F418756

General Info

Members Datasets Scaffolds Average Seq Length
351 245 702 160

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0036165|Ga0495629_0036165_1112_1702
Length 186
Sequence MTGADAAEGAAATSPPDPRTRRALAVTASNRAAAGVYEDRGGPLIVAALRDLGFAVDGPSVVPDGEPVGQVLRDAVAAGYDLVVTTGGTGISPTDRTPEVTRAVLDYEIPGIAEAIRAAGSVKVPTAVLSRGVAGVAGRTLVVNLPGSTGGVKDGLAVLVPLVVHAVDQINGGDHPNVHSVSGRPS

Samples

Sample ID Description Type Environment
1 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
131 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
137 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
150 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
224 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
225 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
226 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
227 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
228 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
229 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
230 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
231 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
232 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
233 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
234 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
235 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
236 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
237 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
238 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
239 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
240 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
241 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
242 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
243 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
244 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
245 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.87
Metatranscriptomes 1.42
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0
Rhizoplane 5.98
Rhizosphere 79.77
Stem 0
Stem Tuber 0
Unclassified 3.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495629_0036165 3300046459 Bacteria 3487
2 rootH2_10038076 3300003320 Bacteria 3632
3 rootL2_10139761 3300003322 Bacteria 2232
4 Ga0070658_10001838 3300005327 Bacteria 17860
5 Ga0070658_10075182 3300005327 Bacteria 2771
6 Ga0070683_100791456 3300005329 Bacteria 909
7 Ga0070683_101293109 3300005329 Bacteria 701
8 Ga0070690_100471218 3300005330 Bacteria 935
9 Ga0068869_100105379 3300005334 Bacteria 2138
10 Ga0068868_100558663 3300005338 Bacteria 1009
11 Ga0070660_100059419 3300005339 Bacteria 2965
12 Ga0070687_100037032 3300005343 Bacteria 2436
13 Ga0070661_100548228 3300005344 Bacteria 930
14 Ga0070692_10156093 3300005345 Bacteria 1304
15 Ga0070668_100149609 3300005347 Bacteria 1887
16 Ga0070669_100164588 3300005353 Bacteria 1726
17 Ga0070671_100012654 3300005355 Bacteria 6801
18 Ga0070671_100409166 3300005355 Bacteria 1161
19 Ga0070674_100501619 3300005356 Bacteria 1011
20 Ga0070673_100297335 3300005364 Bacteria 1420
21 Ga0070659_100069007 3300005366 Bacteria 2805
22 Ga0070709_10070833 3300005434 Bacteria 2249
23 Ga0070709_10129562 3300005434 Bacteria 1720
24 Ga0070714_100059913 3300005435 Bacteria 3265
25 Ga0070714_100076027 3300005435 Bacteria 2915
26 Ga0070713_100481024 3300005436 Bacteria 1170
27 Ga0070713_101331143 3300005436 Bacteria 696
28 Ga0070710_10372756 3300005437 Bacteria 950
29 Ga0070701_10232463 3300005438 Bacteria 1105
30 Ga0070700_100132579 3300005441 Bacteria 1683
31 Ga0070694_100017096 3300005444 Bacteria 4578
32 Ga0070663_100416206 3300005455 Bacteria 1102
33 Ga0070678_100358673 3300005456 Bacteria 1255
34 Ga0070662_100168797 3300005457 Bacteria 1717
35 Ga0068867_100437103 3300005459 Bacteria 1112
36 Ga0070698_100627999 3300005471 Bacteria 1015
37 Ga0070679_100373385 3300005530 Bacteria 1373
38 Ga0070679_101028451 3300005530 Bacteria 768
39 Ga0068853_100056802 3300005539 Bacteria 3376
40 Ga0068853_100164223 3300005539 Bacteria 2005
41 Ga0070695_100090629 3300005545 Bacteria 2041
42 Ga0070696_100320518 3300005546 Bacteria 1193
43 Ga0070693_100103922 3300005547 Bacteria 1735
44 Ga0070665_100992856 3300005548 Bacteria 852
45 Ga0068855_100123726 3300005563 Bacteria 2959
46 Ga0068855_100952074 3300005563 Bacteria 904
47 Ga0070664_100480523 3300005564 Bacteria 1143
48 Ga0068857_100181696 3300005577 Bacteria 1914
49 Ga0068857_100537624 3300005577 Bacteria 1100
50 Ga0068854_100000001 3300005578 Bacteria 608908
51 Ga0068854_100030853 3300005578 Bacteria 3721
52 Ga0068856_100001208 3300005614 Bacteria 27101
53 Ga0068856_100067619 3300005614 Bacteria 3531
54 Ga0068856_100150871 3300005614 Bacteria 2333
55 Ga0068856_100547783 3300005614 Bacteria 1178
56 Ga0070702_100745233 3300005615 Bacteria 752
57 Ga0068864_100003372 3300005618 Bacteria 13209
58 Ga0068864_100011307 3300005618 Bacteria 7374
59 Ga0068866_10056070 3300005718 Bacteria 2026
60 Ga0068851_10269203 3300005834 Bacteria 971
61 Ga0068870_10037604 3300005840 Bacteria 2496
62 Ga0068863_100023609 3300005841 Bacteria 5871
63 Ga0068863_100047495 3300005841 Bacteria 4071
64 Ga0068858_100040398 3300005842 Bacteria 4325
65 Ga0068858_100637712 3300005842 Bacteria 1035
66 Ga0068860_100588764 3300005843 Bacteria 1117
67 Ga0068862_100344194 3300005844 Bacteria 1382
68 Ga0081455_10002105 3300005937 Bacteria 23723
69 Ga0081540_1017906 3300005983 Bacteria 4367
70 Ga0081540_1024287 3300005983 Bacteria 3520
71 Ga0070717_10142717 3300006028 Bacteria 2066
72 Ga0070715_10373463 3300006163 Bacteria 785
73 Ga0070716_100010670 3300006173 Bacteria 4613
74 Ga0070716_101123049 3300006173 Bacteria 628
75 Ga0070712_100216435 3300006175 Bacteria 1514
76 Ga0070712_100346529 3300006175 Bacteria 1214
77 Ga0075433_10343908 3300006852 Bacteria 1318
78 Ga0068865_100144400 3300006881 Bacteria 1798
79 Ga0075436_100022504 3300006914 Bacteria 4329
80 Ga0075435_100290627 3300007076 Bacteria 1396
81 Ga0105240_10042383 3300009093 Bacteria 5800
82 Ga0111539_10113028 3300009094 Bacteria 3186
83 Ga0105245_10034032 3300009098 Bacteria 4517
84 Ga0105245_10095806 3300009098 Bacteria 2738
85 Ga0105241_10015507 3300009174 Bacteria 5585
86 Ga0105241_11348002 3300009174 Bacteria 681
87 Ga0105248_10041877 3300009177 Bacteria 5135
88 Ga0105237_10116186 3300009545 Bacteria 2669
89 Ga0105238_10031571 3300009551 Bacteria 5393
90 Ga0105249_10226150 3300009553 Bacteria 1843
91 Ga0157373_10090667 3300013100 Bacteria 2153
92 Ga0157370_10033696 3300013104 Bacteria 4992
93 Ga0157374_10075759 3300013296 Bacteria 3179
94 Ga0157374_11074443 3300013296 Bacteria 825
95 Ga0163163_10098476 3300014325 Bacteria 2945
96 Ga0163163_10388276 3300014325 Bacteria 1454
97 Ga0157377_10213778 3300014745 Bacteria 1231
98 Ga0157379_10037710 3300014968 Bacteria 4311
99 Ga0157376_10137660 3300014969 Bacteria 2187
100 Ga0163161_10131570 3300017792 Bacteria 1888
101 Ga0197907_10436710 3300020069 Bacteria 2838
102 Ga0197907_11269527 3300020069 Bacteria 795
103 Ga0206356_11299697 3300020070 Bacteria 8404
104 Ga0206354_10516831 3300020081 Bacteria 1306
105 Ga0213872_10004205 3300021361 Bacteria 7727
106 Ga0213872_10030020 3300021361 Bacteria 2493
107 Ga0213874_10040681 3300021377 Bacteria 1389
108 Ga0213876_10511002 3300021384 Unclassified 639
109 Ga0213875_10000485 3300021388 Bacteria 33939
110 Ga0213875_10008775 3300021388 Bacteria 5161
111 Ga0213875_10063589 3300021388 Bacteria 1725
112 Ga0224712_10205816 3300022467 Bacteria 896
113 Ga0207656_10139010 3300025321 Bacteria 1144
114 Ga0207692_10312189 3300025898 Bacteria 960
115 Ga0207642_10020443 3300025899 Bacteria 2584
116 Ga0207710_10171876 3300025900 Bacteria 1060
117 Ga0207688_10021531 3300025901 Bacteria 3524
118 Ga0207688_10946512 3300025901 Bacteria 545
119 Ga0207647_10038380 3300025904 Bacteria 3028
120 Ga0207699_10071809 3300025906 Bacteria 2118
121 Ga0207705_10009041 3300025909 Bacteria 7259
122 Ga0207705_10124350 3300025909 Bacteria 1916
123 Ga0207654_10158916 3300025911 Bacteria 1458
124 Ga0207654_10334509 3300025911 Bacteria 1039
125 Ga0207654_10712712 3300025911 Bacteria 721
126 Ga0207671_10038861 3300025914 Bacteria 3526
127 Ga0207671_10613455 3300025914 Bacteria 867
128 Ga0207693_10008521 3300025915 Bacteria 8393
129 Ga0207693_10112841 3300025915 Bacteria 2132
130 Ga0207663_10284502 3300025916 Bacteria 1229
131 Ga0207660_10407988 3300025917 Bacteria 1095
132 Ga0207662_10065910 3300025918 Bacteria 2181
133 Ga0207657_10013189 3300025919 Bacteria 8115
134 Ga0207649_10643308 3300025920 Bacteria 819
135 Ga0207646_10598318 3300025922 Bacteria 990
136 Ga0207681_10804860 3300025923 Bacteria 785
137 Ga0207694_10306586 3300025924 Bacteria 1308
138 Ga0207694_11293648 3300025924 Bacteria 617
139 Ga0207687_10336687 3300025927 Bacteria 1226
140 Ga0207687_10349732 3300025927 Bacteria 1204
141 Ga0207700_11054676 3300025928 Bacteria 727
142 Ga0207700_11506782 3300025928 Bacteria 597
143 Ga0207664_10347573 3300025929 Bacteria 1312
144 Ga0207664_10460963 3300025929 Bacteria 1135
145 Ga0207706_10015971 3300025933 Bacteria 6785
146 Ga0207704_10021393 3300025938 Bacteria 3444
147 Ga0207691_10092200 3300025940 Bacteria 2713
148 Ga0207711_10165097 3300025941 Bacteria 2006
149 Ga0207711_10166933 3300025941 Bacteria 1995
150 Ga0207689_10076876 3300025942 Bacteria 2744
151 Ga0207661_10789634 3300025944 Bacteria 874
152 Ga0207679_10252598 3300025945 Bacteria 1500
153 Ga0207679_10462866 3300025945 Bacteria 1126
154 Ga0207667_10240264 3300025949 Bacteria 1854
155 Ga0207667_10892607 3300025949 Bacteria 881
156 Ga0207712_10104086 3300025961 Bacteria 2116
157 Ga0207668_10928589 3300025972 Bacteria 775
158 Ga0207640_10000005 3300025981 Bacteria 408618
159 Ga0207640_10166942 3300025981 Bacteria 1635
160 Ga0207677_10055841 3300026023 Bacteria 2702
161 Ga0207677_10703280 3300026023 Bacteria 897
162 Ga0207703_10237702 3300026035 Bacteria 1636
163 Ga0207639_10043128 3300026041 Bacteria 3385
164 Ga0207678_10018813 3300026067 Bacteria 6067
165 Ga0207708_10084091 3300026075 Bacteria 2447
166 Ga0207702_10020303 3300026078 Bacteria 5503
167 Ga0207702_10973688 3300026078 Bacteria 841
168 Ga0207641_10421216 3300026088 Bacteria 1286
169 Ga0207676_10008389 3300026095 Bacteria 7345
170 Ga0207676_10332207 3300026095 Bacteria 1399
171 Ga0207675_100058423 3300026118 Bacteria 3599
172 Ga0207683_10044257 3300026121 Bacteria 3892
173 Ga0265356_1000855 3300028017 Bacteria 4998
174 Ga0307517_10012629 3300028786 Bacteria 11567
175 Ga0307511_10125851 3300030521 Bacteria 1564
176 Ga0307509_10298154 3300031507 Bacteria 1362
177 Ga0307508_10083064 3300031616 Bacteria 2785
178 Ga0307508_10110766 3300031616 Bacteria 2345
179 Ga0316576_10028755 3300031727 Bacteria 3922
180 Ga0307516_10303508 3300031730 Bacteria 1272
181 Ga0307510_10231433 3300033180 Bacteria 1350
182 Ga0373928_0025305 3300035084 Bacteria 1279
183 Ga0373951_0182796 3300035091 Bacteria 603
184 Ga0316574_0308011 3300035398 Bacteria 1007
185 Ga0373931_0010660 3300035691 Bacteria 4421
186 Ga0373937_1414015 3300036401 Bacteria 643
187 Ga0373925_0449276 3300037068 Bacteria 1055
188 Ga0373925_0604461 3300037068 Bacteria 903
189 Ga0395899_0010761 3300037312 Bacteria 7013
190 Ga0395900_0022400 3300037418 Bacteria 6461
191 Ga0395898_0066674 3300037466 Bacteria 3486
192 Ga0395905_0691912 3300037471 Bacteria 922
193 Ga0436364_0032410 3300037853 Unclassified 840
194 Ga0436364_0117635 3300037853 Bacteria 37947
195 Ga0436364_0707244 3300037853 Bacteria 16516
196 Ga0436364_1080633 3300037853 Bacteria 5487
197 Ga0436364_1528988 3300037853 Bacteria 1826
198 Ga0395901_0461092 3300038443 Bacteria 1298
199 Ga0436365_0269238 3300039437 Bacteria 925
200 Ga0436365_0540769 3300039437 Bacteria 2099
201 Ga0436365_1052259 3300039437 Bacteria 2630
202 Ga0436365_1925848 3300039437 Unclassified 836
203 Ga0436360_0579326 3300039438 Unclassified 937
204 Ga0436360_0757494 3300039438 Unclassified 2944
205 Ga0436360_1270349 3300039438 Unclassified 680
206 Ga0436361_0939205 3300039447 Bacteria 35500
207 Ga0436361_0949134 3300039447 Unclassified 778
208 Ga0436363_0675512 3300039450 Bacteria 7638
209 Ga0436363_1153476 3300039450 Bacteria 1152
210 Ga0436363_1242378 3300039450 Bacteria 1067
211 Ga0436363_1424123 3300039450 Bacteria 1302
212 Ga0436362_0415382 3300039453 Bacteria 912
213 Ga0436362_0578506 3300039453 Bacteria 1706
214 Ga0436362_0818323 3300039453 Bacteria 904
215 Ga0436362_1084754 3300039453 Bacteria 654
216 Ga0436362_1247961 3300039453 Unclassified 805
217 Ga0466969_0014583 3300044656 Bacteria 4131
218 Ga0466966_0021808 3300044684 Bacteria 4204
219 Ga0466966_0128333 3300044684 Bacteria 1554
220 Ga0466961_0014964 3300044693 Bacteria 4981
221 Ga0466961_0056035 3300044693 Bacteria 2512
222 Ga0466961_0111531 3300044693 Bacteria 1720
223 Ga0466963_0017948 3300044694 Bacteria 4415
224 Ga0466963_0036777 3300044694 Bacteria 3194
225 Ga0466963_0132940 3300044694 Bacteria 1720
226 Ga0466963_0500546 3300044694 Bacteria 858
227 Ga0466963_0516568 3300044694 Unclassified 843
228 Ga0466971_0062244 3300044719 Bacteria 1688
229 Ga0466970_0186030 3300044765 Bacteria 1153
230 Ga0466957_0125304 3300044842 Bacteria 1641
231 Ga0466959_0044343 3300045049 Bacteria 3277
232 Ga0466958_0085695 3300045836 Bacteria 1943
233 Ga0466958_0248052 3300045836 Bacteria 1138
234 Ga0466958_0433486 3300045836 Unclassified 850
235 Ga0466967_0143882 3300045976 Bacteria 2223
236 Ga0466967_0226922 3300045976 Bacteria 1777
237 Ga0466967_0265305 3300045976 Bacteria 1644
238 Ga0466967_1255466 3300045976 Bacteria 738
239 Ga0495592_0066683 3300046454 Bacteria 2633
240 Ga0495603_0367203 3300046455 Bacteria 826
241 Ga0495629_0027291 3300046459 Bacteria 4054
242 Ga0495629_0055407 3300046459 Bacteria 2772
243 Ga0495629_0255750 3300046459 Bacteria 1204
244 Ga0495641_0033660 3300046461 Bacteria 2430
245 Ga0495651_0096891 3300046462 Bacteria 2203
246 Ga0495582_0241696 3300046473 Bacteria 1035
247 Ga0495662_0186524 3300046476 Bacteria 1022
248 Ga0495585_0144639 3300046492 Bacteria 1243
249 Ga0495594_0167312 3300046499 Bacteria 1250
250 Ga0495618_0029640 3300046514 Bacteria 3414
251 Ga0495628_0091482 3300046516 Bacteria 2354
252 Ga0495628_0152592 3300046516 Bacteria 1759
253 Ga0495630_0546234 3300046517 Bacteria 888
254 Ga0495637_0081547 3300046520 Bacteria 1289
255 Ga0495643_0001988 3300046522 Bacteria 17097
256 Ga0495643_0382208 3300046522 Bacteria 624
257 Ga0495640_0003642 3300046533 Bacteria 12373
258 Ga0495622_0035074 3300046557 Bacteria 2340
259 Ga0495667_0112046 3300046559 Bacteria 1763
260 Ga0495634_0092956 3300046642 Bacteria 1956
261 Ga0495634_0184916 3300046642 Bacteria 1303
262 Ga0495588_0079949 3300046674 Bacteria 1706
263 Ga0495657_0032742 3300046675 Bacteria 3625
264 Ga0495599_0018844 3300046678 Bacteria 4302
265 Ga0495658_0050969 3300046683 Bacteria 2343
266 Ga0495613_0005985 3300046689 Bacteria 9102
267 Ga0495613_0134572 3300046689 Bacteria 1769
268 Ga0495624_0080698 3300046690 Bacteria 2016
269 Ga0495670_0037061 3300046691 Bacteria 2430
270 Ga0495589_0051229 3300046794 Bacteria 2041
271 Ga0495600_0052363 3300046809 Bacteria 2666
272 Ga0495660_0035403 3300046810 Bacteria 2789
273 Ga0495604_0047044 3300047317 Bacteria 3361
274 Ga0495676_0020370 3300047321 Bacteria 5818
275 Ga0495680_0375970 3300047322 Bacteria 985
276 Ga0495683_0055835 3300047323 Bacteria 1965
277 Ga0495675_0050456 3300047444 Bacteria 2645
278 Ga0495685_000281 3300047447 Bacteria 17023
279 Ga0495681_0008117 3300047470 Bacteria 6611
280 Ga0495686_0074537 3300047472 Bacteria 2082
281 Ga0496104_0054670 3300048907 Bacteria 3774
282 Ga0496105_0002297 3300048908 Bacteria 13868
283 Ga0496105_0067883 3300048908 Bacteria 2945
284 Ga0496105_0280015 3300048908 Bacteria 1345
285 Ga0496105_0337484 3300048908 Bacteria 1205
286 Ga0496106_0233908 3300048909 Bacteria 1467
287 Ga0496106_1183467 3300048909 Bacteria 597
288 Ga0496108_0009539 3300048911 Bacteria 7866
289 Ga0496108_0155157 3300048911 Bacteria 1977
290 Ga0496108_0186170 3300048911 Bacteria 1798
291 Ga0496109_0009011 3300048912 Bacteria 8499
292 Ga0496109_0126668 3300048912 Bacteria 2381
293 Ga0496110_0003471 3300048913 Bacteria 12088
294 Ga0496110_0274295 3300048913 Bacteria 1535
295 Ga0496111_0016338 3300048914 Bacteria 5113
296 Ga0496112_0040843 3300048915 Bacteria 4536
297 Ga0496113_0037474 3300048916 Bacteria 3558
298 Ga0496113_0119363 3300048916 Bacteria 2060
299 Ga0496114_0280598 3300048917 Bacteria 1469
300 Ga0496114_0897204 3300048917 Bacteria 767
301 Ga0496115_0189467 3300048918 Bacteria 1699
302 Ga0501031_0064818 3300049568 Bacteria 2380
303 Ga0501031_0254310 3300049568 Bacteria 1142
304 Ga0501032_0087920 3300049569 Bacteria 2063
305 Ga0501034_0204477 3300049571 Bacteria 1931
306 Ga0501034_0278772 3300049571 Bacteria 1611
307 Ga0501038_0049355 3300049574 Bacteria 3639
308 Ga0501038_0121327 3300049574 Bacteria 2155
309 Ga0501039_0234391 3300049575 Bacteria 1443
310 Ga0501043_0008487 3300049579 Bacteria 8088
311 Ga0501043_0120388 3300049579 Bacteria 2058
312 Ga0501043_0304806 3300049579 Bacteria 1216
313 Ga0501046_0243009 3300049580 Bacteria 1327
314 Ga0501046_0600336 3300049580 Bacteria 781
315 Ga0501047_0064671 3300049581 Bacteria 3528
316 Ga0501047_0197915 3300049581 Bacteria 1871
317 Ga0501035_0014232 3300049822 Bacteria 7342
318 Ga0501035_0064392 3300049822 Bacteria 3258
319 Ga0501035_0157507 3300049822 Bacteria 1967
320 Ga0501035_0334264 3300049822 Bacteria 1270
321 Ga0501044_0019266 3300049823 Bacteria 7302
322 Ga0501044_0371542 3300049823 Bacteria 1346
323 Ga0501044_0669414 3300049823 Bacteria 925
324 nmdc:mga0rr50_291356_c1 3300050513 Bacteria 1364
325 Ga0500646_0000035 3300053090 Bacteria 39442
326 Ga0500583_0005205 3300053092 Bacteria 4335
327 Ga0500641_0021744 3300053096 Bacteria 2450
328 Ga0500654_062088 3300053099 Bacteria 1903
329 Ga0500660_025437 3300053100 Bacteria 3127
330 Ga0500553_039882 3300053101 Bacteria 2307
331 Ga0500560_011275 3300053107 Bacteria 2274
332 Ga0500594_0025635 3300053118 Bacteria 1513
333 Ga0500614_060607 3300053123 Bacteria 1017
334 Ga0500628_003333 3300053129 Bacteria 2649
335 Ga0500652_028039 3300053131 Bacteria 2183
336 Ga0500658_0101816 3300053134 Bacteria 1254
337 Ga0500573_0052312 3300053140 Bacteria 2348
338 Ga0500588_0005522 3300053146 Bacteria 2813
339 Ga0500616_0108335 3300053153 Unclassified 1346
340 Ga0500633_0077390 3300053160 Bacteria 1198
341 Ga0500634_0063386 3300053161 Bacteria 1955
342 Ga0500656_001982 3300053732 Bacteria 1817
343 Ga0500587_003630 3300053739 Bacteria 2147
344 Ga0466962_0028089 3300061719 Bacteria 2696
345 Ga0466962_0213859 3300061719 Bacteria 943
346 2586057852 2585427649 Bacteria 9053857
347 2729908351 2728369276 Bacteria 5610032
348 2753269702 2751185782 Bacteria 11227053
349 2809593314 2808606522 Bacteria 9488490
350 2839986771 2839986021 Bacteria 3685650
351 2915768870 2915768154 Bacteria 8424322
352 Ga0495629_0036165
353 rootH2_10038076
354 rootL2_10139761
355 Ga0070658_10001838
356 Ga0070658_10075182
357 Ga0070683_100791456
358 Ga0070683_101293109
359 Ga0070690_100471218
360 Ga0068869_100105379
361 Ga0068868_100558663
362 Ga0070660_100059419
363 Ga0070687_100037032
364 Ga0070661_100548228
365 Ga0070692_10156093
366 Ga0070668_100149609
367 Ga0070669_100164588
368 Ga0070671_100012654
369 Ga0070671_100409166
370 Ga0070674_100501619
371 Ga0070673_100297335
372 Ga0070659_100069007
373 Ga0070709_10070833
374 Ga0070709_10129562
375 Ga0070714_100059913
376 Ga0070714_100076027
377 Ga0070713_100481024
378 Ga0070713_101331143
379 Ga0070710_10372756
380 Ga0070701_10232463
381 Ga0070700_100132579
382 Ga0070694_100017096
383 Ga0070663_100416206
384 Ga0070678_100358673
385 Ga0070662_100168797
386 Ga0068867_100437103
387 Ga0070698_100627999
388 Ga0070679_100373385
389 Ga0070679_101028451
390 Ga0068853_100056802
391 Ga0068853_100164223
392 Ga0070695_100090629
393 Ga0070696_100320518
394 Ga0070693_100103922
395 Ga0070665_100992856
396 Ga0068855_100123726
397 Ga0068855_100952074
398 Ga0070664_100480523
399 Ga0068857_100181696
400 Ga0068857_100537624
401 Ga0068854_100000001
402 Ga0068854_100030853
403 Ga0068856_100001208
404 Ga0068856_100067619
405 Ga0068856_100150871
406 Ga0068856_100547783
407 Ga0070702_100745233
408 Ga0068864_100003372
409 Ga0068864_100011307
410 Ga0068866_10056070
411 Ga0068851_10269203
412 Ga0068870_10037604
413 Ga0068863_100023609
414 Ga0068863_100047495
415 Ga0068858_100040398
416 Ga0068858_100637712
417 Ga0068860_100588764
418 Ga0068862_100344194
419 Ga0081455_10002105
420 Ga0081540_1017906
421 Ga0081540_1024287
422 Ga0070717_10142717
423 Ga0070715_10373463
424 Ga0070716_100010670
425 Ga0070716_101123049
426 Ga0070712_100216435
427 Ga0070712_100346529
428 Ga0075433_10343908
429 Ga0068865_100144400
430 Ga0075436_100022504
431 Ga0075435_100290627
432 Ga0105240_10042383
433 Ga0111539_10113028
434 Ga0105245_10034032
435 Ga0105245_10095806
436 Ga0105241_10015507
437 Ga0105241_11348002
438 Ga0105248_10041877
439 Ga0105237_10116186
440 Ga0105238_10031571
441 Ga0105249_10226150
442 Ga0157373_10090667
443 Ga0157370_10033696
444 Ga0157374_10075759
445 Ga0157374_11074443
446 Ga0163163_10098476
447 Ga0163163_10388276
448 Ga0157377_10213778
449 Ga0157379_10037710
450 Ga0157376_10137660
451 Ga0163161_10131570
452 Ga0197907_10436710
453 Ga0197907_11269527
454 Ga0206356_11299697
455 Ga0206354_10516831
456 Ga0213872_10004205
457 Ga0213872_10030020
458 Ga0213874_10040681
459 Ga0213876_10511002
460 Ga0213875_10000485
461 Ga0213875_10008775
462 Ga0213875_10063589
463 Ga0224712_10205816
464 Ga0207656_10139010
465 Ga0207692_10312189
466 Ga0207642_10020443
467 Ga0207710_10171876
468 Ga0207688_10021531
469 Ga0207688_10946512
470 Ga0207647_10038380
471 Ga0207699_10071809
472 Ga0207705_10009041
473 Ga0207705_10124350
474 Ga0207654_10158916
475 Ga0207654_10334509
476 Ga0207654_10712712
477 Ga0207671_10038861
478 Ga0207671_10613455
479 Ga0207693_10008521
480 Ga0207693_10112841
481 Ga0207663_10284502
482 Ga0207660_10407988
483 Ga0207662_10065910
484 Ga0207657_10013189
485 Ga0207649_10643308
486 Ga0207646_10598318
487 Ga0207681_10804860
488 Ga0207694_10306586
489 Ga0207694_11293648
490 Ga0207687_10336687
491 Ga0207687_10349732
492 Ga0207700_11054676
493 Ga0207700_11506782
494 Ga0207664_10347573
495 Ga0207664_10460963
496 Ga0207706_10015971
497 Ga0207704_10021393
498 Ga0207691_10092200
499 Ga0207711_10165097
500 Ga0207711_10166933
501 Ga0207689_10076876
502 Ga0207661_10789634
503 Ga0207679_10252598
504 Ga0207679_10462866
505 Ga0207667_10240264
506 Ga0207667_10892607
507 Ga0207712_10104086
508 Ga0207668_10928589
509 Ga0207640_10000005
510 Ga0207640_10166942
511 Ga0207677_10055841
512 Ga0207677_10703280
513 Ga0207703_10237702
514 Ga0207639_10043128
515 Ga0207678_10018813
516 Ga0207708_10084091
517 Ga0207702_10020303
518 Ga0207702_10973688
519 Ga0207641_10421216
520 Ga0207676_10008389
521 Ga0207676_10332207
522 Ga0207675_100058423
523 Ga0207683_10044257
524 Ga0265356_1000855
525 Ga0307517_10012629
526 Ga0307511_10125851
527 Ga0307509_10298154
528 Ga0307508_10083064
529 Ga0307508_10110766
530 Ga0316576_10028755
531 Ga0307516_10303508
532 Ga0307510_10231433
533 Ga0373928_0025305
534 Ga0373951_0182796
535 Ga0316574_0308011
536 Ga0373931_0010660
537 Ga0373937_1414015
538 Ga0373925_0449276
539 Ga0373925_0604461
540 Ga0395899_0010761
541 Ga0395900_0022400
542 Ga0395898_0066674
543 Ga0395905_0691912
544 Ga0436364_0032410
545 Ga0436364_0117635
546 Ga0436364_0707244
547 Ga0436364_1080633
548 Ga0436364_1528988
549 Ga0395901_0461092
550 Ga0436365_0269238
551 Ga0436365_0540769
552 Ga0436365_1052259
553 Ga0436365_1925848
554 Ga0436360_0579326
555 Ga0436360_0757494
556 Ga0436360_1270349
557 Ga0436361_0939205
558 Ga0436361_0949134
559 Ga0436363_0675512
560 Ga0436363_1153476
561 Ga0436363_1242378
562 Ga0436363_1424123
563 Ga0436362_0415382
564 Ga0436362_0578506
565 Ga0436362_0818323
566 Ga0436362_1084754
567 Ga0436362_1247961
568 Ga0466969_0014583
569 Ga0466966_0021808
570 Ga0466966_0128333
571 Ga0466961_0014964
572 Ga0466961_0056035
573 Ga0466961_0111531
574 Ga0466963_0017948
575 Ga0466963_0036777
576 Ga0466963_0132940
577 Ga0466963_0500546
578 Ga0466963_0516568
579 Ga0466971_0062244
580 Ga0466970_0186030
581 Ga0466957_0125304
582 Ga0466959_0044343
583 Ga0466958_0085695
584 Ga0466958_0248052
585 Ga0466958_0433486
586 Ga0466967_0143882
587 Ga0466967_0226922
588 Ga0466967_0265305
589 Ga0466967_1255466
590 Ga0495592_0066683
591 Ga0495603_0367203
592 Ga0495629_0027291
593 Ga0495629_0055407
594 Ga0495629_0255750
595 Ga0495641_0033660
596 Ga0495651_0096891
597 Ga0495582_0241696
598 Ga0495662_0186524
599 Ga0495585_0144639
600 Ga0495594_0167312
601 Ga0495618_0029640
602 Ga0495628_0091482
603 Ga0495628_0152592
604 Ga0495630_0546234
605 Ga0495637_0081547
606 Ga0495643_0001988
607 Ga0495643_0382208
608 Ga0495640_0003642
609 Ga0495622_0035074
610 Ga0495667_0112046
611 Ga0495634_0092956
612 Ga0495634_0184916
613 Ga0495588_0079949
614 Ga0495657_0032742
615 Ga0495599_0018844
616 Ga0495658_0050969
617 Ga0495613_0005985
618 Ga0495613_0134572
619 Ga0495624_0080698
620 Ga0495670_0037061
621 Ga0495589_0051229
622 Ga0495600_0052363
623 Ga0495660_0035403
624 Ga0495604_0047044
625 Ga0495676_0020370
626 Ga0495680_0375970
627 Ga0495683_0055835
628 Ga0495675_0050456
629 Ga0495685_000281
630 Ga0495681_0008117
631 Ga0495686_0074537
632 Ga0496104_0054670
633 Ga0496105_0002297
634 Ga0496105_0067883
635 Ga0496105_0280015
636 Ga0496105_0337484
637 Ga0496106_0233908
638 Ga0496106_1183467
639 Ga0496108_0009539
640 Ga0496108_0155157
641 Ga0496108_0186170
642 Ga0496109_0009011
643 Ga0496109_0126668
644 Ga0496110_0003471
645 Ga0496110_0274295
646 Ga0496111_0016338
647 Ga0496112_0040843
648 Ga0496113_0037474
649 Ga0496113_0119363
650 Ga0496114_0280598
651 Ga0496114_0897204
652 Ga0496115_0189467
653 Ga0501031_0064818
654 Ga0501031_0254310
655 Ga0501032_0087920
656 Ga0501034_0204477
657 Ga0501034_0278772
658 Ga0501038_0049355
659 Ga0501038_0121327
660 Ga0501039_0234391
661 Ga0501043_0008487
662 Ga0501043_0120388
663 Ga0501043_0304806
664 Ga0501046_0243009
665 Ga0501046_0600336
666 Ga0501047_0064671
667 Ga0501047_0197915
668 Ga0501035_0014232
669 Ga0501035_0064392
670 Ga0501035_0157507
671 Ga0501035_0334264
672 Ga0501044_0019266
673 Ga0501044_0371542
674 Ga0501044_0669414
675 nmdc:mga0rr50_291356_c1
676 Ga0500646_0000035
677 Ga0500583_0005205
678 Ga0500641_0021744
679 Ga0500654_062088
680 Ga0500660_025437
681 Ga0500553_039882
682 Ga0500560_011275
683 Ga0500594_0025635
684 Ga0500614_060607
685 Ga0500628_003333
686 Ga0500652_028039
687 Ga0500658_0101816
688 Ga0500573_0052312
689 Ga0500588_0005522
690 Ga0500616_0108335
691 Ga0500633_0077390
692 Ga0500634_0063386
693 Ga0500656_001982
694 Ga0500587_003630
695 Ga0466962_0028089
696 Ga0466962_0213859
697 2586057852
698 2729908351
699 2753269702
700 2809593314
701 2839986771
702 2915768870

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

24

165

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g4r-assembly1.cif.gz_B anomalous substructure of moga 0.9888 7 155
4twg-assembly2.cif.gz_F the structure of the molybdopterin biosynthesis mog protein from mycobacterium ulcerans 0.9777 3 158
4twg-assembly2.cif.gz_F the structure of the molybdopterin biosynthesis mog protein from mycobacterium ulcerans 0.9714 3 158
3oi9-assembly1.cif.gz_A crystal structure of molybdenum cofactor synthesis domain from mycobacterium avium 0.9702 7 158
4twg-assembly1.cif.gz_A the structure of the molybdopterin biosynthesis mog protein from mycobacterium ulcerans 0.9694 6 155
ID Description Score Start End Superfamily
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.97 2 156 3.40.980.10
af_O53897_20_180_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9514 7 155 3.40.980.10
2g4rC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9489 7 155 3.40.980.10
af_A0A1D6DUY2_88_206_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9463 2 95 3.40.980.10
1o8nC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9455 6 158 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A6B3GT62-F1-model_v4 MogA/MoaB family molybdenum cofactor biosynthesis protein 0.9993 12 129 GO:0006777
AF-A0A7W3Y2J7-F1-model_v4 MogA/MoaB family molybdenum cofactor biosynthesis protein 0.9971 1 161 GO:0006777
AF-A0A562WPG1-F1-model_v4 Molybdenum cofactor synthesis domain-containing protein 0.9954 6 160 GO:0006777
AF-C7Q0J0-F1-model_v4 Molybdenum cofactor synthesis domain protein 0.9953 6 160 GO:0006777
AF-A0A1Q9T416-F1-model_v4 deleted 0.9947 6 160

Map