F418750

General Info

Members Datasets Scaffolds Average Seq Length
351 242 702 356

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0005364|Ga0495603_0005364_339_1538
Length 390
Sequence VTTPRRTEHLVLPGVLTAEEAAATVRGILAVQRPDGAIPWFRGHHLDPWDHTEAAMALDAAGEHEAAERAYEWLARHQNEDGSWYAAYADGDFEDVTDRGRETNFVAYIAVGVWHHYLATGDDVFLDRMWPTVYAAMEFVLRLQQSGGQIGWKREDDGTAVDDALLTGSSSVHHALRCALAIAEQREEPQPDWELAVGALRHAIRLHPERFLDKGRYSMDWYYPVLGGALTGAEAKSRIEEGWDRFVVPGLGVRCVVPNPWVTGGESAELALALWVVGESDHALEILQSIQHLRDPQSGLYWTGYVFEDRAVWPEELTTWTAGSLLLAVAALGGDEATCAVFGGERLPGGLDPDCSTPTRRGSGRSWLPGPSGPPAPVSAGAFGWRPRGL

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
3 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
4 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
5 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
10 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
11 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
12 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
13 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
14 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
15 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
16 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
17 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
23 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
25 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
26 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
29 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
30 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
31 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
32 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
33 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
34 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
35 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
36 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
41 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
42 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
43 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
44 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
45 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
46 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
47 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
50 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
51 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
52 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
53 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
54 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
55 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
93 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
106 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
109 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
119 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
120 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
124 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
145 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
146 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
147 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
148 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
149 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
152 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
157 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
158 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
159 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
160 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
161 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
162 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
163 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
164 2643221548 Streptomyces sp. Root55 Isolate Unclassified
165 2643221578 Streptomyces sp. Root63 Isolate Unclassified
166 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
167 2643221670 Streptomyces sp. Root431 Isolate Unclassified
168 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
169 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
170 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
171 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
172 2643221714 Streptomyces sp. Root264 Isolate Unclassified
173 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
174 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
175 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
176 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
177 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
178 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
179 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
180 2808606448 Streptomyces sp. 193411 Isolate Unclassified
181 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
182 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
183 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
184 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
185 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
186 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
187 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
188 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
189 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
190 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
191 2862574272 Streptomyces sp. AcE210 Isolate Nodule
192 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
193 2867369537 Streptomyces sp. Z26 Isolate Unclassified
194 2867428634 Streptomyces sp. RP5T Isolate Unclassified
195 2867475112 Streptomyces sp. TM32 Isolate Unclassified
196 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
197 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
198 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
199 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
200 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
201 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
202 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
203 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
204 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
205 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
206 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
207 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
208 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
209 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
210 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
211 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
212 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
213 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
214 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
215 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
216 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
217 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
218 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
219 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
220 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
221 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
222 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
223 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
224 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
225 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
226 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
227 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
228 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
229 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
230 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
231 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
232 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
233 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
234 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
235 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
236 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
237 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
238 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
239 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
240 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
241 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
242 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.21
Metatranscriptomes 0.28
Isolates 24.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.27
Nodule 1.14
Rhizoplane 0.85
Rhizosphere 75.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0005364 3300046455 Bacteria 7645
2 Ga0006562J51391_1056593 3300003578 Bacteria 3189
3 Ga0070665_100133213 3300005548 Bacteria 2487
4 Ga0075368_10008797 3300006042 Bacteria 3614
5 Ga0075363_100027346 3300006048 Bacteria 2924
6 Ga0075363_100115463 3300006048 Bacteria 1495
7 Ga0075367_10001474 3300006178 Bacteria 10157
8 Ga0099826_10069165 3300006948 Bacteria 2251
9 Ga0105251_10015861 3300009011 Bacteria 4099
10 Ga0105243_10299999 3300009148 Bacteria 1456
11 Ga0105243_10399206 3300009148 Bacteria 1277
12 Ga0105249_10552742 3300009553 Bacteria 1202
13 Ga0105246_10001826 3300011119 Bacteria 12758
14 Ga0157375_10391886 3300013308 Bacteria 1556
15 Ga0182008_10013290 3300014497 Bacteria 4329
16 Ga0182006_1018053 3300015261 Bacteria 2986
17 Ga0182007_10002701 3300015262 Bacteria 8678
18 Ga0183367_1009 3300015688 Bacteria 484598
19 Ga0209758_1005416 3300025297 Bacteria 9846
20 Ga0207426_1001425 3300025302 Bacteria 19931
21 Ga0207426_1003866 3300025302 Bacteria 7720
22 Ga0207426_1008311 3300025302 Bacteria 4212
23 Ga0207713_1036936 3300025735 Bacteria 2089
24 Ga0207647_10068054 3300025904 Bacteria 2156
25 Ga0207702_10097995 3300026078 Bacteria 2581
26 Ga0209813_10063870 3300027866 Bacteria 1182
27 Ga0268266_10077572 3300028379 Bacteria 2889
28 Ga0307517_10002663 3300028786 Bacteria 28525
29 Ga0307517_10012808 3300028786 Bacteria 11463
30 Ga0307515_10000140 3300028794 Bacteria 172330
31 Ga0307515_10041444 3300028794 Bacteria 7239
32 Ga0307511_10001791 3300030521 Bacteria 22601
33 Ga0307511_10106455 3300030521 Bacteria 1810
34 Ga0307512_10080690 3300030522 Bacteria 2340
35 Ga0307513_10011767 3300031456 Bacteria 10847
36 Ga0307513_10037405 3300031456 Bacteria 5402
37 Ga0307513_10221956 3300031456 Bacteria 1710
38 Ga0307509_10190408 3300031507 Bacteria 1903
39 Ga0307508_10073167 3300031616 Bacteria 3002
40 Ga0307508_10090774 3300031616 Bacteria 2642
41 Ga0307514_10029737 3300031649 Bacteria 4389
42 Ga0307514_10084163 3300031649 Bacteria 2342
43 Ga0307514_10107960 3300031649 Bacteria 1981
44 Ga0307516_10031014 3300031730 Bacteria 5392
45 Ga0307516_10067771 3300031730 Bacteria 3438
46 Ga0307518_10163174 3300031838 Bacteria 1528
47 Ga0307410_10076345 3300031852 Bacteria 2339
48 Ga0307507_10014465 3300033179 Bacteria 9404
49 Ga0307507_10070365 3300033179 Bacteria 3174
50 Ga0307507_10232713 3300033179 Bacteria 1219
51 Ga0307510_10003641 3300033180 Bacteria 17980
52 Ga0307510_10041460 3300033180 Bacteria 5032
53 Ga0395899_0106158 3300037312 Bacteria 2023
54 Ga0395898_0006479 3300037466 Bacteria 12502
55 Ga0395898_0011914 3300037466 Bacteria 9006
56 Ga0395901_0104844 3300038443 Bacteria 2967
57 Ga0439436_0001007 3300041404 Bacteria 7853
58 Ga0439439_0009243 3300041406 Bacteria 2341
59 Ga0451853_2246894 3300041512 Bacteria 1448
60 Ga0439433_0008147 3300041999 Bacteria 2269
61 Ga0439448_0001717 3300042005 Bacteria 5779
62 Ga0439448_0024582 3300042005 Bacteria 1885
63 Ga0439448_0027165 3300042005 Bacteria 1803
64 Ga0439449_0000084 3300042007 Bacteria 30447
65 Ga0439449_0007487 3300042007 Bacteria 4148
66 Ga0439449_0056224 3300042007 Bacteria 1453
67 Ga0439450_004257 3300042008 Bacteria 2432
68 Ga0439455_0000168 3300042012 Bacteria 7446
69 Ga0439457_000102 3300042014 Bacteria 19948
70 Ga0439457_000968 3300042014 Bacteria 8648
71 Ga0439457_024881 3300042014 Bacteria 1325
72 Ga0439462_0001601 3300042015 Bacteria 5081
73 Ga0450896_000192 3300042133 Bacteria 5264
74 Ga0450898_002560 3300042134 Bacteria 2547
75 Ga0450900_006390 3300042136 Bacteria 1424
76 Ga0450903_000146 3300042138 Bacteria 15464
77 Ga0450906_002510 3300042145 Bacteria 4011
78 Ga0439458_0000571 3300042157 Bacteria 9489
79 Ga0466969_0004670 3300044656 Bacteria 7297
80 Ga0466969_0055718 3300044656 Bacteria 1933
81 Ga0466972_0000960 3300044658 Bacteria 13846
82 Ga0466972_0031812 3300044658 Bacteria 2593
83 Ga0466965_0003738 3300044683 Bacteria 6716
84 Ga0466966_0002500 3300044684 Bacteria 12047
85 Ga0466966_0019371 3300044684 Bacteria 4477
86 Ga0466961_0007749 3300044693 Bacteria 6837
87 Ga0466963_0000106 3300044694 Bacteria 30236
88 Ga0466963_0001285 3300044694 Bacteria 13333
89 Ga0466964_0007157 3300044706 Bacteria 4171
90 Ga0466971_0000222 3300044719 Bacteria 21742
91 Ga0466970_0003615 3300044765 Bacteria 7539
92 Ga0466970_0004025 3300044765 Bacteria 7218
93 Ga0466957_0047612 3300044842 Bacteria 2605
94 Ga0466960_0013262 3300044901 Bacteria 3497
95 Ga0466959_0026502 3300045049 Bacteria 4296
96 Ga0466958_0000267 3300045836 Bacteria 20182
97 Ga0466958_0046789 3300045836 Bacteria 2611
98 Ga0466967_0005116 3300045976 Bacteria 9012
99 Ga0466967_0030465 3300045976 Bacteria 4528
100 Ga0495627_043962 3300046453 Bacteria 1365
101 Ga0495603_0000345 3300046455 Bacteria 24889
102 Ga0495603_0001197 3300046455 Bacteria 15136
103 Ga0495603_0004361 3300046455 Bacteria 8440
104 Ga0495603_0083523 3300046455 Bacteria 1870
105 Ga0495603_0157207 3300046455 Bacteria 1319
106 Ga0495629_0003931 3300046459 Bacteria 11173
107 Ga0495629_0011690 3300046459 Bacteria 6369
108 Ga0495629_0045298 3300046459 Bacteria 3086
109 Ga0495629_0056591 3300046459 Bacteria 2741
110 Ga0495629_0097756 3300046459 Bacteria 2048
111 Ga0495629_0207545 3300046459 Bacteria 1353
112 Ga0495638_0026368 3300046460 Bacteria 3766
113 Ga0495651_0002933 3300046462 Bacteria 13194
114 Ga0495651_0025772 3300046462 Bacteria 4578
115 Ga0495653_0157204 3300046463 Bacteria 1582
116 Ga0495582_0057066 3300046473 Bacteria 2152
117 Ga0495605_0016508 3300046474 Bacteria 3994
118 Ga0495639_0014271 3300046475 Bacteria 3438
119 Ga0495662_0000441 3300046476 Bacteria 18666
120 Ga0495662_0013227 3300046476 Bacteria 4016
121 Ga0495585_0055294 3300046492 Bacteria 2193
122 Ga0495594_0001380 3300046499 Bacteria 12604
123 Ga0495594_0088335 3300046499 Bacteria 1735
124 Ga0495607_0052714 3300046501 Bacteria 2354
125 Ga0495607_0063352 3300046501 Bacteria 2092
126 Ga0495607_0067680 3300046501 Bacteria 2006
127 Ga0495583_0067976 3300046506 Bacteria 1572
128 Ga0495583_0103702 3300046506 Bacteria 1211
129 Ga0495616_0012501 3300046513 Bacteria 4819
130 Ga0495628_0085085 3300046516 Bacteria 2453
131 Ga0495631_0004787 3300046518 Bacteria 7137
132 Ga0495631_0018608 3300046518 Bacteria 3268
133 Ga0495643_0003567 3300046522 Bacteria 11307
134 Ga0495643_0005056 3300046522 Bacteria 9028
135 Ga0495587_0001775 3300046536 Bacteria 14425
136 Ga0495609_0037861 3300046538 Bacteria 2175
137 Ga0495622_0020445 3300046557 Bacteria 3082
138 Ga0495622_0030028 3300046557 Bacteria 2539
139 Ga0495633_0023552 3300046558 Bacteria 3049
140 Ga0495633_0043107 3300046558 Bacteria 2141
141 Ga0495634_0003766 3300046642 Bacteria 12059
142 Ga0495634_0091882 3300046642 Bacteria 1969
143 Ga0495611_0016038 3300046648 Bacteria 3203
144 Ga0495611_0024323 3300046648 Bacteria 2634
145 Ga0495611_0043450 3300046648 Bacteria 2009
146 Ga0495625_0076184 3300046660 Bacteria 2345
147 Ga0495635_0003573 3300046663 Bacteria 10759
148 Ga0495635_0104533 3300046663 Bacteria 1935
149 Ga0495661_0026877 3300046665 Bacteria 3701
150 Ga0495588_0002164 3300046674 Bacteria 8406
151 Ga0495588_0050106 3300046674 Bacteria 2148
152 Ga0495588_0133196 3300046674 Bacteria 1311
153 Ga0495657_0000757 3300046675 Bacteria 28736
154 Ga0495657_0017683 3300046675 Bacteria 5171
155 Ga0495623_0036559 3300046679 Bacteria 3145
156 Ga0495646_0000627 3300046680 Bacteria 19270
157 Ga0495613_0000544 3300046689 Bacteria 31241
158 Ga0495613_0001099 3300046689 Bacteria 20653
159 Ga0495613_0016148 3300046689 Bacteria 5560
160 Ga0495613_0139290 3300046689 Bacteria 1734
161 Ga0495624_0023744 3300046690 Bacteria 4041
162 Ga0495671_0024682 3300046692 Bacteria 3128
163 Ga0495649_0034957 3300046694 Bacteria 2764
164 Ga0495589_0008674 3300046794 Bacteria 5297
165 Ga0495589_0042431 3300046794 Bacteria 2267
166 Ga0495600_0006677 3300046809 Bacteria 7031
167 Ga0495600_0048664 3300046809 Bacteria 2765
168 Ga0495660_0066351 3300046810 Bacteria 1924
169 Ga0495581_0014632 3300047315 Bacteria 4549
170 Ga0495581_0115953 3300047315 Bacteria 1557
171 Ga0495604_0003329 3300047317 Bacteria 12808
172 Ga0495636_0001991 3300047318 Bacteria 7822
173 Ga0495636_0023246 3300047318 Bacteria 2508
174 Ga0495636_0070173 3300047318 Bacteria 1494
175 Ga0495674_0031732 3300047319 Bacteria 4796
176 Ga0495676_0000336 3300047321 Bacteria 38204
177 Ga0495676_0000526 3300047321 Bacteria 31374
178 Ga0495676_0016468 3300047321 Bacteria 6559
179 Ga0495676_0033550 3300047321 Bacteria 4320
180 Ga0495680_0059892 3300047322 Bacteria 2937
181 Ga0495687_001962 3300047443 Bacteria 17572
182 Ga0495687_003155 3300047443 Bacteria 12276
183 Ga0495687_039578 3300047443 Bacteria 2084
184 Ga0495687_047605 3300047443 Bacteria 1844
185 Ga0495687_049684 3300047443 Bacteria 1791
186 Ga0495675_0004794 3300047444 Bacteria 8218
187 Ga0495685_000318 3300047447 Bacteria 15522
188 Ga0495685_016237 3300047447 Bacteria 2542
189 Ga0495685_016932 3300047447 Bacteria 2492
190 Ga0495685_018839 3300047447 Bacteria 2370
191 Ga0495681_0007429 3300047470 Bacteria 7004
192 Ga0495681_0011629 3300047470 Bacteria 5228
193 Ga0495681_0013694 3300047470 Bacteria 4693
194 Ga0495686_0016472 3300047472 Bacteria 5012
195 Ga0495686_0028925 3300047472 Bacteria 3607
196 Ga0495686_0110732 3300047472 Bacteria 1647
197 Ga0495593_0167070 3300047673 Bacteria 1110
198 Ga0495602_0067019 3300048088 Bacteria 3090
199 Ga0495602_0077511 3300048088 Bacteria 2812
200 Ga0495614_0000895 3300048089 Bacteria 12653
201 Ga0495626_0020560 3300048091 Bacteria 3287
202 Ga0496109_0026296 3300048912 Bacteria 5189
203 Ga0496111_0140063 3300048914 Bacteria 1792
204 Ga0495678_034588 3300049459 Bacteria 2077
205 Ga0501031_0005447 3300049568 Bacteria 8287
206 Ga0501032_0023154 3300049569 Bacteria 4298
207 Ga0501032_0068781 3300049569 Bacteria 2363
208 Ga0501032_0170725 3300049569 Bacteria 1426
209 Ga0501033_0001908 3300049570 Bacteria 18135
210 Ga0501033_0007739 3300049570 Bacteria 8333
211 Ga0501033_0010830 3300049570 Bacteria 6993
212 Ga0501034_0001296 3300049571 Bacteria 33823
213 Ga0501034_0010020 3300049571 Bacteria 9900
214 Ga0501034_0028665 3300049571 Bacteria 5665
215 Ga0501034_0172615 3300049571 Bacteria 2128
216 Ga0501036_0000081 3300049572 Bacteria 58719
217 Ga0501036_0047109 3300049572 Bacteria 3651
218 Ga0501036_0195294 3300049572 Bacteria 1703
219 Ga0501037_0029003 3300049573 Bacteria 4087
220 Ga0501037_0103847 3300049573 Bacteria 2049
221 Ga0501038_0002442 3300049574 Bacteria 17298
222 Ga0501038_0026029 3300049574 Bacteria 5211
223 Ga0501038_0035495 3300049574 Bacteria 4377
224 Ga0501038_0181437 3300049574 Bacteria 1698
225 Ga0501039_0005539 3300049575 Bacteria 9555
226 Ga0501039_0133058 3300049575 Bacteria 1952
227 Ga0501042_0024294 3300049578 Bacteria 4250
228 Ga0501043_0000675 3300049579 Bacteria 30027
229 Ga0501043_0001155 3300049579 Bacteria 23219
230 Ga0501043_0049064 3300049579 Bacteria 3318
231 Ga0501046_0137990 3300049580 Bacteria 1846
232 Ga0501046_0314623 3300049580 Bacteria 1141
233 Ga0501047_0000056 3300049581 Bacteria 143501
234 Ga0501047_0017545 3300049581 Bacteria 6858
235 Ga0501047_0092687 3300049581 Bacteria 2900
236 Ga0501048_0030830 3300049582 Bacteria 3880
237 Ga0501070_0000218 3300049586 Bacteria 54494
238 Ga0501070_0157360 3300049586 Bacteria 1874
239 Ga0501074_0006210 3300049590 Bacteria 8622
240 Ga0501080_0178984 3300049742 Bacteria 1952
241 Ga0501035_0013226 3300049822 Bacteria 7616
242 Ga0501035_0020759 3300049822 Bacteria 6036
243 Ga0501035_0068168 3300049822 Bacteria 3155
244 Ga0501035_0119356 3300049822 Bacteria 2306
245 Ga0501044_0003829 3300049823 Bacteria 16886
246 Ga0501044_0016611 3300049823 Bacteria 7900
247 Ga0501044_0132089 3300049823 Bacteria 2490
248 Ga0501044_0172876 3300049823 Bacteria 2130
249 Ga0501044_0324979 3300049823 Bacteria 1462
250 nmdc:mga03n38_38159_c1 3300050490 Bacteria 2076
251 nmdc:mga04h51_2882_c1 3300050495 Bacteria 4125
252 nmdc:mga07m45_23308_c1 3300050496 Bacteria 3383
253 Ga0495655_0012958 3300053083 Bacteria 1712
254 Ga0500578_0005754 3300053086 Bacteria 8376
255 Ga0500578_0150672 3300053086 Bacteria 1449
256 Ga0500553_052087 3300053101 Bacteria 1957
257 Ga0500560_004277 3300053107 Bacteria 3017
258 Ga0500569_000355 3300053109 Bacteria 7389
259 Ga0500658_0001339 3300053134 Bacteria 9966
260 Ga0500600_0005150 3300053149 Bacteria 7700
261 Ga0500616_0018537 3300053153 Bacteria 3933
262 Ga0500633_0001412 3300053160 Bacteria 4502
263 Ga0500634_0003426 3300053161 Bacteria 7042
264 Ga0466962_0000140 3300061719 Bacteria 29637
265 Ga0466962_0028896 3300061719 Bacteria 2655
266 2547407738 2547132111 Bacteria 8013147
267 2554258806 2554235005 Bacteria 6457341
268 2585300012 2582581312 Bacteria 7308206
269 2585308476 2582581313 Bacteria 10042643
270 2585313300 2582581314 Bacteria 11452267
271 2616694536 2616644814 Bacteria 11555299
272 2616899656 2616644941 Bacteria 8510691
273 2643759511 2643221548 Bacteria 8053412
274 2643897587 2643221578 Bacteria 9213798
275 2643944941 2643221587 Bacteria 7586415
276 2644385083 2643221670 Bacteria 6497041
277 2644408733 2643221673 Bacteria 9196637
278 2644431840 2643221677 Bacteria 7584031
279 2644435997 2643221678 Bacteria 9540101
280 2644463073 2643221682 Bacteria 6743283
281 2644632115 2643221714 Bacteria 9015452
282 2784587591 2784132148 Bacteria 8627943
283 2785368205 2784746768 Bacteria 10036182
284 2786669203 2786546132 Bacteria 10419719
285 2793985537 2791355406 Bacteria 11364898
286 2804844637 2802429296 Bacteria 7227771
287 2808840842 2808606359 Bacteria 9866990
288 2808919440 2808606375 Bacteria 9466072
289 2809231153 2808606448 Bacteria 8656184
290 2811847852 2808606982 Bacteria 7791042
291 2812359351 2811994879 Bacteria 9313447
292 2812481488 2811994917 Bacteria 7761064
293 2819693917 2818991463 Bacteria 7948711
294 2852640711 2852635781 Bacteria 8251373
295 2862182742 2862178590 Bacteria 8583590
296 2862288465 2862281513 Bacteria 9621493
297 2862295815 2862290372 Bacteria 7471434
298 2862392475 2862382967 Bacteria 10317375
299 2862513892 2862507626 Bacteria 9425308
300 2862582676 2862574272 Bacteria 10567477
301 2863405958 2863404153 Bacteria 9672205
302 2867370842 2867369537 Bacteria 6501581
303 2867432695 2867428634 Bacteria 9590268
304 2867480222 2867475112 Bacteria 6909112
305 2873156814 2873151551 Bacteria 8625867
306 2875393540 2875391855 Bacteria 7600475
307 2877682376 2877676314 Bacteria 9512378
308 2912721281 2912715099 Bacteria 9460473
309 2912725287 2912723979 Bacteria 8557534
310 2912759707 2912757875 Bacteria 7940295
311 2918503438 2918501144 Bacteria 8668083
312 2919468339 2919468124 Bacteria 9133025
313 2935396557 2935390628 Bacteria 7043367
314 2946051165 2946045630 Bacteria 8527308
315 2946066544 2946064051 Bacteria 8957905
316 2946074805 2946072368 Bacteria 8999607
317 2947230656 2947224130 Bacteria 9938529
318 2954004064 2954002825 Bacteria 9173742
319 2954387508 2954380949 Bacteria 10050426
320 2954675666 2954673503 Bacteria 9685905
321 2954688598 2954682443 Bacteria 9862841
322 2954698350 2954691527 Bacteria 10720516
323 2954703883 2954701450 Bacteria 10834262
324 2954717361 2954711539 Bacteria 10867210
325 2954727329 2954721474 Bacteria 10456478
326 2954734463 2954731030 Bacteria 10243860
327 2954746234 2954740390 Bacteria 10229294
328 2954753360 2954749733 Bacteria 10366972
329 2954765347 2954759201 Bacteria 9358192
330 2966603543 2966598605 Bacteria 7676064
331 2990060509 2990059506 Bacteria 9321252
332 2997456218 2997451912 Bacteria 8492419
333 2997602366 2997600082 Bacteria 9896405
334 3006393994 3006393351 Bacteria 6615579
335 3006427548 3006425503 Bacteria 6491253
336 3006488992 3006486233 Bacteria 8157040
337 3006501340 3006493962 Bacteria 8825450
338 8008562323 8008558824 Bacteria 10610750
339 8008579878 8008574985 Bacteria 7815457
340 8023627408 8023623736 Bacteria 8593882
341 8025416159 8025413630 Bacteria 7014048
342 8025481417 8025478263 Bacteria 8209203
343 8025531096 8025530807 Bacteria 8495698
344 8047899391 8047893842 Bacteria 11723082
345 8048136623 8048127548 Bacteria 11053136
346 8048359539 8048356638 Bacteria 11044339
347 8048376339 8048369669 Bacteria 11666822
348 8048385394 8048379754 Bacteria 11877923
349 8048413421 8048406513 Bacteria 8936924
350 8054167599 8054160619 Bacteria 7783213
351 8056836644 8056829672 Bacteria 9045328
352 Ga0495603_0005364
353 Ga0006562J51391_1056593
354 Ga0070665_100133213
355 Ga0075368_10008797
356 Ga0075363_100027346
357 Ga0075363_100115463
358 Ga0075367_10001474
359 Ga0099826_10069165
360 Ga0105251_10015861
361 Ga0105243_10299999
362 Ga0105243_10399206
363 Ga0105249_10552742
364 Ga0105246_10001826
365 Ga0157375_10391886
366 Ga0182008_10013290
367 Ga0182006_1018053
368 Ga0182007_10002701
369 Ga0183367_1009
370 Ga0209758_1005416
371 Ga0207426_1001425
372 Ga0207426_1003866
373 Ga0207426_1008311
374 Ga0207713_1036936
375 Ga0207647_10068054
376 Ga0207702_10097995
377 Ga0209813_10063870
378 Ga0268266_10077572
379 Ga0307517_10002663
380 Ga0307517_10012808
381 Ga0307515_10000140
382 Ga0307515_10041444
383 Ga0307511_10001791
384 Ga0307511_10106455
385 Ga0307512_10080690
386 Ga0307513_10011767
387 Ga0307513_10037405
388 Ga0307513_10221956
389 Ga0307509_10190408
390 Ga0307508_10073167
391 Ga0307508_10090774
392 Ga0307514_10029737
393 Ga0307514_10084163
394 Ga0307514_10107960
395 Ga0307516_10031014
396 Ga0307516_10067771
397 Ga0307518_10163174
398 Ga0307410_10076345
399 Ga0307507_10014465
400 Ga0307507_10070365
401 Ga0307507_10232713
402 Ga0307510_10003641
403 Ga0307510_10041460
404 Ga0395899_0106158
405 Ga0395898_0006479
406 Ga0395898_0011914
407 Ga0395901_0104844
408 Ga0439436_0001007
409 Ga0439439_0009243
410 Ga0451853_2246894
411 Ga0439433_0008147
412 Ga0439448_0001717
413 Ga0439448_0024582
414 Ga0439448_0027165
415 Ga0439449_0000084
416 Ga0439449_0007487
417 Ga0439449_0056224
418 Ga0439450_004257
419 Ga0439455_0000168
420 Ga0439457_000102
421 Ga0439457_000968
422 Ga0439457_024881
423 Ga0439462_0001601
424 Ga0450896_000192
425 Ga0450898_002560
426 Ga0450900_006390
427 Ga0450903_000146
428 Ga0450906_002510
429 Ga0439458_0000571
430 Ga0466969_0004670
431 Ga0466969_0055718
432 Ga0466972_0000960
433 Ga0466972_0031812
434 Ga0466965_0003738
435 Ga0466966_0002500
436 Ga0466966_0019371
437 Ga0466961_0007749
438 Ga0466963_0000106
439 Ga0466963_0001285
440 Ga0466964_0007157
441 Ga0466971_0000222
442 Ga0466970_0003615
443 Ga0466970_0004025
444 Ga0466957_0047612
445 Ga0466960_0013262
446 Ga0466959_0026502
447 Ga0466958_0000267
448 Ga0466958_0046789
449 Ga0466967_0005116
450 Ga0466967_0030465
451 Ga0495627_043962
452 Ga0495603_0000345
453 Ga0495603_0001197
454 Ga0495603_0004361
455 Ga0495603_0083523
456 Ga0495603_0157207
457 Ga0495629_0003931
458 Ga0495629_0011690
459 Ga0495629_0045298
460 Ga0495629_0056591
461 Ga0495629_0097756
462 Ga0495629_0207545
463 Ga0495638_0026368
464 Ga0495651_0002933
465 Ga0495651_0025772
466 Ga0495653_0157204
467 Ga0495582_0057066
468 Ga0495605_0016508
469 Ga0495639_0014271
470 Ga0495662_0000441
471 Ga0495662_0013227
472 Ga0495585_0055294
473 Ga0495594_0001380
474 Ga0495594_0088335
475 Ga0495607_0052714
476 Ga0495607_0063352
477 Ga0495607_0067680
478 Ga0495583_0067976
479 Ga0495583_0103702
480 Ga0495616_0012501
481 Ga0495628_0085085
482 Ga0495631_0004787
483 Ga0495631_0018608
484 Ga0495643_0003567
485 Ga0495643_0005056
486 Ga0495587_0001775
487 Ga0495609_0037861
488 Ga0495622_0020445
489 Ga0495622_0030028
490 Ga0495633_0023552
491 Ga0495633_0043107
492 Ga0495634_0003766
493 Ga0495634_0091882
494 Ga0495611_0016038
495 Ga0495611_0024323
496 Ga0495611_0043450
497 Ga0495625_0076184
498 Ga0495635_0003573
499 Ga0495635_0104533
500 Ga0495661_0026877
501 Ga0495588_0002164
502 Ga0495588_0050106
503 Ga0495588_0133196
504 Ga0495657_0000757
505 Ga0495657_0017683
506 Ga0495623_0036559
507 Ga0495646_0000627
508 Ga0495613_0000544
509 Ga0495613_0001099
510 Ga0495613_0016148
511 Ga0495613_0139290
512 Ga0495624_0023744
513 Ga0495671_0024682
514 Ga0495649_0034957
515 Ga0495589_0008674
516 Ga0495589_0042431
517 Ga0495600_0006677
518 Ga0495600_0048664
519 Ga0495660_0066351
520 Ga0495581_0014632
521 Ga0495581_0115953
522 Ga0495604_0003329
523 Ga0495636_0001991
524 Ga0495636_0023246
525 Ga0495636_0070173
526 Ga0495674_0031732
527 Ga0495676_0000336
528 Ga0495676_0000526
529 Ga0495676_0016468
530 Ga0495676_0033550
531 Ga0495680_0059892
532 Ga0495687_001962
533 Ga0495687_003155
534 Ga0495687_039578
535 Ga0495687_047605
536 Ga0495687_049684
537 Ga0495675_0004794
538 Ga0495685_000318
539 Ga0495685_016237
540 Ga0495685_016932
541 Ga0495685_018839
542 Ga0495681_0007429
543 Ga0495681_0011629
544 Ga0495681_0013694
545 Ga0495686_0016472
546 Ga0495686_0028925
547 Ga0495686_0110732
548 Ga0495593_0167070
549 Ga0495602_0067019
550 Ga0495602_0077511
551 Ga0495614_0000895
552 Ga0495626_0020560
553 Ga0496109_0026296
554 Ga0496111_0140063
555 Ga0495678_034588
556 Ga0501031_0005447
557 Ga0501032_0023154
558 Ga0501032_0068781
559 Ga0501032_0170725
560 Ga0501033_0001908
561 Ga0501033_0007739
562 Ga0501033_0010830
563 Ga0501034_0001296
564 Ga0501034_0010020
565 Ga0501034_0028665
566 Ga0501034_0172615
567 Ga0501036_0000081
568 Ga0501036_0047109
569 Ga0501036_0195294
570 Ga0501037_0029003
571 Ga0501037_0103847
572 Ga0501038_0002442
573 Ga0501038_0026029
574 Ga0501038_0035495
575 Ga0501038_0181437
576 Ga0501039_0005539
577 Ga0501039_0133058
578 Ga0501042_0024294
579 Ga0501043_0000675
580 Ga0501043_0001155
581 Ga0501043_0049064
582 Ga0501046_0137990
583 Ga0501046_0314623
584 Ga0501047_0000056
585 Ga0501047_0017545
586 Ga0501047_0092687
587 Ga0501048_0030830
588 Ga0501070_0000218
589 Ga0501070_0157360
590 Ga0501074_0006210
591 Ga0501080_0178984
592 Ga0501035_0013226
593 Ga0501035_0020759
594 Ga0501035_0068168
595 Ga0501035_0119356
596 Ga0501044_0003829
597 Ga0501044_0016611
598 Ga0501044_0132089
599 Ga0501044_0172876
600 Ga0501044_0324979
601 nmdc:mga03n38_38159_c1
602 nmdc:mga04h51_2882_c1
603 nmdc:mga07m45_23308_c1
604 Ga0495655_0012958
605 Ga0500578_0005754
606 Ga0500578_0150672
607 Ga0500553_052087
608 Ga0500560_004277
609 Ga0500569_000355
610 Ga0500658_0001339
611 Ga0500600_0005150
612 Ga0500616_0018537
613 Ga0500633_0001412
614 Ga0500634_0003426
615 Ga0466962_0000140
616 Ga0466962_0028896
617 2547407738
618 2554258806
619 2585300012
620 2585308476
621 2585313300
622 2616694536
623 2616899656
624 2643759511
625 2643897587
626 2643944941
627 2644385083
628 2644408733
629 2644431840
630 2644435997
631 2644463073
632 2644632115
633 2784587591
634 2785368205
635 2786669203
636 2793985537
637 2804844637
638 2808840842
639 2808919440
640 2809231153
641 2811847852
642 2812359351
643 2812481488
644 2819693917
645 2852640711
646 2862182742
647 2862288465
648 2862295815
649 2862392475
650 2862513892
651 2862582676
652 2863405958
653 2867370842
654 2867432695
655 2867480222
656 2873156814
657 2875393540
658 2877682376
659 2912721281
660 2912725287
661 2912759707
662 2918503438
663 2919468339
664 2935396557
665 2946051165
666 2946066544
667 2946074805
668 2947230656
669 2954004064
670 2954387508
671 2954675666
672 2954688598
673 2954698350
674 2954703883
675 2954717361
676 2954727329
677 2954734463
678 2954746234
679 2954753360
680 2954765347
681 2966603543
682 2990060509
683 2997456218
684 2997602366
685 3006393994
686 3006427548
687 3006488992
688 3006501340
689 8008562323
690 8008579878
691 8023627408
692 8025416159
693 8025481417
694 8025531096
695 8047899391
696 8048136623
697 8048359539
698 8048376339
699 8048385394
700 8048413421
701 8054167599
702 8056836644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qsj-assembly2.cif.gz_B methylmannose polysaccharide hydrolase mmph from m. hassiacum 0.9824 10 351
7qsj-assembly2.cif.gz_B methylmannose polysaccharide hydrolase mmph from m. hassiacum 0.9571 10 351
3s4c-assembly1.cif.gz_A-2 lactose phosphorylase in complex with sulfate 0.8092 14 330
8ho9-assembly1.cif.gz_A the cryo-em structure of cellobiose phosphorylase from clostridium thermocellum (cysteine-to-serine varient) 0.8055 42 328
3afj-assembly1.cif.gz_B crystal structure of cellvibrio gilvus cellobiose phosphorylase triple mutant 0.804 14 330
ID Description Score Start End Superfamily
af_Q59005_266_613_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8087 19 326 1.50.10.10
1v7wA03 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8023 17 328 1.50.10.10
af_P71741_292_669_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7939 19 331 1.50.10.10
af_Q552D2_275_646_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7695 16 332 1.50.10.10
4wvbA00 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.7467 19 325 1.50.10.10
ID Description Score Start End GO Terms
AF-A0A0L0JM97-F1-model_v4 Prenyltransferase 0.9973 1 351 GO:0005975
GO:0016740
AF-A0A6G2PWD2-F1-model_v4 Prenyltransferase 0.9972 1 351 GO:0005975
GO:0016740
AF-A0A7W3TEA6-F1-model_v4 Prenyltransferase 0.9961 5 350 GO:0005975
GO:0016740
AF-A0A2G9DBH6-F1-model_v4 deleted 0.9953 57 193
AF-V6UCX3-F1-model_v4 deleted 0.9914 109 350

Map