F418661

General Info

Members Datasets Scaffolds Average Seq Length
351 189 702 235

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10241629|Ga0207689_102416292
Length 268
Sequence LSIPDDSFVIPGYEGSDFAGMTGNETYFIILHFIYFHLIFTDLDSHSYDSDLLTDIVIGMSDGLTVPFALAAGLSGAVSTTTLIVIAGIAEIAAGSIAMGLGGYLAGKTEIDHYNSELKREYNEVETVPHKEKAEVKEFFQNLGLSEEVQEQAVEEMTKDKEKWVNFMMKYELGLDKPDEKRAAKSAFNIGVSYIVGGIIPLSPYFFVKDGVEGLKISAVITLCCLFIFGFFKSKITGVNPWWGAVRVSFIGAAAAACAFGIAKLIQG

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
182 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
183 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
184 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
187 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0
Rhizoplane 1.71
Rhizosphere 92.02
Stem 0
Stem Tuber 0
Unclassified 12.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10241629 3300025942 Unclassified 1493
2 rootH2_10220985 3300003320 Bacteria 1209
3 Ga0065712_10005028 3300005290 Bacteria 3676
4 Ga0070658_10000620 3300005327 Bacteria 30623
5 Ga0070658_10066732 3300005327 Bacteria 2939
6 Ga0070676_10000382 3300005328 Bacteria 20553
7 Ga0070683_100044239 3300005329 Unclassified 4106
8 Ga0070690_100515685 3300005330 Unclassified 896
9 Ga0070670_100152726 3300005331 Unclassified 1998
10 Ga0070670_100267556 3300005331 Bacteria 1491
11 Ga0070677_10239938 3300005333 Bacteria 894
12 Ga0068869_100005111 3300005334 Bacteria 8228
13 Ga0070666_10000432 3300005335 Bacteria 25632
14 Ga0070666_10000687 3300005335 Bacteria 20542
15 Ga0070666_10072804 3300005335 Unclassified 2340
16 Ga0070666_10255471 3300005335 Bacteria 1241
17 Ga0070680_100000066 3300005336 Bacteria 55257
18 Ga0070680_100017269 3300005336 Bacteria 5686
19 Ga0070682_100002492 3300005337 Bacteria 10164
20 Ga0068868_100001018 3300005338 Bacteria 19149
21 Ga0070660_100027285 3300005339 Bacteria 4260
22 Ga0070689_100097304 3300005340 Bacteria 2327
23 Ga0070691_10080466 3300005341 Bacteria 1594
24 Ga0070687_100008816 3300005343 Bacteria 4287
25 Ga0070668_100000116 3300005347 Bacteria 49265
26 Ga0070675_100064714 3300005354 Unclassified 3023
27 Ga0070675_100124803 3300005354 Bacteria 2190
28 Ga0070671_100032620 3300005355 Bacteria 4304
29 Ga0070671_100051559 3300005355 Bacteria 3422
30 Ga0070671_100191436 3300005355 Unclassified 1734
31 Ga0070671_100345671 3300005355 Bacteria 1269
32 Ga0070674_100096248 3300005356 Bacteria 2148
33 Ga0070674_100400008 3300005356 Bacteria 1122
34 Ga0070673_100006333 3300005364 Bacteria 7689
35 Ga0070673_100063235 3300005364 Bacteria 2944
36 Ga0070673_100668930 3300005364 Unclassified 951
37 Ga0070688_100041804 3300005365 Bacteria 2816
38 Ga0070688_100080175 3300005365 Bacteria 2111
39 Ga0070659_100279736 3300005366 Bacteria 1388
40 Ga0070659_100454617 3300005366 Unclassified 1087
41 Ga0070667_100000652 3300005367 Bacteria 33714
42 Ga0070667_100025036 3300005367 Bacteria 4960
43 Ga0070667_100034814 3300005367 Bacteria 4216
44 Ga0070667_100044443 3300005367 Bacteria 3731
45 Ga0070667_100546572 3300005367 Bacteria 1064
46 Ga0070678_100347878 3300005456 Bacteria 1274
47 Ga0070662_100061379 3300005457 Bacteria 2744
48 Ga0070662_100558307 3300005457 Bacteria 960
49 Ga0070681_10017079 3300005458 Bacteria 7252
50 Ga0068867_100010209 3300005459 Bacteria 6623
51 Ga0068867_100090315 3300005459 Bacteria 2324
52 Ga0070679_100026530 3300005530 Bacteria 5693
53 Ga0070679_100060623 3300005530 Bacteria 3770
54 Ga0070684_100053832 3300005535 Bacteria 3505
55 Ga0068853_100037924 3300005539 Bacteria 4104
56 Ga0068853_100075453 3300005539 Bacteria 2942
57 Ga0068853_100104622 3300005539 Bacteria 2506
58 Ga0068853_100244115 3300005539 Bacteria 1647
59 Ga0068853_100266619 3300005539 Bacteria 1576
60 Ga0070672_100000038 3300005543 Bacteria 57709
61 Ga0070672_100041125 3300005543 Bacteria 3552
62 Ga0070672_100268612 3300005543 Bacteria 1440
63 Ga0070686_100031538 3300005544 Bacteria 3241
64 Ga0070686_100077765 3300005544 Bacteria 2189
65 Ga0070693_100002133 3300005547 Bacteria 9064
66 Ga0070693_100245080 3300005547 Bacteria 1185
67 Ga0070665_100000504 3300005548 Bacteria 55959
68 Ga0068855_100056815 3300005563 Bacteria 4589
69 Ga0068855_100070670 3300005563 Bacteria 4061
70 Ga0068855_100087291 3300005563 Bacteria 3606
71 Ga0068855_100150265 3300005563 Bacteria 2649
72 Ga0068855_100327448 3300005563 Bacteria 1692
73 Ga0068855_100871443 3300005563 Bacteria 953
74 Ga0068857_100013554 3300005577 Bacteria 7101
75 Ga0068857_100126605 3300005577 Bacteria 2302
76 Ga0068854_100007114 3300005578 Bacteria 7145
77 Ga0068856_100051186 3300005614 Unclassified 4073
78 Ga0068856_100089221 3300005614 Unclassified 3066
79 Ga0070702_100127107 3300005615 Bacteria 1605
80 Ga0068852_100005008 3300005616 Bacteria 9424
81 Ga0068852_100054553 3300005616 Bacteria 3446
82 Ga0068852_100239464 3300005616 Bacteria 1733
83 Ga0068859_100000242 3300005617 Bacteria 53646
84 Ga0068859_100019531 3300005617 Bacteria 6808
85 Ga0068864_100000852 3300005618 Bacteria 25731
86 Ga0068864_100102354 3300005618 Bacteria 2541
87 Ga0068864_100183854 3300005618 Bacteria 1912
88 Ga0068851_10000707 3300005834 Bacteria 14240
89 Ga0068863_100003482 3300005841 Bacteria 15530
90 Ga0068863_100008695 3300005841 Bacteria 9918
91 Ga0068863_100010182 3300005841 Bacteria 9144
92 Ga0068858_100013174 3300005842 Bacteria 7794
93 Ga0068858_100014819 3300005842 Bacteria 7335
94 Ga0068858_100329259 3300005842 Unclassified 1461
95 Ga0068858_100945570 3300005842 Bacteria 843
96 Ga0068860_100000397 3300005843 Bacteria 57001
97 Ga0068860_100002540 3300005843 Bacteria 19099
98 Ga0068860_100016524 3300005843 Bacteria 7197
99 Ga0068860_100018515 3300005843 Bacteria 6774
100 Ga0075366_10008711 3300006195 Bacteria 5648
101 Ga0097621_100000300 3300006237 Bacteria 33484
102 Ga0097621_100015116 3300006237 Bacteria 5798
103 Ga0097621_100015437 3300006237 Bacteria 5746
104 Ga0097621_100027547 3300006237 Bacteria 4470
105 Ga0097621_100105328 3300006237 Bacteria 2378
106 Ga0097621_100557710 3300006237 Bacteria 1043
107 Ga0068871_100000593 3300006358 Bacteria 24903
108 Ga0068871_100002454 3300006358 Bacteria 12659
109 Ga0068871_100030832 3300006358 Bacteria 4226
110 Ga0068871_100050031 3300006358 Bacteria 3380
111 Ga0097620_100000242 3300006931 Bacteria 53646
112 Ga0097620_100019531 3300006931 Bacteria 6808
113 Ga0105240_10004786 3300009093 Bacteria 20421
114 Ga0105240_10037120 3300009093 Bacteria 6263
115 Ga0105240_10097230 3300009093 Bacteria 3588
116 Ga0105240_10429403 3300009093 Unclassified 1483
117 Ga0111539_10050728 3300009094 Bacteria 4943
118 Ga0105245_10143814 3300009098 Unclassified 2249
119 Ga0105245_10499447 3300009098 Bacteria 1232
120 Ga0105247_10009204 3300009101 Bacteria 6007
121 Ga0105247_10016998 3300009101 Bacteria 4364
122 Ga0114129_10001007 3300009147 Bacteria 36711
123 Ga0105243_10136182 3300009148 Unclassified 2090
124 Ga0105241_10039294 3300009174 Bacteria 3569
125 Ga0105241_10078374 3300009174 Bacteria 2582
126 Ga0105241_10566411 3300009174 Bacteria 1022
127 Ga0105242_10348040 3300009176 Bacteria 1368
128 Ga0105237_10014562 3300009545 Bacteria 8218
129 Ga0105237_10016984 3300009545 Bacteria 7551
130 Ga0105237_10201096 3300009545 Bacteria 1992
131 Ga0105238_10022501 3300009551 Bacteria 6424
132 Ga0105249_10009424 3300009553 Bacteria 8545
133 Ga0105249_10010553 3300009553 Bacteria 8118
134 Ga0105249_10030300 3300009553 Bacteria 4891
135 Ga0105239_10000099 3300010375 Bacteria 120205
136 Ga0105239_10003894 3300010375 Bacteria 18092
137 Ga0105239_10022644 3300010375 Bacteria 6927
138 Ga0105239_10139775 3300010375 Unclassified 2698
139 Ga0105239_10255790 3300010375 Bacteria 1967
140 Ga0105246_10028443 3300011119 Bacteria 3672
141 Ga0105246_10829595 3300011119 Bacteria 823
142 Ga0157371_10023391 3300013102 Bacteria 4519
143 Ga0157370_10002021 3300013104 Bacteria 24922
144 Ga0157370_10003389 3300013104 Bacteria 18738
145 Ga0157370_10015584 3300013104 Bacteria 7724
146 Ga0157370_10269499 3300013104 Bacteria 1573
147 Ga0157369_10008593 3300013105 Bacteria 11714
148 Ga0157369_10224585 3300013105 Bacteria 1965
149 Ga0157374_10000339 3300013296 Bacteria 43247
150 Ga0157374_10094094 3300013296 Bacteria 2863
151 Ga0157378_10006276 3300013297 Bacteria 10408
152 Ga0157378_10015214 3300013297 Bacteria 6738
153 Ga0157378_10025437 3300013297 Bacteria 5213
154 Ga0157378_10068883 3300013297 Bacteria 3173
155 Ga0157378_10136967 3300013297 Bacteria 2270
156 Ga0163162_10000040 3300013306 Bacteria 133855
157 Ga0163162_10000554 3300013306 Bacteria 34569
158 Ga0163162_10003244 3300013306 Bacteria 15556
159 Ga0163162_10004724 3300013306 Bacteria 13139
160 Ga0163162_10008359 3300013306 Bacteria 10088
161 Ga0163162_10046336 3300013306 Bacteria 4357
162 Ga0163162_10170384 3300013306 Bacteria 2302
163 Ga0157372_10044273 3300013307 Bacteria 4931
164 Ga0157372_10145250 3300013307 Bacteria 2736
165 Ga0157372_10572885 3300013307 Unclassified 1316
166 Ga0157375_10000453 3300013308 Bacteria 37144
167 Ga0157375_10000548 3300013308 Bacteria 33804
168 Ga0157375_10156004 3300013308 Unclassified 2421
169 Ga0163163_10000046 3300014325 Bacteria 133543
170 Ga0157380_10442239 3300014326 Bacteria 1246
171 Ga0157380_10877309 3300014326 Unclassified 921
172 Ga0157377_10013224 3300014745 Bacteria 4174
173 Ga0157379_10000020 3300014968 Bacteria 92868
174 Ga0157379_10016844 3300014968 Bacteria 6433
175 Ga0157379_10030395 3300014968 Bacteria 4808
176 Ga0157376_10000297 3300014969 Bacteria 33467
177 Ga0157376_10015682 3300014969 Bacteria 5731
178 Ga0157376_10020863 3300014969 Bacteria 5078
179 Ga0157376_10025371 3300014969 Bacteria 4668
180 Ga0157376_10073876 3300014969 Bacteria 2905
181 Ga0157376_10128983 3300014969 Bacteria 2253
182 Ga0163161_10016656 3300017792 Bacteria 5134
183 Ga0163161_10016721 3300017792 Bacteria 5125
184 Ga0163161_10073000 3300017792 Unclassified 2514
185 Ga0209646_1001706 3300025246 Bacteria 5569
186 Ga0207656_10028063 3300025321 Unclassified 2307
187 Ga0207710_10006136 3300025900 Bacteria 5145
188 Ga0207710_10120535 3300025900 Unclassified 1252
189 Ga0207688_10089163 3300025901 Bacteria 1769
190 Ga0207680_10000268 3300025903 Bacteria 24842
191 Ga0207680_10003086 3300025903 Bacteria 7821
192 Ga0207680_10272688 3300025903 Bacteria 1174
193 Ga0207647_10021224 3300025904 Bacteria 4338
194 Ga0207647_10078839 3300025904 Bacteria 1978
195 Ga0207647_10112663 3300025904 Bacteria 1608
196 Ga0207645_10000716 3300025907 Bacteria 27613
197 Ga0207645_10016377 3300025907 Bacteria 4908
198 Ga0207705_10014189 3300025909 Bacteria 5739
199 Ga0207705_10040300 3300025909 Bacteria 3349
200 Ga0207654_10007245 3300025911 Bacteria 5589
201 Ga0207654_10055164 3300025911 Bacteria 2299
202 Ga0207707_10015548 3300025912 Bacteria 6628
203 Ga0207707_10018158 3300025912 Bacteria 6130
204 Ga0207695_10022953 3300025913 Bacteria 7066
205 Ga0207695_10128487 3300025913 Bacteria 2494
206 Ga0207671_10006905 3300025914 Bacteria 10012
207 Ga0207660_10013053 3300025917 Bacteria 5440
208 Ga0207660_10076781 3300025917 Bacteria 2443
209 Ga0207662_10003215 3300025918 Bacteria 8366
210 Ga0207657_10038107 3300025919 Bacteria 4284
211 Ga0207649_10576368 3300025920 Bacteria 863
212 Ga0207652_10000456 3300025921 Bacteria 42137
213 Ga0207652_10001383 3300025921 Bacteria 21589
214 Ga0207650_10062408 3300025925 Bacteria 2784
215 Ga0207659_10072420 3300025926 Bacteria 2519
216 Ga0207659_10113268 3300025926 Unclassified 2066
217 Ga0207644_10306023 3300025931 Bacteria 1282
218 Ga0207709_10095613 3300025935 Unclassified 1952
219 Ga0207670_10211697 3300025936 Bacteria 1479
220 Ga0207669_10396462 3300025937 Bacteria 1080
221 Ga0207704_10012531 3300025938 Bacteria 4210
222 Ga0207691_10000013 3300025940 Bacteria 147349
223 Ga0207691_10225698 3300025940 Unclassified 1623
224 Ga0207691_10255975 3300025940 Bacteria 1510
225 Ga0207689_10012013 3300025942 Bacteria 7422
226 Ga0207661_10220275 3300025944 Bacteria 1677
227 Ga0207667_10000419 3300025949 Bacteria 57239
228 Ga0207667_10021355 3300025949 Bacteria 7174
229 Ga0207667_10053878 3300025949 Bacteria 4232
230 Ga0207667_10071079 3300025949 Bacteria 3620
231 Ga0207667_10079737 3300025949 Bacteria 3393
232 Ga0207667_10464217 3300025949 Bacteria 1286
233 Ga0207667_10770050 3300025949 Bacteria 961
234 Ga0207667_10994482 3300025949 Unclassified 826
235 Ga0207651_10000984 3300025960 Bacteria 12587
236 Ga0207651_10094505 3300025960 Bacteria 2198
237 Ga0207712_10036003 3300025961 Bacteria 3368
238 Ga0207712_10042529 3300025961 Unclassified 3129
239 Ga0207668_10000295 3300025972 Bacteria 32756
240 Ga0207640_10341256 3300025981 Bacteria 1200
241 Ga0207658_10000910 3300025986 Bacteria 24517
242 Ga0207658_10015844 3300025986 Bacteria 5176
243 Ga0207658_10554943 3300025986 Bacteria 1028
244 Ga0207677_10002248 3300026023 Bacteria 10134
245 Ga0207677_10862412 3300026023 Unclassified 814
246 Ga0207703_10001005 3300026035 Bacteria 27079
247 Ga0207703_10486353 3300026035 Unclassified 1157
248 Ga0207639_10018902 3300026041 Bacteria 4905
249 Ga0207639_10056759 3300026041 Bacteria 3002
250 Ga0207639_10085533 3300026041 Bacteria 2508
251 Ga0207639_10219004 3300026041 Bacteria 1643
252 Ga0207639_10337987 3300026041 Unclassified 1342
253 Ga0207678_10020537 3300026067 Bacteria 5790
254 Ga0207702_10019236 3300026078 Bacteria 5649
255 Ga0207641_10000053 3300026088 Bacteria 173468
256 Ga0207641_10001809 3300026088 Bacteria 20561
257 Ga0207641_10143242 3300026088 Bacteria 2159
258 Ga0207648_10009553 3300026089 Bacteria 9277
259 Ga0207648_10053760 3300026089 Unclassified 3519
260 Ga0207648_10054459 3300026089 Bacteria 3494
261 Ga0207676_10025534 3300026095 Unclassified 4383
262 Ga0207676_10085565 3300026095 Bacteria 2573
263 Ga0207674_10015016 3300026116 Bacteria 8531
264 Ga0207674_10055405 3300026116 Bacteria 4031
265 Ga0207674_10111490 3300026116 Bacteria 2710
266 Ga0207683_10128080 3300026121 Bacteria 2282
267 Ga0207683_10333268 3300026121 Unclassified 1391
268 Ga0207698_10040660 3300026142 Bacteria 3458
269 Ga0207698_10102913 3300026142 Unclassified 2372
270 Ga0207698_10547949 3300026142 Bacteria 1133
271 Ga0268266_10005536 3300028379 Bacteria 11754
272 Ga0268264_10002659 3300028381 Bacteria 15607
273 Ga0268264_10007366 3300028381 Bacteria 9193
274 Ga0268264_10012988 3300028381 Bacteria 6846
275 Ga0268264_10026687 3300028381 Bacteria 4720
276 Ga0307515_10000190 3300028794 Bacteria 150300
277 Ga0307515_10275979 3300028794 Bacteria 1395
278 Ga0265338_10333708 3300028800 Bacteria 1094
279 Ga0265327_10161713 3300031251 Unclassified 1033
280 Ga0307513_10119242 3300031456 Bacteria 2610
281 Ga0307509_10287669 3300031507 Unclassified 1400
282 Ga0307509_10516168 3300031507 Unclassified 877
283 Ga0307408_100001077 3300031548 Bacteria 20872
284 Ga0307508_10000822 3300031616 Bacteria 36157
285 Ga0307508_10089186 3300031616 Bacteria 2669
286 Ga0307508_10293473 3300031616 Bacteria 1219
287 Ga0307412_10011061 3300031911 Bacteria 5215
288 Ga0307414_10589474 3300032004 Bacteria 996
289 Ga0307415_100268667 3300032126 Bacteria 1396
290 Ga0307510_10000532 3300033180 Bacteria 38009
291 Ga0373957_0058455 3300035120 Bacteria 1490
292 Ga0373943_0244820 3300035170 Bacteria 1006
293 Ga0373924_0039512 3300035410 Bacteria 1928
294 Ga0373935_0107839 3300035692 Bacteria 1845
295 Ga0373937_0647533 3300036401 Bacteria 1002
296 Ga0395899_0028749 3300037312 Bacteria 4183
297 Ga0395900_0133375 3300037418 Bacteria 2544
298 Ga0395898_0015978 3300037466 Bacteria 7690
299 Ga0395905_0556944 3300037471 Bacteria 1048
300 Ga0395901_0059026 3300038443 Bacteria 3991
301 Ga0439436_0021587 3300041404 Bacteria 1912
302 Ga0451849_1211584 3300041505 Bacteria 932
303 Ga0439457_004968 3300042014 Bacteria 3402
304 Ga0466972_0034692 3300044658 Bacteria 2470
305 Ga0466966_0003685 3300044684 Bacteria 10111
306 Ga0466964_0346423 3300044706 Bacteria 762
307 Ga0466957_0008800 3300044842 Bacteria 5747
308 Ga0466959_0000021 3300045049 Bacteria 132387
309 Ga0495664_0057983 3300046477 Unclassified 2304
310 Ga0495606_0002128 3300046507 Bacteria 23952
311 Ga0495630_0052975 3300046517 Bacteria 3038
312 Ga0495630_0421870 3300046517 Bacteria 1022
313 Ga0495652_0233538 3300046529 Unclassified 1374
314 Ga0495625_0166066 3300046660 Unclassified 1476
315 Ga0495636_0000008 3300047318 Bacteria 102958
316 Ga0495674_0147811 3300047319 Bacteria 1972
317 Ga0495672_0027588 3300047320 Bacteria 3606
318 Ga0495686_0000039 3300047472 Bacteria 304821
319 Ga0496104_0258627 3300048907 Bacteria 1654
320 Ga0496104_0513794 3300048907 Unclassified 1109
321 Ga0496106_0441114 3300048909 Bacteria 1046
322 Ga0496109_0030865 3300048912 Bacteria 4805
323 Ga0496110_0495242 3300048913 Bacteria 1113
324 Ga0496114_0038928 3300048917 Bacteria 3935
325 Ga0501032_0190137 3300049569 Bacteria 1342
326 Ga0501039_0619757 3300049575 Bacteria 848
327 Ga0501047_0009257 3300049581 Bacteria 9301
328 Ga0501047_0060798 3300049581 Bacteria 3645
329 Ga0501047_0176761 3300049581 Unclassified 2002
330 Ga0501047_0464366 3300049581 Bacteria 1094
331 Ga0501048_0403588 3300049582 Bacteria 977
332 Ga0501067_0022791 3300049583 Bacteria 3466
333 Ga0501070_0112744 3300049586 Bacteria 2247
334 Ga0501257_035749 3300049686 Bacteria 1209
335 Ga0501080_0237318 3300049742 Bacteria 1665
336 Ga0501035_0158994 3300049822 Bacteria 1957
337 Ga0501044_0026071 3300049823 Bacteria 6191
338 Ga0501044_0076651 3300049823 Bacteria 3392
339 Ga0501044_0706591 3300049823 Bacteria 893
340 nmdc:mga0k408_33946_c1 3300050493 Unclassified 2919
341 nmdc:mga05p37_829_c1 3300050507 Bacteria 34660
342 Ga0500578_0000009 3300053086 Bacteria 219807
343 Ga0500583_0000226 3300053092 Bacteria 20632
344 Ga0500583_0003495 3300053092 Bacteria 4948
345 Ga0500573_0124808 3300053140 Bacteria 1430
346 Ga0500589_042138 3300053147 Bacteria 2129
347 Ga0500616_0009469 3300053153 Bacteria 5926
348 Ga0500622_0030560 3300053156 Bacteria 2828
349 Ga0500636_0074886 3300053177 Bacteria 1959
350 Ga0501084_0000686 3300054114 Bacteria 25875
351 Ga0501082_0030948 3300060353 Bacteria 4613
352 Ga0207689_10241629
353 rootH2_10220985
354 Ga0065712_10005028
355 Ga0070658_10000620
356 Ga0070658_10066732
357 Ga0070676_10000382
358 Ga0070683_100044239
359 Ga0070690_100515685
360 Ga0070670_100152726
361 Ga0070670_100267556
362 Ga0070677_10239938
363 Ga0068869_100005111
364 Ga0070666_10000432
365 Ga0070666_10000687
366 Ga0070666_10072804
367 Ga0070666_10255471
368 Ga0070680_100000066
369 Ga0070680_100017269
370 Ga0070682_100002492
371 Ga0068868_100001018
372 Ga0070660_100027285
373 Ga0070689_100097304
374 Ga0070691_10080466
375 Ga0070687_100008816
376 Ga0070668_100000116
377 Ga0070675_100064714
378 Ga0070675_100124803
379 Ga0070671_100032620
380 Ga0070671_100051559
381 Ga0070671_100191436
382 Ga0070671_100345671
383 Ga0070674_100096248
384 Ga0070674_100400008
385 Ga0070673_100006333
386 Ga0070673_100063235
387 Ga0070673_100668930
388 Ga0070688_100041804
389 Ga0070688_100080175
390 Ga0070659_100279736
391 Ga0070659_100454617
392 Ga0070667_100000652
393 Ga0070667_100025036
394 Ga0070667_100034814
395 Ga0070667_100044443
396 Ga0070667_100546572
397 Ga0070678_100347878
398 Ga0070662_100061379
399 Ga0070662_100558307
400 Ga0070681_10017079
401 Ga0068867_100010209
402 Ga0068867_100090315
403 Ga0070679_100026530
404 Ga0070679_100060623
405 Ga0070684_100053832
406 Ga0068853_100037924
407 Ga0068853_100075453
408 Ga0068853_100104622
409 Ga0068853_100244115
410 Ga0068853_100266619
411 Ga0070672_100000038
412 Ga0070672_100041125
413 Ga0070672_100268612
414 Ga0070686_100031538
415 Ga0070686_100077765
416 Ga0070693_100002133
417 Ga0070693_100245080
418 Ga0070665_100000504
419 Ga0068855_100056815
420 Ga0068855_100070670
421 Ga0068855_100087291
422 Ga0068855_100150265
423 Ga0068855_100327448
424 Ga0068855_100871443
425 Ga0068857_100013554
426 Ga0068857_100126605
427 Ga0068854_100007114
428 Ga0068856_100051186
429 Ga0068856_100089221
430 Ga0070702_100127107
431 Ga0068852_100005008
432 Ga0068852_100054553
433 Ga0068852_100239464
434 Ga0068859_100000242
435 Ga0068859_100019531
436 Ga0068864_100000852
437 Ga0068864_100102354
438 Ga0068864_100183854
439 Ga0068851_10000707
440 Ga0068863_100003482
441 Ga0068863_100008695
442 Ga0068863_100010182
443 Ga0068858_100013174
444 Ga0068858_100014819
445 Ga0068858_100329259
446 Ga0068858_100945570
447 Ga0068860_100000397
448 Ga0068860_100002540
449 Ga0068860_100016524
450 Ga0068860_100018515
451 Ga0075366_10008711
452 Ga0097621_100000300
453 Ga0097621_100015116
454 Ga0097621_100015437
455 Ga0097621_100027547
456 Ga0097621_100105328
457 Ga0097621_100557710
458 Ga0068871_100000593
459 Ga0068871_100002454
460 Ga0068871_100030832
461 Ga0068871_100050031
462 Ga0097620_100000242
463 Ga0097620_100019531
464 Ga0105240_10004786
465 Ga0105240_10037120
466 Ga0105240_10097230
467 Ga0105240_10429403
468 Ga0111539_10050728
469 Ga0105245_10143814
470 Ga0105245_10499447
471 Ga0105247_10009204
472 Ga0105247_10016998
473 Ga0114129_10001007
474 Ga0105243_10136182
475 Ga0105241_10039294
476 Ga0105241_10078374
477 Ga0105241_10566411
478 Ga0105242_10348040
479 Ga0105237_10014562
480 Ga0105237_10016984
481 Ga0105237_10201096
482 Ga0105238_10022501
483 Ga0105249_10009424
484 Ga0105249_10010553
485 Ga0105249_10030300
486 Ga0105239_10000099
487 Ga0105239_10003894
488 Ga0105239_10022644
489 Ga0105239_10139775
490 Ga0105239_10255790
491 Ga0105246_10028443
492 Ga0105246_10829595
493 Ga0157371_10023391
494 Ga0157370_10002021
495 Ga0157370_10003389
496 Ga0157370_10015584
497 Ga0157370_10269499
498 Ga0157369_10008593
499 Ga0157369_10224585
500 Ga0157374_10000339
501 Ga0157374_10094094
502 Ga0157378_10006276
503 Ga0157378_10015214
504 Ga0157378_10025437
505 Ga0157378_10068883
506 Ga0157378_10136967
507 Ga0163162_10000040
508 Ga0163162_10000554
509 Ga0163162_10003244
510 Ga0163162_10004724
511 Ga0163162_10008359
512 Ga0163162_10046336
513 Ga0163162_10170384
514 Ga0157372_10044273
515 Ga0157372_10145250
516 Ga0157372_10572885
517 Ga0157375_10000453
518 Ga0157375_10000548
519 Ga0157375_10156004
520 Ga0163163_10000046
521 Ga0157380_10442239
522 Ga0157380_10877309
523 Ga0157377_10013224
524 Ga0157379_10000020
525 Ga0157379_10016844
526 Ga0157379_10030395
527 Ga0157376_10000297
528 Ga0157376_10015682
529 Ga0157376_10020863
530 Ga0157376_10025371
531 Ga0157376_10073876
532 Ga0157376_10128983
533 Ga0163161_10016656
534 Ga0163161_10016721
535 Ga0163161_10073000
536 Ga0209646_1001706
537 Ga0207656_10028063
538 Ga0207710_10006136
539 Ga0207710_10120535
540 Ga0207688_10089163
541 Ga0207680_10000268
542 Ga0207680_10003086
543 Ga0207680_10272688
544 Ga0207647_10021224
545 Ga0207647_10078839
546 Ga0207647_10112663
547 Ga0207645_10000716
548 Ga0207645_10016377
549 Ga0207705_10014189
550 Ga0207705_10040300
551 Ga0207654_10007245
552 Ga0207654_10055164
553 Ga0207707_10015548
554 Ga0207707_10018158
555 Ga0207695_10022953
556 Ga0207695_10128487
557 Ga0207671_10006905
558 Ga0207660_10013053
559 Ga0207660_10076781
560 Ga0207662_10003215
561 Ga0207657_10038107
562 Ga0207649_10576368
563 Ga0207652_10000456
564 Ga0207652_10001383
565 Ga0207650_10062408
566 Ga0207659_10072420
567 Ga0207659_10113268
568 Ga0207644_10306023
569 Ga0207709_10095613
570 Ga0207670_10211697
571 Ga0207669_10396462
572 Ga0207704_10012531
573 Ga0207691_10000013
574 Ga0207691_10225698
575 Ga0207691_10255975
576 Ga0207689_10012013
577 Ga0207661_10220275
578 Ga0207667_10000419
579 Ga0207667_10021355
580 Ga0207667_10053878
581 Ga0207667_10071079
582 Ga0207667_10079737
583 Ga0207667_10464217
584 Ga0207667_10770050
585 Ga0207667_10994482
586 Ga0207651_10000984
587 Ga0207651_10094505
588 Ga0207712_10036003
589 Ga0207712_10042529
590 Ga0207668_10000295
591 Ga0207640_10341256
592 Ga0207658_10000910
593 Ga0207658_10015844
594 Ga0207658_10554943
595 Ga0207677_10002248
596 Ga0207677_10862412
597 Ga0207703_10001005
598 Ga0207703_10486353
599 Ga0207639_10018902
600 Ga0207639_10056759
601 Ga0207639_10085533
602 Ga0207639_10219004
603 Ga0207639_10337987
604 Ga0207678_10020537
605 Ga0207702_10019236
606 Ga0207641_10000053
607 Ga0207641_10001809
608 Ga0207641_10143242
609 Ga0207648_10009553
610 Ga0207648_10053760
611 Ga0207648_10054459
612 Ga0207676_10025534
613 Ga0207676_10085565
614 Ga0207674_10015016
615 Ga0207674_10055405
616 Ga0207674_10111490
617 Ga0207683_10128080
618 Ga0207683_10333268
619 Ga0207698_10040660
620 Ga0207698_10102913
621 Ga0207698_10547949
622 Ga0268266_10005536
623 Ga0268264_10002659
624 Ga0268264_10007366
625 Ga0268264_10012988
626 Ga0268264_10026687
627 Ga0307515_10000190
628 Ga0307515_10275979
629 Ga0265338_10333708
630 Ga0265327_10161713
631 Ga0307513_10119242
632 Ga0307509_10287669
633 Ga0307509_10516168
634 Ga0307408_100001077
635 Ga0307508_10000822
636 Ga0307508_10089186
637 Ga0307508_10293473
638 Ga0307412_10011061
639 Ga0307414_10589474
640 Ga0307415_100268667
641 Ga0307510_10000532
642 Ga0373957_0058455
643 Ga0373943_0244820
644 Ga0373924_0039512
645 Ga0373935_0107839
646 Ga0373937_0647533
647 Ga0395899_0028749
648 Ga0395900_0133375
649 Ga0395898_0015978
650 Ga0395905_0556944
651 Ga0395901_0059026
652 Ga0439436_0021587
653 Ga0451849_1211584
654 Ga0439457_004968
655 Ga0466972_0034692
656 Ga0466966_0003685
657 Ga0466964_0346423
658 Ga0466957_0008800
659 Ga0466959_0000021
660 Ga0495664_0057983
661 Ga0495606_0002128
662 Ga0495630_0052975
663 Ga0495630_0421870
664 Ga0495652_0233538
665 Ga0495625_0166066
666 Ga0495636_0000008
667 Ga0495674_0147811
668 Ga0495672_0027588
669 Ga0495686_0000039
670 Ga0496104_0258627
671 Ga0496104_0513794
672 Ga0496106_0441114
673 Ga0496109_0030865
674 Ga0496110_0495242
675 Ga0496114_0038928
676 Ga0501032_0190137
677 Ga0501039_0619757
678 Ga0501047_0009257
679 Ga0501047_0060798
680 Ga0501047_0176761
681 Ga0501047_0464366
682 Ga0501048_0403588
683 Ga0501067_0022791
684 Ga0501070_0112744
685 Ga0501257_035749
686 Ga0501080_0237318
687 Ga0501035_0158994
688 Ga0501044_0026071
689 Ga0501044_0076651
690 Ga0501044_0706591
691 nmdc:mga0k408_33946_c1
692 nmdc:mga05p37_829_c1
693 Ga0500578_0000009
694 Ga0500583_0000226
695 Ga0500583_0003495
696 Ga0500573_0124808
697 Ga0500589_042138
698 Ga0500616_0009469
699 Ga0500622_0030560
700 Ga0500636_0074886
701 Ga0501084_0000686
702 Ga0501082_0030948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01988

VIT1

VIT family

53

264

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.7975 15 219
6iu4-assembly1.cif.gz_A crystal structure of iron transporter vit1 with cobalt ion 0.7439 15 219
1u77-assembly1.cif.gz_A crystal structure of ammonia channel amtb from e. coli 0.3855 120 218
3gi7-assembly1.cif.gz_A crystal structure of a duf1311 family protein (pp0307) from pseudomonas putida kt2440 at 1.85 a resolution 0.3711 59 151
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.3711 135 217
ID Description Score Start End Superfamily
af_I1K5I4_32_243_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8288 18 217 1.20.1260.10
af_Q54H42_48_275_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7834 18 216 1.20.1260.10
af_I1K5I4_32_243_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7809 18 217 1.20.1260.10
af_Q4DKQ8_55_270_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.776 18 216 1.20.1260.10
af_K7MU65_40_256_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.776 18 216 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7W1VZ29-F1-model_v4 VIT1/CCC1 transporter family protein 0.9509 15 220 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A661A5F6-F1-model_v4 Rubrerythrin family protein 0.9451 12 220 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A7J3BQF0-F1-model_v4 Rubrerythrin family protein 0.9362 12 218 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A1F5ECY8-F1-model_v4 VIT family protein 0.9359 15 218 GO:0005384
GO:0012505
GO:0016020
GO:0030026
AF-A0A7C4MG03-F1-model_v4 Rubrerythrin family protein 0.9334 16 220 GO:0005384
GO:0012505
GO:0016020
GO:0030026

Map