F418697

General Info

Members Datasets Scaffolds Average Seq Length
351 202 702 86

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100248096|Ga0307409_1002480962
Length 89
Sequence MMEDYGIIGWIVIGGLAGGIAKLLMPGRDPGGCIVTVLLGIAGALVAGWLGRAVGWYDANDQGAGFIAAIVGAFLLLLIYRVIAGRRRV

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
129 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
130 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
131 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
145 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
159 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
160 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
161 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
192 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
193 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
194 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0.28
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 6.27
Rhizosphere 91.45
Stem 0
Stem Tuber 0.28
Unclassified 20.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100248096 3300031995 Bacteria 1626
2 MBSR1b_contig_6265034 2162886012 Bacteria 871
3 rootH1_10227068 3300003323 Bacteria 1146
4 Ga0065712_10142496 3300005290 Bacteria 1438
5 Ga0065715_10006332 3300005293 Bacteria 3883
6 Ga0065715_10019073 3300005293 Bacteria 1726
7 Ga0070658_10022891 3300005327 Bacteria 5015
8 Ga0070658_10068417 3300005327 Bacteria 2903
9 Ga0070658_10136827 3300005327 Bacteria 2044
10 Ga0070658_10462982 3300005327 Unclassified 1093
11 Ga0070658_11162074 3300005327 Unclassified 671
12 Ga0070676_10767212 3300005328 Unclassified 709
13 Ga0070676_11568705 3300005328 Bacteria 508
14 Ga0070683_100853238 3300005329 Unclassified 873
15 Ga0070670_100048043 3300005331 Bacteria 3673
16 Ga0070670_100049722 3300005331 Bacteria 3604
17 Ga0070670_100106430 3300005331 Bacteria 2417
18 Ga0070670_101189922 3300005331 Bacteria 696
19 Ga0070677_10001482 3300005333 Bacteria 7430
20 Ga0070677_10203469 3300005333 Bacteria 957
21 Ga0068869_101012395 3300005334 Bacteria 724
22 Ga0070666_10044883 3300005335 Bacteria 2963
23 Ga0070666_11019490 3300005335 Bacteria 614
24 Ga0070680_100275136 3300005336 Bacteria 1426
25 Ga0068868_101727552 3300005338 Unclassified 590
26 Ga0070660_100063394 3300005339 Bacteria 2873
27 Ga0070687_101283501 3300005343 Bacteria 543
28 Ga0070661_100019297 3300005344 Bacteria 4860
29 Ga0070661_100072971 3300005344 Bacteria 2526
30 Ga0070661_100525199 3300005344 Bacteria 950
31 Ga0070661_101074115 3300005344 Unclassified 670
32 Ga0070692_10546531 3300005345 Bacteria 758
33 Ga0070668_100025261 3300005347 Bacteria 4503
34 Ga0070668_100359888 3300005347 Bacteria 1233
35 Ga0070668_101808683 3300005347 Bacteria 562
36 Ga0070669_100013193 3300005353 Bacteria 5874
37 Ga0070669_100757402 3300005353 Unclassified 823
38 Ga0070675_100011593 3300005354 Bacteria 6904
39 Ga0070675_100026972 3300005354 Bacteria 4613
40 Ga0070671_100035325 3300005355 Bacteria 4140
41 Ga0070671_101252777 3300005355 Bacteria 653
42 Ga0070674_100078245 3300005356 Bacteria 2356
43 Ga0070673_100073244 3300005364 Bacteria 2757
44 Ga0070673_100619423 3300005364 Unclassified 988
45 Ga0070673_102185533 3300005364 Bacteria 526
46 Ga0070688_100946983 3300005365 Unclassified 681
47 Ga0070659_100026598 3300005366 Bacteria 4453
48 Ga0070659_100150383 3300005366 Bacteria 1899
49 Ga0070659_100188814 3300005366 Bacteria 1693
50 Ga0070667_100028538 3300005367 Bacteria 4647
51 Ga0070714_100008378 3300005435 Bacteria 8068
52 Ga0070713_100349957 3300005436 Bacteria 1370
53 Ga0070663_100081043 3300005455 Bacteria 2385
54 Ga0070663_100841371 3300005455 Unclassified 789
55 Ga0070663_101001994 3300005455 Unclassified 726
56 Ga0070663_101462300 3300005455 Unclassified 607
57 Ga0070678_100163472 3300005456 Unclassified 1806
58 Ga0070662_100006956 3300005457 Bacteria 7319
59 Ga0070662_100024876 3300005457 Bacteria 4130
60 Ga0070662_100042331 3300005457 Bacteria 3253
61 Ga0070662_100822709 3300005457 Bacteria 790
62 Ga0070681_10469862 3300005458 Bacteria 1170
63 Ga0070681_11790744 3300005458 Bacteria 541
64 Ga0068867_100508046 3300005459 Bacteria 1037
65 Ga0070684_100508332 3300005535 Bacteria 1116
66 Ga0070684_101652225 3300005535 Unclassified 604
67 Ga0068853_100135164 3300005539 Bacteria 2210
68 Ga0070672_100494363 3300005543 Unclassified 1058
69 Ga0070672_101441848 3300005543 Unclassified 616
70 Ga0070686_100584182 3300005544 Bacteria 878
71 Ga0068855_100013172 3300005563 Bacteria 9974
72 Ga0068855_100267377 3300005563 Bacteria 1903
73 Ga0070664_100002761 3300005564 Bacteria 14168
74 Ga0070664_100005532 3300005564 Bacteria 10141
75 Ga0070664_100047638 3300005564 Bacteria 3621
76 Ga0070664_100173954 3300005564 Unclassified 1911
77 Ga0070664_100853099 3300005564 Unclassified 853
78 Ga0068854_100212947 3300005578 Bacteria 1525
79 Ga0068856_100081860 3300005614 Bacteria 3204
80 Ga0068856_100110532 3300005614 Bacteria 2745
81 Ga0068856_102611076 3300005614 Bacteria 511
82 Ga0068852_100003515 3300005616 Bacteria 10961
83 Ga0068852_100035142 3300005616 Bacteria 4176
84 Ga0068852_102035615 3300005616 Bacteria 596
85 Ga0068859_100001549 3300005617 Bacteria 23444
86 Ga0068864_100084836 3300005618 Bacteria 2784
87 Ga0068864_100185737 3300005618 Bacteria 1903
88 Ga0068866_10473974 3300005718 Bacteria 823
89 Ga0068861_100644622 3300005719 Bacteria 978
90 Ga0068861_100661372 3300005719 Bacteria 966
91 Ga0068851_10050201 3300005834 Bacteria 2118
92 Ga0068863_100017339 3300005841 Bacteria 6905
93 Ga0068858_100670365 3300005842 Bacteria 1008
94 Ga0068860_100005237 3300005843 Bacteria 13170
95 Ga0068862_100000075 3300005844 Bacteria 117819
96 Ga0068862_100076411 3300005844 Bacteria 2898
97 Ga0070715_10580613 3300006163 Bacteria 654
98 Ga0075367_10403560 3300006178 Bacteria 864
99 Ga0075366_10008607 3300006195 Bacteria 5682
100 Ga0097621_101534775 3300006237 Unclassified 632
101 Ga0075370_10264885 3300006353 Bacteria 1020
102 Ga0068871_100399968 3300006358 Unclassified 1223
103 Ga0068871_101208437 3300006358 Bacteria 709
104 Ga0068871_101728431 3300006358 Unclassified 593
105 Ga0075433_10047137 3300006852 Bacteria 3749
106 Ga0075433_10153552 3300006852 Bacteria 2048
107 Ga0075434_100003361 3300006871 Bacteria 14317
108 Ga0075436_101512451 3300006914 Bacteria 510
109 Ga0097620_100001549 3300006931 Bacteria 23444
110 Ga0111539_10437960 3300009094 Bacteria 1522
111 Ga0111539_12059204 3300009094 Bacteria 662
112 Ga0105245_11361441 3300009098 Unclassified 759
113 Ga0114129_10012318 3300009147 Bacteria 12168
114 Ga0114129_12672930 3300009147 Unclassified 595
115 Ga0105241_12205427 3300009174 Bacteria 546
116 Ga0105242_12890924 3300009176 Bacteria 531
117 Ga0105248_10085335 3300009177 Bacteria 3553
118 Ga0105248_11452685 3300009177 Bacteria 776
119 Ga0105249_10349380 3300009553 Bacteria 1498
120 Ga0105249_10464943 3300009553 Bacteria 1306
121 Ga0105246_12515243 3300011119 Unclassified 507
122 Ga0157327_1030390 3300012512 Unclassified 671
123 Ga0157373_10008353 3300013100 Bacteria 7693
124 Ga0157373_10566021 3300013100 Bacteria 825
125 Ga0157371_10017657 3300013102 Bacteria 5293
126 Ga0157371_10359652 3300013102 Bacteria 1061
127 Ga0157369_10013212 3300013105 Bacteria 9345
128 Ga0157369_10378275 3300013105 Bacteria 1470
129 Ga0157369_12383431 3300013105 Unclassified 536
130 Ga0157374_10388447 3300013296 Unclassified 1391
131 Ga0157378_11235478 3300013297 Unclassified 787
132 Ga0163162_13160095 3300013306 Bacteria 529
133 Ga0163162_13170535 3300013306 Bacteria 528
134 Ga0157375_10409526 3300013308 Unclassified 1522
135 Ga0157375_12399273 3300013308 Unclassified 629
136 Ga0163163_11208264 3300014325 Unclassified 819
137 Ga0157380_10046399 3300014326 Bacteria 3412
138 Ga0157376_10420186 3300014969 Unclassified 1297
139 Ga0163161_10284907 3300017792 Bacteria 1297
140 Ga0207656_10010354 3300025321 Bacteria 3492
141 Ga0207656_10024282 3300025321 Bacteria 2450
142 Ga0207682_10000899 3300025893 Bacteria 13769
143 Ga0207682_10143476 3300025893 Bacteria 1073
144 Ga0207642_10232824 3300025899 Bacteria 1036
145 Ga0207710_10002858 3300025900 Bacteria 7860
146 Ga0207688_10017136 3300025901 Bacteria 3937
147 Ga0207688_10083965 3300025901 Bacteria 1822
148 Ga0207688_10513792 3300025901 Bacteria 751
149 Ga0207680_10049819 3300025903 Bacteria 2495
150 Ga0207645_10330602 3300025907 Bacteria 1018
151 Ga0207643_10313891 3300025908 Bacteria 978
152 Ga0207705_10006764 3300025909 Bacteria 8475
153 Ga0207705_10096376 3300025909 Bacteria 2172
154 Ga0207705_10379489 3300025909 Unclassified 1092
155 Ga0207684_11544700 3300025910 Unclassified 539
156 Ga0207707_10409983 3300025912 Bacteria 1163
157 Ga0207662_11002399 3300025918 Bacteria 593
158 Ga0207657_10002456 3300025919 Bacteria 20031
159 Ga0207649_10013230 3300025920 Bacteria 4604
160 Ga0207649_10037152 3300025920 Bacteria 2940
161 Ga0207649_10049849 3300025920 Bacteria 2588
162 Ga0207649_10697510 3300025920 Bacteria 787
163 Ga0207649_11165724 3300025920 Unclassified 609
164 Ga0207681_10718392 3300025923 Unclassified 831
165 Ga0207650_10075443 3300025925 Bacteria 2545
166 Ga0207650_10100025 3300025925 Bacteria 2230
167 Ga0207650_10259138 3300025925 Bacteria 1410
168 Ga0207659_10013492 3300025926 Bacteria 5235
169 Ga0207659_10104422 3300025926 Bacteria 2143
170 Ga0207700_10168191 3300025928 Bacteria 1827
171 Ga0207700_10819300 3300025928 Unclassified 833
172 Ga0207664_10004690 3300025929 Bacteria 9274
173 Ga0207644_10020511 3300025931 Bacteria 4493
174 Ga0207644_10292832 3300025931 Bacteria 1310
175 Ga0207690_10016823 3300025932 Bacteria 4456
176 Ga0207690_10153342 3300025932 Bacteria 1710
177 Ga0207690_10178983 3300025932 Bacteria 1595
178 Ga0207690_11744738 3300025932 Bacteria 520
179 Ga0207706_10008560 3300025933 Bacteria 9430
180 Ga0207706_10036108 3300025933 Bacteria 4391
181 Ga0207706_10120330 3300025933 Bacteria 2308
182 Ga0207670_10171359 3300025936 Bacteria 1628
183 Ga0207669_10206603 3300025937 Bacteria 1430
184 Ga0207691_10238734 3300025940 Bacteria 1572
185 Ga0207691_10469893 3300025940 Unclassified 1069
186 Ga0207691_11312220 3300025940 Unclassified 597
187 Ga0207689_10138759 3300025942 Bacteria 2003
188 Ga0207661_10630086 3300025944 Unclassified 985
189 Ga0207661_11056856 3300025944 Unclassified 748
190 Ga0207679_10017661 3300025945 Bacteria 4763
191 Ga0207679_10129762 3300025945 Bacteria 2020
192 Ga0207679_10134811 3300025945 Unclassified 1987
193 Ga0207679_10814657 3300025945 Unclassified 852
194 Ga0207679_11085757 3300025945 Bacteria 734
195 Ga0207679_12177688 3300025945 Bacteria 503
196 Ga0207667_10461542 3300025949 Bacteria 1290
197 Ga0207651_10257434 3300025960 Unclassified 1431
198 Ga0207651_10687534 3300025960 Unclassified 900
199 Ga0207651_11088813 3300025960 Bacteria 716
200 Ga0207712_10000012 3300025961 Bacteria 392363
201 Ga0207712_10074572 3300025961 Bacteria 2450
202 Ga0207668_10047150 3300025972 Bacteria 2949
203 Ga0207668_10128549 3300025972 Bacteria 1931
204 Ga0207668_11062179 3300025972 Bacteria 725
205 Ga0207668_11116457 3300025972 Bacteria 707
206 Ga0207658_10008780 3300025986 Bacteria 6862
207 Ga0207658_10189176 3300025986 Bacteria 1709
208 Ga0207677_11148349 3300026023 Unclassified 710
209 Ga0207639_10423871 3300026041 Unclassified 1203
210 Ga0207678_10407677 3300026067 Bacteria 1177
211 Ga0207702_10017757 3300026078 Bacteria 5889
212 Ga0207702_10101196 3300026078 Bacteria 2544
213 Ga0207641_10002367 3300026088 Bacteria 17403
214 Ga0207641_11834906 3300026088 Unclassified 608
215 Ga0207676_10577733 3300026095 Unclassified 1077
216 Ga0207675_100073156 3300026118 Bacteria 3207
217 Ga0207675_100771426 3300026118 Bacteria 973
218 Ga0207675_101079831 3300026118 Bacteria 822
219 Ga0207683_10613173 3300026121 Unclassified 1007
220 Ga0207683_10933198 3300026121 Bacteria 806
221 Ga0207683_12058056 3300026121 Unclassified 519
222 Ga0207698_10016543 3300026142 Bacteria 4975
223 Ga0207698_10382644 3300026142 Unclassified 1339
224 Ga0207698_10659261 3300026142 Bacteria 1037
225 Ga0209983_1088619 3300027665 Bacteria 696
226 Ga0268265_10000087 3300028380 Bacteria 117852
227 Ga0268265_10108460 3300028380 Bacteria 2260
228 Ga0268264_10001015 3300028381 Bacteria 28303
229 Ga0314311_1016505 3300030733 Bacteria 1209
230 Ga0316179_1057253 3300030734 Bacteria 796
231 Ga0316180_1191543 3300030736 Bacteria 659
232 Ga0316183_1090669 3300030742 Bacteria 985
233 Ga0316182_1027801 3300030745 Bacteria 1037
234 Ga0316182_1291412 3300030745 Bacteria 1398
235 Ga0307408_100062875 3300031548 Bacteria 2714
236 Ga0307408_100471265 3300031548 Bacteria 1093
237 Ga0307408_100975583 3300031548 Bacteria 780
238 Ga0307408_102142300 3300031548 Bacteria 540
239 Ga0307405_10068934 3300031731 Bacteria 2266
240 Ga0307405_10089238 3300031731 Bacteria 2036
241 Ga0307405_10119955 3300031731 Bacteria 1798
242 Ga0307413_10127294 3300031824 Bacteria 1737
243 Ga0307413_11206394 3300031824 Bacteria 658
244 Ga0307410_10002031 3300031852 Bacteria 9548
245 Ga0307410_10051771 3300031852 Bacteria 2769
246 Ga0307410_10370196 3300031852 Bacteria 1150
247 Ga0307406_10033488 3300031901 Bacteria 3146
248 Ga0307407_10862214 3300031903 Bacteria 693
249 Ga0307412_10268789 3300031911 Bacteria 1333
250 Ga0307412_10394198 3300031911 Unclassified 1125
251 Ga0307412_11099365 3300031911 Bacteria 707
252 Ga0307409_100143797 3300031995 Bacteria 2059
253 Ga0307409_100196969 3300031995 Bacteria 1799
254 Ga0307409_101952338 3300031995 Bacteria 616
255 Ga0307416_100000853 3300032002 Bacteria 16054
256 Ga0307416_100405000 3300032002 Bacteria 1403
257 Ga0307416_100569454 3300032002 Bacteria 1208
258 Ga0307416_101620355 3300032002 Bacteria 752
259 Ga0307416_102290720 3300032002 Bacteria 641
260 Ga0307414_10000904 3300032004 Bacteria 15210
261 Ga0307411_10124752 3300032005 Bacteria 1870
262 Ga0307415_100026338 3300032126 Bacteria 3666
263 Ga0373959_0092406 3300034820 Bacteria 711
264 Ga0373949_0047423 3300035090 Unclassified 1074
265 Ga0373932_0031082 3300035112 Unclassified 1485
266 Ga0373941_0349211 3300035115 Bacteria 601
267 Ga0373960_0368430 3300035121 Unclassified 548
268 Ga0373935_1410416 3300035692 Bacteria 521
269 Ga0373947_1137192 3300035725 Bacteria 532
270 Ga0395899_0066080 3300037312 Bacteria 2656
271 Ga0395900_0025988 3300037418 Bacteria 5995
272 Ga0395900_0778130 3300037418 Bacteria 886
273 Ga0395900_1127147 3300037418 Unclassified 701
274 Ga0395905_0004140 3300037471 Bacteria 15179
275 Ga0395905_0009301 3300037471 Bacteria 9614
276 Ga0395905_0037976 3300037471 Bacteria 4519
277 Ga0395905_0054963 3300037471 Bacteria 3726
278 Ga0395905_0103972 3300037471 Bacteria 2666
279 Ga0395905_0280720 3300037471 Bacteria 1552
280 Ga0395905_0603032 3300037471 Unclassified 1000
281 Ga0395901_0049725 3300038443 Bacteria 4356
282 Ga0395901_0398303 3300038443 Bacteria 1415
283 Ga0395901_0432417 3300038443 Unclassified 1348
284 Ga0395901_1531689 3300038443 Unclassified 622
285 Ga0436363_1287039 3300039450 Bacteria 1231
286 Ga0439461_0021157 3300041410 Bacteria 1294
287 Ga0439466_0282204 3300041411 Bacteria 503
288 Ga0451802_2129832 3300041460 Unclassified 655
289 Ga0439432_070144 3300042006 Bacteria 1070
290 Ga0439449_0100663 3300042007 Bacteria 1068
291 Ga0439462_0054827 3300042015 Bacteria 1075
292 Ga0439462_0205998 3300042015 Bacteria 561
293 Ga0439434_0123362 3300042435 Unclassified 846
294 Ga0451577_1631614 3300042876 Unclassified 568
295 Ga0466972_0027887 3300044658 Bacteria 2791
296 Ga0466972_0050561 3300044658 Bacteria 2006
297 Ga0466965_0149619 3300044683 Bacteria 1220
298 Ga0466965_0337136 3300044683 Bacteria 824
299 Ga0466966_0172851 3300044684 Bacteria 1312
300 Ga0466966_0311370 3300044684 Bacteria 946
301 Ga0466961_0295617 3300044693 Bacteria 990
302 Ga0466963_0115535 3300044694 Bacteria 1844
303 Ga0466963_0161994 3300044694 Bacteria 1557
304 Ga0466963_0452673 3300044694 Bacteria 906
305 Ga0466971_0122353 3300044719 Bacteria 1205
306 Ga0466957_0123834 3300044842 Bacteria 1650
307 Ga0466960_0163621 3300044901 Bacteria 1196
308 Ga0466959_0170180 3300045049 Bacteria 1528
309 Ga0466958_0210806 3300045836 Bacteria 1238
310 Ga0466967_0129038 3300045976 Bacteria 2345
311 Ga0466967_0922619 3300045976 Bacteria 869
312 Ga0466967_2052567 3300045976 Unclassified 568
313 Ga0495590_0127010 3300046457 Unclassified 916
314 Ga0495585_0210305 3300046492 Bacteria 986
315 Ga0495642_0076606 3300046528 Bacteria 1404
316 Ga0495670_0241225 3300046691 Bacteria 962
317 Ga0496101_1101436 3300048904 Bacteria 623
318 Ga0496102_0733380 3300048905 Unclassified 911
319 Ga0496104_0237386 3300048907 Bacteria 1735
320 Ga0496105_0146600 3300048908 Unclassified 1941
321 Ga0496107_0077274 3300048910 Bacteria 2425
322 Ga0496108_0034982 3300048911 Bacteria 4174
323 Ga0496108_0071297 3300048911 Bacteria 2931
324 Ga0496109_0020606 3300048912 Bacteria 5824
325 Ga0496109_0052339 3300048912 Bacteria 3721
326 Ga0496109_0517913 3300048912 Bacteria 1126
327 Ga0496109_0709375 3300048912 Unclassified 943
328 Ga0496110_0036955 3300048913 Bacteria 4243
329 Ga0496110_0236834 3300048913 Unclassified 1661
330 Ga0496110_1017062 3300048913 Bacteria 736
331 Ga0496111_0054967 3300048914 Bacteria 2879
332 Ga0496111_0959210 3300048914 Bacteria 614
333 Ga0496111_1182857 3300048914 Bacteria 542
334 Ga0496112_0059671 3300048915 Bacteria 3759
335 Ga0496112_0420419 3300048915 Unclassified 1275
336 Ga0496113_0011581 3300048916 Bacteria 5893
337 Ga0496113_0026889 3300048916 Bacteria 4118
338 Ga0496124_0244467 3300048927 Bacteria 1332
339 Ga0501201_035845 3300049651 Bacteria 581
340 Ga0501247_042849 3300049677 Bacteria 651
341 Ga0501260_055904 3300049689 Unclassified 506
342 Ga0501268_061629 3300049765 Bacteria 744
343 nmdc:mga0k408_30555_c1 3300050493 Bacteria 3072
344 nmdc:mga05p37_28626_c1 3300050507 Bacteria 6796
345 nmdc:mga05p37_91746_c1 3300050507 Bacteria 3743
346 nmdc:mga0qj67_1152536_c1 3300050509 Unclassified 604
347 nmdc:mga0n895_1777886_c1 3300050512 Unclassified 578
348 nmdc:mga08x19_625189_c1 3300050514 Bacteria 763
349 nmdc:mga0a205_36211_c1 3300050515 Bacteria 4741
350 Ga0587076_191297 3300059645 Bacteria 521
351 2885427340 2885427238 Bacteria 2291351
352 Ga0307409_100248096
353 MBSR1b_contig_6265034
354 rootH1_10227068
355 Ga0065712_10142496
356 Ga0065715_10006332
357 Ga0065715_10019073
358 Ga0070658_10022891
359 Ga0070658_10068417
360 Ga0070658_10136827
361 Ga0070658_10462982
362 Ga0070658_11162074
363 Ga0070676_10767212
364 Ga0070676_11568705
365 Ga0070683_100853238
366 Ga0070670_100048043
367 Ga0070670_100049722
368 Ga0070670_100106430
369 Ga0070670_101189922
370 Ga0070677_10001482
371 Ga0070677_10203469
372 Ga0068869_101012395
373 Ga0070666_10044883
374 Ga0070666_11019490
375 Ga0070680_100275136
376 Ga0068868_101727552
377 Ga0070660_100063394
378 Ga0070687_101283501
379 Ga0070661_100019297
380 Ga0070661_100072971
381 Ga0070661_100525199
382 Ga0070661_101074115
383 Ga0070692_10546531
384 Ga0070668_100025261
385 Ga0070668_100359888
386 Ga0070668_101808683
387 Ga0070669_100013193
388 Ga0070669_100757402
389 Ga0070675_100011593
390 Ga0070675_100026972
391 Ga0070671_100035325
392 Ga0070671_101252777
393 Ga0070674_100078245
394 Ga0070673_100073244
395 Ga0070673_100619423
396 Ga0070673_102185533
397 Ga0070688_100946983
398 Ga0070659_100026598
399 Ga0070659_100150383
400 Ga0070659_100188814
401 Ga0070667_100028538
402 Ga0070714_100008378
403 Ga0070713_100349957
404 Ga0070663_100081043
405 Ga0070663_100841371
406 Ga0070663_101001994
407 Ga0070663_101462300
408 Ga0070678_100163472
409 Ga0070662_100006956
410 Ga0070662_100024876
411 Ga0070662_100042331
412 Ga0070662_100822709
413 Ga0070681_10469862
414 Ga0070681_11790744
415 Ga0068867_100508046
416 Ga0070684_100508332
417 Ga0070684_101652225
418 Ga0068853_100135164
419 Ga0070672_100494363
420 Ga0070672_101441848
421 Ga0070686_100584182
422 Ga0068855_100013172
423 Ga0068855_100267377
424 Ga0070664_100002761
425 Ga0070664_100005532
426 Ga0070664_100047638
427 Ga0070664_100173954
428 Ga0070664_100853099
429 Ga0068854_100212947
430 Ga0068856_100081860
431 Ga0068856_100110532
432 Ga0068856_102611076
433 Ga0068852_100003515
434 Ga0068852_100035142
435 Ga0068852_102035615
436 Ga0068859_100001549
437 Ga0068864_100084836
438 Ga0068864_100185737
439 Ga0068866_10473974
440 Ga0068861_100644622
441 Ga0068861_100661372
442 Ga0068851_10050201
443 Ga0068863_100017339
444 Ga0068858_100670365
445 Ga0068860_100005237
446 Ga0068862_100000075
447 Ga0068862_100076411
448 Ga0070715_10580613
449 Ga0075367_10403560
450 Ga0075366_10008607
451 Ga0097621_101534775
452 Ga0075370_10264885
453 Ga0068871_100399968
454 Ga0068871_101208437
455 Ga0068871_101728431
456 Ga0075433_10047137
457 Ga0075433_10153552
458 Ga0075434_100003361
459 Ga0075436_101512451
460 Ga0097620_100001549
461 Ga0111539_10437960
462 Ga0111539_12059204
463 Ga0105245_11361441
464 Ga0114129_10012318
465 Ga0114129_12672930
466 Ga0105241_12205427
467 Ga0105242_12890924
468 Ga0105248_10085335
469 Ga0105248_11452685
470 Ga0105249_10349380
471 Ga0105249_10464943
472 Ga0105246_12515243
473 Ga0157327_1030390
474 Ga0157373_10008353
475 Ga0157373_10566021
476 Ga0157371_10017657
477 Ga0157371_10359652
478 Ga0157369_10013212
479 Ga0157369_10378275
480 Ga0157369_12383431
481 Ga0157374_10388447
482 Ga0157378_11235478
483 Ga0163162_13160095
484 Ga0163162_13170535
485 Ga0157375_10409526
486 Ga0157375_12399273
487 Ga0163163_11208264
488 Ga0157380_10046399
489 Ga0157376_10420186
490 Ga0163161_10284907
491 Ga0207656_10010354
492 Ga0207656_10024282
493 Ga0207682_10000899
494 Ga0207682_10143476
495 Ga0207642_10232824
496 Ga0207710_10002858
497 Ga0207688_10017136
498 Ga0207688_10083965
499 Ga0207688_10513792
500 Ga0207680_10049819
501 Ga0207645_10330602
502 Ga0207643_10313891
503 Ga0207705_10006764
504 Ga0207705_10096376
505 Ga0207705_10379489
506 Ga0207684_11544700
507 Ga0207707_10409983
508 Ga0207662_11002399
509 Ga0207657_10002456
510 Ga0207649_10013230
511 Ga0207649_10037152
512 Ga0207649_10049849
513 Ga0207649_10697510
514 Ga0207649_11165724
515 Ga0207681_10718392
516 Ga0207650_10075443
517 Ga0207650_10100025
518 Ga0207650_10259138
519 Ga0207659_10013492
520 Ga0207659_10104422
521 Ga0207700_10168191
522 Ga0207700_10819300
523 Ga0207664_10004690
524 Ga0207644_10020511
525 Ga0207644_10292832
526 Ga0207690_10016823
527 Ga0207690_10153342
528 Ga0207690_10178983
529 Ga0207690_11744738
530 Ga0207706_10008560
531 Ga0207706_10036108
532 Ga0207706_10120330
533 Ga0207670_10171359
534 Ga0207669_10206603
535 Ga0207691_10238734
536 Ga0207691_10469893
537 Ga0207691_11312220
538 Ga0207689_10138759
539 Ga0207661_10630086
540 Ga0207661_11056856
541 Ga0207679_10017661
542 Ga0207679_10129762
543 Ga0207679_10134811
544 Ga0207679_10814657
545 Ga0207679_11085757
546 Ga0207679_12177688
547 Ga0207667_10461542
548 Ga0207651_10257434
549 Ga0207651_10687534
550 Ga0207651_11088813
551 Ga0207712_10000012
552 Ga0207712_10074572
553 Ga0207668_10047150
554 Ga0207668_10128549
555 Ga0207668_11062179
556 Ga0207668_11116457
557 Ga0207658_10008780
558 Ga0207658_10189176
559 Ga0207677_11148349
560 Ga0207639_10423871
561 Ga0207678_10407677
562 Ga0207702_10017757
563 Ga0207702_10101196
564 Ga0207641_10002367
565 Ga0207641_11834906
566 Ga0207676_10577733
567 Ga0207675_100073156
568 Ga0207675_100771426
569 Ga0207675_101079831
570 Ga0207683_10613173
571 Ga0207683_10933198
572 Ga0207683_12058056
573 Ga0207698_10016543
574 Ga0207698_10382644
575 Ga0207698_10659261
576 Ga0209983_1088619
577 Ga0268265_10000087
578 Ga0268265_10108460
579 Ga0268264_10001015
580 Ga0314311_1016505
581 Ga0316179_1057253
582 Ga0316180_1191543
583 Ga0316183_1090669
584 Ga0316182_1027801
585 Ga0316182_1291412
586 Ga0307408_100062875
587 Ga0307408_100471265
588 Ga0307408_100975583
589 Ga0307408_102142300
590 Ga0307405_10068934
591 Ga0307405_10089238
592 Ga0307405_10119955
593 Ga0307413_10127294
594 Ga0307413_11206394
595 Ga0307410_10002031
596 Ga0307410_10051771
597 Ga0307410_10370196
598 Ga0307406_10033488
599 Ga0307407_10862214
600 Ga0307412_10268789
601 Ga0307412_10394198
602 Ga0307412_11099365
603 Ga0307409_100143797
604 Ga0307409_100196969
605 Ga0307409_101952338
606 Ga0307416_100000853
607 Ga0307416_100405000
608 Ga0307416_100569454
609 Ga0307416_101620355
610 Ga0307416_102290720
611 Ga0307414_10000904
612 Ga0307411_10124752
613 Ga0307415_100026338
614 Ga0373959_0092406
615 Ga0373949_0047423
616 Ga0373932_0031082
617 Ga0373941_0349211
618 Ga0373960_0368430
619 Ga0373935_1410416
620 Ga0373947_1137192
621 Ga0395899_0066080
622 Ga0395900_0025988
623 Ga0395900_0778130
624 Ga0395900_1127147
625 Ga0395905_0004140
626 Ga0395905_0009301
627 Ga0395905_0037976
628 Ga0395905_0054963
629 Ga0395905_0103972
630 Ga0395905_0280720
631 Ga0395905_0603032
632 Ga0395901_0049725
633 Ga0395901_0398303
634 Ga0395901_0432417
635 Ga0395901_1531689
636 Ga0436363_1287039
637 Ga0439461_0021157
638 Ga0439466_0282204
639 Ga0451802_2129832
640 Ga0439432_070144
641 Ga0439449_0100663
642 Ga0439462_0054827
643 Ga0439462_0205998
644 Ga0439434_0123362
645 Ga0451577_1631614
646 Ga0466972_0027887
647 Ga0466972_0050561
648 Ga0466965_0149619
649 Ga0466965_0337136
650 Ga0466966_0172851
651 Ga0466966_0311370
652 Ga0466961_0295617
653 Ga0466963_0115535
654 Ga0466963_0161994
655 Ga0466963_0452673
656 Ga0466971_0122353
657 Ga0466957_0123834
658 Ga0466960_0163621
659 Ga0466959_0170180
660 Ga0466958_0210806
661 Ga0466967_0129038
662 Ga0466967_0922619
663 Ga0466967_2052567
664 Ga0495590_0127010
665 Ga0495585_0210305
666 Ga0495642_0076606
667 Ga0495670_0241225
668 Ga0496101_1101436
669 Ga0496102_0733380
670 Ga0496104_0237386
671 Ga0496105_0146600
672 Ga0496107_0077274
673 Ga0496108_0034982
674 Ga0496108_0071297
675 Ga0496109_0020606
676 Ga0496109_0052339
677 Ga0496109_0517913
678 Ga0496109_0709375
679 Ga0496110_0036955
680 Ga0496110_0236834
681 Ga0496110_1017062
682 Ga0496111_0054967
683 Ga0496111_0959210
684 Ga0496111_1182857
685 Ga0496112_0059671
686 Ga0496112_0420419
687 Ga0496113_0011581
688 Ga0496113_0026889
689 Ga0496124_0244467
690 Ga0501201_035845
691 Ga0501247_042849
692 Ga0501260_055904
693 Ga0501268_061629
694 nmdc:mga0k408_30555_c1
695 nmdc:mga05p37_28626_c1
696 nmdc:mga05p37_91746_c1
697 nmdc:mga0qj67_1152536_c1
698 nmdc:mga0n895_1777886_c1
699 nmdc:mga08x19_625189_c1
700 nmdc:mga0a205_36211_c1
701 Ga0587076_191297
702 2885427340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

37

85

0.96

Map