F418745

General Info

Members Datasets Scaffolds Average Seq Length
351 274 702 393

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0151666|Ga0466967_0151666_1093_2154
Length 353
Sequence VIPYTYFGHTDPKSFIGFDAIVLATDSFFMAMFFFLSGLFVWPGLAHKAPSVFFRDRLVRLGLPFAIAALTIIPLAYYAIELRANPEITFAAYWWKTITVGPWPSGPVWFLWVLLAFDLSACAAFQISPTLLDPLNRLSLRGHDKPLNFFYALIAVTAIVYIPMRVSYGPNVWFEFGPFSVQINRVLLYAAYFYFGAGIGAANFERGVLGADGQLSQRGMGAWIVAMVVPYTLLWVLIAIKREVLGNQPTQPAWYEATYGLFFVAFSAATMFAILAYFLNRRRSEFSVLDRMQADAYGIFLVHYPVVLWIQYALFDLDVPAIAKATVAFVGTTVVSWGITWALRQVPGAKSIL

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
74 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
75 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
76 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
81 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
82 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
83 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
86 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
87 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
96 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
148 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
177 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
178 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
179 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
180 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
181 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
182 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
190 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
191 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
192 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
193 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
194 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
195 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
196 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
197 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
198 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
199 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
200 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
201 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
202 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
203 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
204 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
205 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
206 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
207 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
208 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
209 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
210 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
211 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
212 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
213 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
214 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
215 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
216 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
217 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
218 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
219 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
220 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
221 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
222 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
223 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
224 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
225 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
226 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
227 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
228 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
229 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
230 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
231 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
232 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
233 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
234 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
235 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
236 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
237 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
238 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
239 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
240 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
241 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
242 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
243 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
244 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
245 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
246 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
247 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
248 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
249 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
250 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
251 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
252 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
253 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
254 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
255 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
256 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
257 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
258 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
259 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
260 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
261 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
262 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
263 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
264 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
265 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
266 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
267 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
268 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
269 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
270 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
271 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
272 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
273 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
274 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.5
Metatranscriptomes 0
Isolates 24.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 20.51
Rhizoplane 7.41
Rhizosphere 54.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0151666 3300045976 Bacteria 2167
2 JGI25406J46586_10000141 3300003203 Bacteria 31326
3 JGI25153J46596_10001533 3300003215 Bacteria 13713
4 JGI25160J50197_1001294 3300003354 Bacteria 12650
5 Ga0055543_1003754 3300004625 Bacteria 4340
6 Ga0065165_1002974 3300005262 Bacteria 12862
7 Ga0065165_1003005 3300005262 Bacteria 12758
8 Ga0065712_10110763 3300005290 Bacteria 1830
9 Ga0070658_10107279 3300005327 Bacteria 2311
10 Ga0070658_10225725 3300005327 Bacteria 1585
11 Ga0070683_100054825 3300005329 Bacteria 3697
12 Ga0070683_100085836 3300005329 Bacteria 2951
13 Ga0070683_100148009 3300005329 Bacteria 2226
14 Ga0070680_100003306 3300005336 Bacteria 12032
15 Ga0070680_100075298 3300005336 Bacteria 2778
16 Ga0070680_100111539 3300005336 Bacteria 2277
17 Ga0070660_100053294 3300005339 Bacteria 3120
18 Ga0070691_10022461 3300005341 Bacteria 2927
19 Ga0070659_100066547 3300005366 Bacteria 2855
20 Ga0070713_100185101 3300005436 Bacteria 1874
21 Ga0070710_10081825 3300005437 Bacteria 1886
22 Ga0070711_100047871 3300005439 Bacteria 2920
23 Ga0070681_10028949 3300005458 Bacteria 5565
24 Ga0070681_10052193 3300005458 Bacteria 4078
25 Ga0070681_10064419 3300005458 Bacteria 3635
26 Ga0070681_10087176 3300005458 Bacteria 3074
27 Ga0070679_100027061 3300005530 Bacteria 5639
28 Ga0070679_100044585 3300005530 Bacteria 4418
29 Ga0070679_100046319 3300005530 Bacteria 4334
30 Ga0070684_100014121 3300005535 Bacteria 6458
31 Ga0070684_100028313 3300005535 Bacteria 4739
32 Ga0070697_100147482 3300005536 Bacteria 1982
33 Ga0068853_100005359 3300005539 Bacteria 10046
34 Ga0068853_100068588 3300005539 Bacteria 3083
35 Ga0068853_100091017 3300005539 Bacteria 2682
36 Ga0070665_100098678 3300005548 Bacteria 2925
37 Ga0068855_100010147 3300005563 Bacteria 11351
38 Ga0068855_100021003 3300005563 Bacteria 7830
39 Ga0068857_100089229 3300005577 Bacteria 2758
40 Ga0068854_100189379 3300005578 Bacteria 1611
41 Ga0068856_100004479 3300005614 Bacteria 13897
42 Ga0068852_100027430 3300005616 Bacteria 4642
43 Ga0068860_100000317 3300005843 Bacteria 65673
44 Ga0081539_10000008 3300005985 Bacteria 525071
45 Ga0070717_10006275 3300006028 Bacteria 8732
46 Ga0075365_10077598 3300006038 Bacteria 2244
47 Ga0070716_100116924 3300006173 Bacteria 1662
48 Ga0070712_100177372 3300006175 Bacteria 1658
49 Ga0097621_100049964 3300006237 Bacteria 3400
50 Ga0099822_1002198 3300006943 Bacteria 24094
51 Ga0099794_10044662 3300007265 Bacteria 2118
52 Ga0099794_10097633 3300007265 Bacteria 1464
53 Ga0099795_10040951 3300007788 Bacteria 1648
54 Ga0105240_10077632 3300009093 Bacteria 4091
55 Ga0105240_10127591 3300009093 Bacteria 3055
56 Ga0105237_10011285 3300009545 Bacteria 9453
57 Ga0105238_10003129 3300009551 Bacteria 16514
58 Ga0105238_10119500 3300009551 Bacteria 2615
59 Ga0105238_10307098 3300009551 Bacteria 1571
60 Ga0105239_10008965 3300010375 Bacteria 11320
61 Ga0105239_10017421 3300010375 Bacteria 7945
62 Ga0105239_10144944 3300010375 Bacteria 2648
63 Ga0105239_10463553 3300010375 Bacteria 1438
64 Ga0105246_10149257 3300011119 Bacteria 1767
65 Ga0157373_10044092 3300013100 Bacteria 3184
66 Ga0157370_10067708 3300013104 Bacteria 3375
67 Ga0157369_10004501 3300013105 Bacteria 16421
68 Ga0157369_10165492 3300013105 Bacteria 2333
69 Ga0157378_10037649 3300013297 Bacteria 4286
70 Ga0157372_10283022 3300013307 Bacteria 1928
71 Ga0213876_10083569 3300021384 Bacteria 1689
72 Ga0209677_101241 3300025253 Bacteria 11522
73 Ga0209233_1002461 3300025261 Bacteria 6797
74 Ga0209233_1003268 3300025261 Bacteria 5748
75 Ga0209564_1002300 3300025295 Bacteria 15530
76 Ga0209758_1001983 3300025297 Bacteria 22130
77 Ga0207426_1000466 3300025302 Bacteria 62533
78 Ga0207426_1001739 3300025302 Bacteria 16577
79 Ga0207647_10095833 3300025904 Bacteria 1766
80 Ga0207707_10002025 3300025912 Bacteria 18400
81 Ga0207707_10016326 3300025912 Bacteria 6477
82 Ga0207707_10095312 3300025912 Bacteria 2601
83 Ga0207695_10084929 3300025913 Bacteria 3195
84 Ga0207695_10228309 3300025913 Bacteria 1767
85 Ga0207671_10025519 3300025914 Bacteria 4439
86 Ga0207663_10007113 3300025916 Bacteria 5780
87 Ga0207657_10009869 3300025919 Bacteria 9560
88 Ga0207652_10002138 3300025921 Bacteria 16939
89 Ga0207694_10101107 3300025924 Bacteria 2284
90 Ga0207665_10129883 3300025939 Bacteria 1787
91 Ga0207711_10204615 3300025941 Bacteria 1802
92 Ga0207661_10009379 3300025944 Bacteria 7016
93 Ga0207661_10017331 3300025944 Bacteria 5326
94 Ga0207667_10008468 3300025949 Bacteria 12214
95 Ga0207667_10045729 3300025949 Bacteria 4635
96 Ga0207703_10060914 3300026035 Bacteria 3088
97 Ga0207639_10145272 3300026041 Bacteria 1981
98 Ga0207678_10065922 3300026067 Bacteria 3109
99 Ga0207678_10161072 3300026067 Bacteria 1916
100 Ga0207702_10001399 3300026078 Bacteria 24061
101 Ga0207702_10153226 3300026078 Bacteria 2099
102 Ga0207641_10066110 3300026088 Bacteria 3095
103 Ga0207674_10010829 3300026116 Bacteria 10282
104 Ga0207698_10036991 3300026142 Bacteria 3590
105 Ga0207698_10084775 3300026142 Bacteria 2570
106 Ga0209589_1000018 3300027357 Bacteria 192614
107 Ga0209489_100026 3300027361 Bacteria 192614
108 Ga0209700_100035 3300027363 Bacteria 192614
109 Ga0209179_1001264 3300027512 Bacteria 3033
110 Ga0209588_1007968 3300027671 Bacteria 3132
111 Ga0268266_10098933 3300028379 Bacteria 2567
112 Ga0268264_10000035 3300028381 Bacteria 398196
113 Ga0265337_1002402 3300028556 Bacteria 8620
114 Ga0265326_10003557 3300028558 Bacteria 5095
115 Ga0265319_1002432 3300028563 Bacteria 10179
116 Ga0265334_10002131 3300028573 Bacteria 9344
117 Ga0265318_10003684 3300028577 Bacteria 7655
118 Ga0265323_10001287 3300028653 Bacteria 12515
119 Ga0265322_10005293 3300028654 Bacteria 3819
120 Ga0265336_10000128 3300028666 Bacteria 55655
121 Ga0265338_10000119 3300028800 Bacteria 146599
122 Ga0265324_10003823 3300029957 Bacteria 7036
123 Ga0265330_10021112 3300031235 Bacteria 2974
124 Ga0265330_10040036 3300031235 Bacteria 2081
125 Ga0265325_10006257 3300031241 Bacteria 7251
126 Ga0307509_10056729 3300031507 Bacteria 4156
127 Ga0307509_10149210 3300031507 Bacteria 2257
128 Ga0307509_10205331 3300031507 Bacteria 1801
129 Ga0307508_10017864 3300031616 Bacteria 6448
130 Ga0307508_10022171 3300031616 Bacteria 5772
131 Ga0265314_10011778 3300031711 Bacteria 7193
132 Ga0307507_10046738 3300033179 Bacteria 4239
133 Ga0307510_10143982 3300033180 Bacteria 2020
134 Ga0373934_0026418 3300035086 Bacteria 2252
135 Ga0373923_0007439 3300035111 Bacteria 3851
136 Ga0373954_0009425 3300035118 Bacteria 4294
137 Ga0373956_0088950 3300035119 Bacteria 1423
138 Ga0373957_0018778 3300035120 Bacteria 2425
139 Ga0373931_0007686 3300035691 Bacteria 5088
140 Ga0373927_0028407 3300035695 Bacteria 3648
141 Ga0373927_0043988 3300035695 Bacteria 2890
142 Ga0373927_0046255 3300035695 Bacteria 2816
143 Ga0373933_0002970 3300035724 Bacteria 9455
144 Ga0373933_0068497 3300035724 Bacteria 2155
145 Ga0373925_0106821 3300037068 Bacteria 2159
146 Ga0395900_0291393 3300037418 Bacteria 1621
147 Ga0395898_0002649 3300037466 Bacteria 20818
148 Ga0395898_0180452 3300037466 Bacteria 2018
149 Ga0395898_0225175 3300037466 Bacteria 1789
150 Ga0436365_0032113 3300039437 Bacteria 6905
151 Ga0436363_0481135 3300039450 Bacteria 4988
152 Ga0466971_0023411 3300044719 Bacteria 2753
153 Ga0466959_0030102 3300045049 Bacteria 4020
154 Ga0466967_0112736 3300045976 Bacteria 2500
155 Ga0495592_0001015 3300046454 Bacteria 19460
156 Ga0495603_0011089 3300046455 Bacteria 5464
157 Ga0495603_0034338 3300046455 Bacteria 3049
158 Ga0495629_0005467 3300046459 Bacteria 9480
159 Ga0495653_0001070 3300046463 Bacteria 21097
160 Ga0495606_0092365 3300046507 Bacteria 1859
161 Ga0495628_0052343 3300046516 Bacteria 3225
162 Ga0495628_0055970 3300046516 Bacteria 3106
163 Ga0495648_0008834 3300046524 Bacteria 7884
164 Ga0495640_0022481 3300046533 Bacteria 4608
165 Ga0495645_0002189 3300046543 Bacteria 13283
166 Ga0495645_0005223 3300046543 Bacteria 8897
167 Ga0495635_0001667 3300046663 Bacteria 14944
168 Ga0495657_0004150 3300046675 Bacteria 11599
169 Ga0495599_0003132 3300046678 Bacteria 9642
170 Ga0495599_0059560 3300046678 Bacteria 2389
171 Ga0495623_0064928 3300046679 Bacteria 2283
172 Ga0495646_0097782 3300046680 Bacteria 1686
173 Ga0495613_0044365 3300046689 Bacteria 3290
174 Ga0495624_0096644 3300046690 Bacteria 1820
175 Ga0495600_0003617 3300046809 Bacteria 9112
176 Ga0495674_0047719 3300047319 Bacteria 3795
177 Ga0495674_0090398 3300047319 Bacteria 2616
178 Ga0495680_0207246 3300047322 Bacteria 1405
179 Ga0495684_0019374 3300047471 Bacteria 5238
180 Ga0495593_0000953 3300047673 Bacteria 16903
181 Ga0496100_0068920 3300048903 Bacteria 2354
182 Ga0496101_0032891 3300048904 Bacteria 3654
183 Ga0496102_0190590 3300048905 Bacteria 1932
184 Ga0496104_0013413 3300048907 Bacteria 7383
185 Ga0496104_0104556 3300048907 Bacteria 2713
186 Ga0496105_0006080 3300048908 Bacteria 9238
187 Ga0496106_0000116 3300048909 Bacteria 61237
188 Ga0496106_0002853 3300048909 Bacteria 12840
189 Ga0496106_0025828 3300048909 Bacteria 4370
190 Ga0496107_0016392 3300048910 Bacteria 5201
191 Ga0496107_0022024 3300048910 Bacteria 4501
192 Ga0496108_0000523 3300048911 Bacteria 30064
193 Ga0496108_0204419 3300048911 Bacteria 1714
194 Ga0496109_0001407 3300048912 Bacteria 19953
195 Ga0496109_0060991 3300048912 Bacteria 3447
196 Ga0496109_0195060 3300048912 Bacteria 1903
197 Ga0496110_0037615 3300048913 Bacteria 4207
198 Ga0496110_0096746 3300048913 Bacteria 2645
199 Ga0496111_0049473 3300048914 Bacteria 3031
200 Ga0496111_0086126 3300048914 Bacteria 2298
201 Ga0496112_0014449 3300048915 Bacteria 7327
202 Ga0496112_0086493 3300048915 Bacteria 3101
203 Ga0496114_0002764 3300048917 Bacteria 13432
204 Ga0496115_0099697 3300048918 Bacteria 2381
205 Ga0496115_0118607 3300048918 Bacteria 2176
206 Ga0496117_0025638 3300048920 Bacteria 4631
207 Ga0496118_0006091 3300048921 Bacteria 13407
208 Ga0496118_0040326 3300048921 Bacteria 3714
209 Ga0496119_0099025 3300048922 Bacteria 1641
210 Ga0496121_0018786 3300048924 Bacteria 6945
211 Ga0496124_0016465 3300048927 Bacteria 7024
212 Ga0496126_0006291 3300048929 Bacteria 13257
213 Ga0496126_0118311 3300048929 Bacteria 2300
214 Ga0496126_0252328 3300048929 Bacteria 1470
215 Ga0501031_0003360 3300049568 Bacteria 10278
216 Ga0501031_0005038 3300049568 Bacteria 8590
217 Ga0501032_0000046 3300049569 Bacteria 109405
218 Ga0501032_0005402 3300049569 Bacteria 9503
219 Ga0501033_0000514 3300049570 Bacteria 36256
220 Ga0501033_0012307 3300049570 Bacteria 6530
221 Ga0501034_0000061 3300049571 Bacteria 195178
222 Ga0501034_0002794 3300049571 Bacteria 20423
223 Ga0501036_0000027 3300049572 Bacteria 99799
224 Ga0501036_0000183 3300049572 Bacteria 41503
225 Ga0501037_0000104 3300049573 Bacteria 80204
226 Ga0501037_0000210 3300049573 Bacteria 51992
227 Ga0501038_0000340 3300049574 Bacteria 40348
228 Ga0501038_0000415 3300049574 Bacteria 36967
229 Ga0501039_0000121 3300049575 Bacteria 54152
230 Ga0501043_0000135 3300049579 Bacteria 68762
231 Ga0501043_0001636 3300049579 Bacteria 19475
232 Ga0501046_0001575 3300049580 Bacteria 21813
233 Ga0501047_0000101 3300049581 Bacteria 104950
234 Ga0501048_0000060 3300049582 Bacteria 54898
235 Ga0501048_0002792 3300049582 Bacteria 13334
236 Ga0501067_0002365 3300049583 Bacteria 10443
237 Ga0501067_0029676 3300049583 Bacteria 3031
238 Ga0501070_0000702 3300049586 Bacteria 30762
239 Ga0501070_0009854 3300049586 Bacteria 8078
240 Ga0501071_0008844 3300049587 Bacteria 6677
241 Ga0501072_0007262 3300049588 Bacteria 8406
242 Ga0501073_0000014 3300049589 Bacteria 159719
243 Ga0501073_0012830 3300049589 Bacteria 6107
244 Ga0501074_0028391 3300049590 Bacteria 4055
245 Ga0501080_0000121 3300049742 Bacteria 54804
246 Ga0501080_0003911 3300049742 Bacteria 13195
247 Ga0501083_0010027 3300049744 Bacteria 6684
248 Ga0501035_0000560 3300049822 Bacteria 41183
249 Ga0501035_0005432 3300049822 Bacteria 12049
250 Ga0501044_0000703 3300049823 Bacteria 40390
251 Ga0501045_0128763 3300049824 Bacteria 1881
252 Ga0500557_000039 3300053105 Bacteria 66862
253 Ga0500562_015385 3300053108 Bacteria 1961
254 Ga0500569_002549 3300053109 Bacteria 3607
255 Ga0500658_0076387 3300053134 Bacteria 1424
256 Ga0500559_0009317 3300053136 Bacteria 4254
257 Ga0500573_0028222 3300053140 Bacteria 3231
258 Ga0500603_001850 3300053150 Bacteria 4735
259 Ga0500616_0009727 3300053153 Bacteria 5814
260 Ga0500638_085466 3300053162 Bacteria 1493
261 Ga0500636_0000194 3300053177 Bacteria 32748
262 Ga0500636_0071232 3300053177 Bacteria 2016
263 Ga0500601_000497 3300053737 Bacteria 6065
264 Ga0501084_0001955 3300054114 Bacteria 16459
265 Ga0501082_0056821 3300060353 Bacteria 3371
266 2507510090 2507262055 Bacteria 8048963
267 2508544092 2508501009 Bacteria 7784016
268 2508697968 2508501042 Bacteria 8719808
269 2513660037 2513237096 Bacteria 8722461
270 2513676476 2513237098 Bacteria 9902361
271 2513705412 2513237102 Bacteria 7703324
272 2513720618 2513237104 Bacteria 10034502
273 2513858214 2513237137 Bacteria 9558895
274 2513892014 2513237141 Bacteria 8496279
275 2513922153 2513237145 Bacteria 8979722
276 2515629404 2515154112 Bacteria 8294334
277 2517893897 2517572143 Bacteria 9484767
278 2524467051 2524023210 Bacteria 9029266
279 2671122889 2667528175 Bacteria 7532676
280 2728748022 2728368998 Bacteria 8720350
281 2824622774 2824617872 Bacteria 8814715
282 2824632393 2824626560 Bacteria 8813858
283 2824640412 2824635225 Bacteria 8785348
284 2824647401 2824644064 Bacteria 8743947
285 2824708363 2824704595 Bacteria 9667483
286 2824720379 2824714736 Bacteria 8717648
287 2824728708 2824723954 Bacteria 8758240
288 2824758928 2824753945 Bacteria 9787441
289 2824766104 2824763712 Bacteria 9792355
290 2874593292 2874590934 Bacteria 8299676
291 2874636107 2874628541 Bacteria 8630250
292 2874652933 2874645413 Bacteria 8214782
293 2876773332 2876771140 Bacteria 8287509
294 2876821285 2876818435 Bacteria 8274608
295 2879077248 2879074833 Bacteria 8279565
296 2879130195 2879127579 Bacteria 8294491
297 2879146710 2879142872 Bacteria 8267021
298 2881365732 2881364244 Bacteria 7710352
299 2885390043 2885383462 Bacteria 9473874
300 2903771721 2903768456 Bacteria 9749579
301 2904693455 2904690495 Bacteria 9412302
302 2904718544 2904711408 Bacteria 9771557
303 2906635941 2906635258 Bacteria 8601019
304 2906663961 2906660503 Bacteria 8595048
305 2908761780 2908756301 Bacteria 8864324
306 2932787028 2932784394 Bacteria 9704911
307 2932832382 2932828146 Bacteria 9745859
308 2935611005 2935608549 Bacteria 8203142
309 2935634519 2935630451 Bacteria 8169952
310 2935648436 2935648319 Bacteria 8801166
311 2935657576 2935656913 Bacteria 8965014
312 2935771419 2935769743 Bacteria 7878163
313 2935779108 2935777560 Bacteria 8077691
314 2935788312 2935785616 Bacteria 7962367
315 2935796923 2935793552 Bacteria 8012592
316 2935820490 2935819856 Bacteria 8261050
317 2935849501 2935847175 Bacteria 8228321
318 2935911725 2935908558 Bacteria 8568796
319 2935928754 2935926038 Bacteria 8601059
320 2935938399 2935934488 Bacteria 8602579
321 2935945709 2935942939 Bacteria 8599779
322 2935954684 2935951376 Bacteria 8602333
323 2935963284 2935959822 Bacteria 7869783
324 2935970571 2935967501 Bacteria 8603075
325 2935979193 2935975950 Bacteria 8347125
326 2935987795 2935984226 Bacteria 8302647
327 2936011346 2936011229 Bacteria 8801034
328 2936019941 2936019824 Bacteria 8804134
329 2936028537 2936028420 Bacteria 8965941
330 2936046664 2936046547 Bacteria 8903709
331 2936062357 2936055302 Bacteria 8785755
332 2941509005 2941507105 Bacteria 8166816
333 2941516834 2941515067 Bacteria 8166720
334 2941525071 2941523033 Bacteria 8169134
335 3005478670 3005474847 Bacteria 9259049
336 3005713434 3005710791 Bacteria 7622528
337 8016515180 8016511872 Bacteria 9921665
338 8016612299 8016603502 Bacteria 8731218
339 8016621510 8016613128 Bacteria 8794220
340 8016628451 8016622563 Bacteria 7999408
341 8016632650 8016630954 Bacteria 9217207
342 8017061274 8017057580 Bacteria 10023680
343 8019555534 8019547302 Bacteria 7996444
344 8019626446 8019619141 Bacteria 9218857
345 8019636045 8019629233 Bacteria 8687553
346 8019643619 8019638758 Bacteria 9062356
347 8019673442 8019668869 Bacteria 8791617
348 8019682687 8019678201 Bacteria 8863603
349 8019688370 8019687851 Bacteria 8712826
350 8056685060 8056681323 Bacteria 8472857
351 8056691854 8056689827 Bacteria 6712655
352 Ga0466967_0151666
353 JGI25406J46586_10000141
354 JGI25153J46596_10001533
355 JGI25160J50197_1001294
356 Ga0055543_1003754
357 Ga0065165_1002974
358 Ga0065165_1003005
359 Ga0065712_10110763
360 Ga0070658_10107279
361 Ga0070658_10225725
362 Ga0070683_100054825
363 Ga0070683_100085836
364 Ga0070683_100148009
365 Ga0070680_100003306
366 Ga0070680_100075298
367 Ga0070680_100111539
368 Ga0070660_100053294
369 Ga0070691_10022461
370 Ga0070659_100066547
371 Ga0070713_100185101
372 Ga0070710_10081825
373 Ga0070711_100047871
374 Ga0070681_10028949
375 Ga0070681_10052193
376 Ga0070681_10064419
377 Ga0070681_10087176
378 Ga0070679_100027061
379 Ga0070679_100044585
380 Ga0070679_100046319
381 Ga0070684_100014121
382 Ga0070684_100028313
383 Ga0070697_100147482
384 Ga0068853_100005359
385 Ga0068853_100068588
386 Ga0068853_100091017
387 Ga0070665_100098678
388 Ga0068855_100010147
389 Ga0068855_100021003
390 Ga0068857_100089229
391 Ga0068854_100189379
392 Ga0068856_100004479
393 Ga0068852_100027430
394 Ga0068860_100000317
395 Ga0081539_10000008
396 Ga0070717_10006275
397 Ga0075365_10077598
398 Ga0070716_100116924
399 Ga0070712_100177372
400 Ga0097621_100049964
401 Ga0099822_1002198
402 Ga0099794_10044662
403 Ga0099794_10097633
404 Ga0099795_10040951
405 Ga0105240_10077632
406 Ga0105240_10127591
407 Ga0105237_10011285
408 Ga0105238_10003129
409 Ga0105238_10119500
410 Ga0105238_10307098
411 Ga0105239_10008965
412 Ga0105239_10017421
413 Ga0105239_10144944
414 Ga0105239_10463553
415 Ga0105246_10149257
416 Ga0157373_10044092
417 Ga0157370_10067708
418 Ga0157369_10004501
419 Ga0157369_10165492
420 Ga0157378_10037649
421 Ga0157372_10283022
422 Ga0213876_10083569
423 Ga0209677_101241
424 Ga0209233_1002461
425 Ga0209233_1003268
426 Ga0209564_1002300
427 Ga0209758_1001983
428 Ga0207426_1000466
429 Ga0207426_1001739
430 Ga0207647_10095833
431 Ga0207707_10002025
432 Ga0207707_10016326
433 Ga0207707_10095312
434 Ga0207695_10084929
435 Ga0207695_10228309
436 Ga0207671_10025519
437 Ga0207663_10007113
438 Ga0207657_10009869
439 Ga0207652_10002138
440 Ga0207694_10101107
441 Ga0207665_10129883
442 Ga0207711_10204615
443 Ga0207661_10009379
444 Ga0207661_10017331
445 Ga0207667_10008468
446 Ga0207667_10045729
447 Ga0207703_10060914
448 Ga0207639_10145272
449 Ga0207678_10065922
450 Ga0207678_10161072
451 Ga0207702_10001399
452 Ga0207702_10153226
453 Ga0207641_10066110
454 Ga0207674_10010829
455 Ga0207698_10036991
456 Ga0207698_10084775
457 Ga0209589_1000018
458 Ga0209489_100026
459 Ga0209700_100035
460 Ga0209179_1001264
461 Ga0209588_1007968
462 Ga0268266_10098933
463 Ga0268264_10000035
464 Ga0265337_1002402
465 Ga0265326_10003557
466 Ga0265319_1002432
467 Ga0265334_10002131
468 Ga0265318_10003684
469 Ga0265323_10001287
470 Ga0265322_10005293
471 Ga0265336_10000128
472 Ga0265338_10000119
473 Ga0265324_10003823
474 Ga0265330_10021112
475 Ga0265330_10040036
476 Ga0265325_10006257
477 Ga0307509_10056729
478 Ga0307509_10149210
479 Ga0307509_10205331
480 Ga0307508_10017864
481 Ga0307508_10022171
482 Ga0265314_10011778
483 Ga0307507_10046738
484 Ga0307510_10143982
485 Ga0373934_0026418
486 Ga0373923_0007439
487 Ga0373954_0009425
488 Ga0373956_0088950
489 Ga0373957_0018778
490 Ga0373931_0007686
491 Ga0373927_0028407
492 Ga0373927_0043988
493 Ga0373927_0046255
494 Ga0373933_0002970
495 Ga0373933_0068497
496 Ga0373925_0106821
497 Ga0395900_0291393
498 Ga0395898_0002649
499 Ga0395898_0180452
500 Ga0395898_0225175
501 Ga0436365_0032113
502 Ga0436363_0481135
503 Ga0466971_0023411
504 Ga0466959_0030102
505 Ga0466967_0112736
506 Ga0495592_0001015
507 Ga0495603_0011089
508 Ga0495603_0034338
509 Ga0495629_0005467
510 Ga0495653_0001070
511 Ga0495606_0092365
512 Ga0495628_0052343
513 Ga0495628_0055970
514 Ga0495648_0008834
515 Ga0495640_0022481
516 Ga0495645_0002189
517 Ga0495645_0005223
518 Ga0495635_0001667
519 Ga0495657_0004150
520 Ga0495599_0003132
521 Ga0495599_0059560
522 Ga0495623_0064928
523 Ga0495646_0097782
524 Ga0495613_0044365
525 Ga0495624_0096644
526 Ga0495600_0003617
527 Ga0495674_0047719
528 Ga0495674_0090398
529 Ga0495680_0207246
530 Ga0495684_0019374
531 Ga0495593_0000953
532 Ga0496100_0068920
533 Ga0496101_0032891
534 Ga0496102_0190590
535 Ga0496104_0013413
536 Ga0496104_0104556
537 Ga0496105_0006080
538 Ga0496106_0000116
539 Ga0496106_0002853
540 Ga0496106_0025828
541 Ga0496107_0016392
542 Ga0496107_0022024
543 Ga0496108_0000523
544 Ga0496108_0204419
545 Ga0496109_0001407
546 Ga0496109_0060991
547 Ga0496109_0195060
548 Ga0496110_0037615
549 Ga0496110_0096746
550 Ga0496111_0049473
551 Ga0496111_0086126
552 Ga0496112_0014449
553 Ga0496112_0086493
554 Ga0496114_0002764
555 Ga0496115_0099697
556 Ga0496115_0118607
557 Ga0496117_0025638
558 Ga0496118_0006091
559 Ga0496118_0040326
560 Ga0496119_0099025
561 Ga0496121_0018786
562 Ga0496124_0016465
563 Ga0496126_0006291
564 Ga0496126_0118311
565 Ga0496126_0252328
566 Ga0501031_0003360
567 Ga0501031_0005038
568 Ga0501032_0000046
569 Ga0501032_0005402
570 Ga0501033_0000514
571 Ga0501033_0012307
572 Ga0501034_0000061
573 Ga0501034_0002794
574 Ga0501036_0000027
575 Ga0501036_0000183
576 Ga0501037_0000104
577 Ga0501037_0000210
578 Ga0501038_0000340
579 Ga0501038_0000415
580 Ga0501039_0000121
581 Ga0501043_0000135
582 Ga0501043_0001636
583 Ga0501046_0001575
584 Ga0501047_0000101
585 Ga0501048_0000060
586 Ga0501048_0002792
587 Ga0501067_0002365
588 Ga0501067_0029676
589 Ga0501070_0000702
590 Ga0501070_0009854
591 Ga0501071_0008844
592 Ga0501072_0007262
593 Ga0501073_0000014
594 Ga0501073_0012830
595 Ga0501074_0028391
596 Ga0501080_0000121
597 Ga0501080_0003911
598 Ga0501083_0010027
599 Ga0501035_0000560
600 Ga0501035_0005432
601 Ga0501044_0000703
602 Ga0501045_0128763
603 Ga0500557_000039
604 Ga0500562_015385
605 Ga0500569_002549
606 Ga0500658_0076387
607 Ga0500559_0009317
608 Ga0500573_0028222
609 Ga0500603_001850
610 Ga0500616_0009727
611 Ga0500638_085466
612 Ga0500636_0000194
613 Ga0500636_0071232
614 Ga0500601_000497
615 Ga0501084_0001955
616 Ga0501082_0056821
617 2507510090
618 2508544092
619 2508697968
620 2513660037
621 2513676476
622 2513705412
623 2513720618
624 2513858214
625 2513892014
626 2513922153
627 2515629404
628 2517893897
629 2524467051
630 2671122889
631 2728748022
632 2824622774
633 2824632393
634 2824640412
635 2824647401
636 2824708363
637 2824720379
638 2824728708
639 2824758928
640 2824766104
641 2874593292
642 2874636107
643 2874652933
644 2876773332
645 2876821285
646 2879077248
647 2879130195
648 2879146710
649 2881365732
650 2885390043
651 2903771721
652 2904693455
653 2904718544
654 2906635941
655 2906663961
656 2908761780
657 2932787028
658 2932832382
659 2935611005
660 2935634519
661 2935648436
662 2935657576
663 2935771419
664 2935779108
665 2935788312
666 2935796923
667 2935820490
668 2935849501
669 2935911725
670 2935928754
671 2935938399
672 2935945709
673 2935954684
674 2935963284
675 2935970571
676 2935979193
677 2935987795
678 2936011346
679 2936019941
680 2936028537
681 2936046664
682 2936062357
683 2941509005
684 2941516834
685 2941525071
686 3005478670
687 3005713434
688 8016515180
689 8016612299
690 8016621510
691 8016628451
692 8016632650
693 8017061274
694 8019555534
695 8019626446
696 8019636045
697 8019643619
698 8019673442
699 8019682687
700 8019688370
701 8056685060
702 8056691854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01757

Acyl_transf_3

Acyltransferase family

1

341

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z16-assembly1.cif.gz_b structure of the mrp antiporter complex 0.2756 101 241
6z16-assembly1.cif.gz_b structure of the mrp antiporter complex 0.2513 101 241
8jzr-assembly1.cif.gz_B outward_facing slc15a4 monomer 0.2387 19 379
8c03-assembly1.cif.gz_A structure of slc40/ferroportin in complex with vamifeport and synthetic nanobody sy12 in outward-facing conformation 0.2383 22 378
2z0o-assembly1.cif.gz_A-2 crystal structure of appl1-bar-ph domain 0.238 154 369
ID Description Score Start End Superfamily
af_Q8IIU4_1_132_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3874 190 319 1.20.140.150
af_Q8IIU4_1_132_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3568 190 319 1.20.140.150
af_A0A0R4IDZ8_482_655_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.3451 160 314 1.20.1420.10
af_A0A0R0KVV6_29_221_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3353 254 377 1.20.1250.20
af_Q57985_1_147_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3283 170 314 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1H1TL33-F1-model_v4 Acyltransferase family protein 0.9066 20 380 GO:0016020
GO:0016747
AF-A0A4Q5PFA7-F1-model_v4 Acyltransferase 0.9061 20 380 GO:0016020
GO:0016747
AF-A0A0Q6ZCC3-F1-model_v4 Acyltransferase 0.9054 17 380 GO:0016020
GO:0016747
AF-A0A431P542-F1-model_v4 deleted 0.903 20 237
AF-I2QS17-F1-model_v4 Acyltransferase family protein 0.8862 8 380 GO:0016020
GO:0016747

Map