F418644

General Info

Members Datasets Scaffolds Average Seq Length
351 210 336 107

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1000002|Ga0182006_1000002785
Length 118
Sequence MAGTTLPPREKKMAWIILVLAGLLEIGWAIGLKYSAGFTRLVPSVLTAVSMLGSVVMLGLALRTLPLGTAYAIWTGIGTVGTAIFGIMVLGEPASAARIACIALIVSGILGLKLLSPQ

Samples

Sample ID Description Type Environment
1 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
2 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
3 2643221638 Duganella sp. Root336D2 Isolate Unclassified
4 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
5 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
6 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
7 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
8 2857558681 Duganella sp. R-74565 Isolate Unclassified
9 2857564685 Duganella sp. R-74599 Isolate Unclassified
10 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
11 2919476304 Duganella sp. 3397 Isolate Unclassified
12 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
13 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
14 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
15 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
100 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
106 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
111 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
142 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
147 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
148 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
164 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
184 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
185 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
186 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
189 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
200 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 0.57
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.37
Nodule 0.28
Rhizoplane 4.27
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000571 3300002774 Bacteria 14701
2 JGI25159J45721_1004574 3300002987 Unclassified 4551
3 JGI25153J46596_10005856 3300003215 Bacteria 6369
4 JGI25161J50226_1000182 3300003374 Bacteria 42010
5 Ga0055529_1000068 3300003763 Bacteria 163911
6 Ga0055526_1000013 3300003771 Bacteria 233580
7 Ga0055526_1000934 3300003771 Bacteria 21684
8 Ga0055526_1005682 3300003771 Bacteria 7080
9 Ga0055537_1000039 3300003773 Bacteria 92151
10 Ga0055537_1002487 3300003773 Bacteria 6146
11 Ga0055524_1004427 3300003775 Bacteria 6483
12 Ga0055524_1007872 3300003775 Unclassified 4480
13 Ga0055534_1000174 3300003784 Bacteria 47983
14 Ga0055534_1001797 3300003784 Bacteria 8068
15 Ga0055528_1000066 3300003790 Bacteria 84724
16 Ga0055530_10010604 3300003791 Unclassified 3386
17 Ga0055530_10024830 3300003791 Unclassified 1688
18 Ga0055530_10024978 3300003791 Unclassified 1679
19 Ga0055531_10005354 3300003794 Bacteria 7522
20 Ga0055543_1000112 3300004625 Bacteria 69589
21 Ga0055543_1020853 3300004625 Bacteria 1199
22 Ga0055543_1020856 3300004625 Bacteria 1199
23 Ga0065165_1001216 3300005262 Bacteria 29672
24 Ga0065165_1047977 3300005262 Bacteria 1229
25 Ga0065712_10335750 3300005290 Bacteria 807
26 Ga0070683_100145245 3300005329 Bacteria 2248
27 Ga0070666_10762858 3300005335 Unclassified 711
28 Ga0070671_100578118 3300005355 Unclassified 970
29 Ga0070673_100181644 3300005364 Bacteria 1801
30 Ga0070667_100099977 3300005367 Unclassified 2504
31 Ga0070663_101799628 3300005455 Bacteria 549
32 Ga0070681_10199112 3300005458 Bacteria 1921
33 Ga0070681_10952578 3300005458 Bacteria 777
34 Ga0070681_11595831 3300005458 Bacteria 578
35 Ga0068867_100135593 3300005459 Bacteria 1918
36 Ga0070685_10287057 3300005466 Bacteria 1104
37 Ga0070685_10597479 3300005466 Bacteria 794
38 Ga0070684_100201566 3300005535 Bacteria 1812
39 Ga0070672_100467949 3300005543 Bacteria 1087
40 Ga0070672_101463825 3300005543 Bacteria 612
41 Ga0070702_100146066 3300005615 Bacteria 1512
42 Ga0068860_102517373 3300005843 Unclassified 534
43 Ga0081455_10281150 3300005937 Bacteria 1202
44 Ga0070717_10025687 3300006028 Bacteria 4689
45 Ga0075363_100034283 3300006048 Bacteria 2649
46 Ga0075362_10126751 3300006177 Bacteria 1212
47 Ga0075367_10311787 3300006178 Bacteria 991
48 Ga0075366_10083307 3300006195 Bacteria 1911
49 Ga0075370_10014834 3300006353 Bacteria 4162
50 Ga0075370_10635959 3300006353 Bacteria 647
51 Ga0075428_100460398 3300006844 Bacteria 1362
52 Ga0105244_10002659 3300009036 Bacteria 13391
53 Ga0157370_10559386 3300013104 Bacteria 1048
54 Ga0182008_10004711 3300014497 Bacteria 7910
55 Ga0182008_10223553 3300014497 Bacteria 964
56 Ga0182006_1000002 3300015261 Bacteria 887990
57 Ga0182007_10000997 3300015262 Bacteria 15535
58 Ga0182005_1000002 3300015265 Bacteria 908499
59 Ga0163161_10088590 3300017792 Bacteria 2288
60 Ga0163161_10436269 3300017792 Bacteria 1056
61 Ga0209436_100484 3300025208 Bacteria 17563
62 Ga0209436_113303 3300025208 Bacteria 1351
63 Ga0209436_113304 3300025208 Bacteria 1351
64 Ga0207425_1000001 3300025245 Bacteria 2525432
65 Ga0207425_1000130 3300025245 Bacteria 70791
66 Ga0209129_1000003 3300025258 Bacteria 903689
67 Ga0209565_1000003 3300025263 Bacteria 1099648
68 Ga0209565_1012852 3300025263 Bacteria 1982
69 Ga0209455_1000026 3300025272 Bacteria 653778
70 Ga0209673_1000003 3300025273 Bacteria 980859
71 Ga0209130_1000237 3300025284 Bacteria 70739
72 Ga0209130_1021306 3300025284 Bacteria 1465
73 Ga0209130_1021309 3300025284 Bacteria 1465
74 Ga0209675_1000003 3300025291 Bacteria 1003982
75 Ga0209675_1006952 3300025291 Bacteria 4438
76 Ga0209564_1000002 3300025295 Bacteria 1636803
77 Ga0209564_1000012 3300025295 Bacteria 792078
78 Ga0209564_1000311 3300025295 Bacteria 95587
79 Ga0209564_1007930 3300025295 Bacteria 5355
80 Ga0209758_1000041 3300025297 Bacteria 410328
81 Ga0209050_1000011 3300025298 Bacteria 914037
82 Ga0209050_1000164 3300025298 Bacteria 154628
83 Ga0209050_1000664 3300025298 Bacteria 52795
84 Ga0209256_1000068 3300025299 Bacteria 246064
85 Ga0209256_1000395 3300025299 Bacteria 69343
86 Ga0209256_1000952 3300025299 Bacteria 35118
87 Ga0207426_1011742 3300025302 Bacteria 3318
88 Ga0207426_1052226 3300025302 Bacteria 1211
89 Ga0209257_1000003 3300025304 Bacteria 1702593
90 Ga0207655_1004019 3300025728 Bacteria 10620
91 Ga0207680_10721131 3300025903 Unclassified 715
92 Ga0207707_10234438 3300025912 Bacteria 1597
93 Ga0207644_10733054 3300025931 Unclassified 825
94 Ga0207670_10082466 3300025936 Bacteria 2254
95 Ga0207691_10247611 3300025940 Bacteria 1539
96 Ga0207711_11158629 3300025941 Bacteria 714
97 Ga0207661_10184642 3300025944 Bacteria 1824
98 Ga0207658_10093881 3300025986 Unclassified 2334
99 Ga0207678_10188256 3300026067 Bacteria 1763
100 Ga0207648_10358875 3300026089 Bacteria 1315
101 Ga0207683_10587393 3300026121 Bacteria 1030
102 Ga0307515_10090578 3300028794 Bacteria 3834
103 Ga0316181_1031340 3300030744 Bacteria 1631
104 Ga0307408_100001185 3300031548 Bacteria 19736
105 Ga0307408_100184087 3300031548 Bacteria 1677
106 Ga0307408_100261349 3300031548 Bacteria 1433
107 Ga0307516_10135284 3300031730 Bacteria 2240
108 Ga0307409_101900596 3300031995 Bacteria 625
109 Ga0307414_10003286 3300032004 Bacteria 8617
110 Ga0307414_12221909 3300032004 Bacteria 512
111 Ga0307415_102188441 3300032126 Bacteria 541
112 Ga0373931_0704864 3300035691 Bacteria 667
113 Ga0395900_0475656 3300037418 Bacteria 1202
114 Ga0395905_0265352 3300037471 Bacteria 1602
115 Ga0395905_1309508 3300037471 Bacteria 628
116 Ga0451847_0669870 3300041503 Bacteria 1046
117 Ga0439446_0331958 3300042156 Bacteria 539
118 Ga0451577_0057226 3300042876 Bacteria 3476
119 Ga0466971_0059650 3300044719 Bacteria 1724
120 Ga0495617_000042 3300046452 Bacteria 122225
121 Ga0495627_017646 3300046453 Bacteria 2421
122 Ga0495627_232972 3300046453 Bacteria 505
123 Ga0495603_0038096 3300046455 Bacteria 2884
124 Ga0495590_0000010 3300046457 Bacteria 317890
125 Ga0495638_0000027 3300046460 Bacteria 337569
126 Ga0495638_0056006 3300046460 Bacteria 2447
127 Ga0495638_0088249 3300046460 Bacteria 1872
128 Ga0495638_0140383 3300046460 Bacteria 1411
129 Ga0495638_0297117 3300046460 Bacteria 871
130 Ga0495653_0000010 3300046463 Bacteria 274131
131 Ga0495653_0266060 3300046463 Bacteria 1131
132 Ga0495650_0000044 3300046471 Bacteria 355139
133 Ga0495650_0001268 3300046471 Bacteria 26031
134 Ga0495650_0003132 3300046471 Bacteria 12383
135 Ga0495650_0041517 3300046471 Bacteria 1966
136 Ga0495605_0051362 3300046474 Bacteria 2008
137 Ga0495605_0075369 3300046474 Bacteria 1586
138 Ga0495605_0146986 3300046474 Bacteria 1054
139 Ga0495639_0013547 3300046475 Bacteria 3524
140 Ga0495584_0010996 3300046491 Bacteria 4642
141 Ga0495585_0000385 3300046492 Bacteria 42521
142 Ga0495585_0002878 3300046492 Bacteria 11968
143 Ga0495585_0031031 3300046492 Bacteria 3037
144 Ga0495594_0043228 3300046499 Bacteria 2469
145 Ga0495594_0047585 3300046499 Bacteria 2355
146 Ga0495596_0011429 3300046500 Bacteria 3832
147 Ga0495607_0005509 3300046501 Bacteria 9041
148 Ga0495607_0381892 3300046501 Bacteria 644
149 Ga0495583_0000006 3300046506 Bacteria 436893
150 Ga0495583_0005813 3300046506 Bacteria 8238
151 Ga0495606_0000015 3300046507 Bacteria 288808
152 Ga0495606_0000128 3300046507 Bacteria 128179
153 Ga0495606_0000557 3300046507 Bacteria 59505
154 Ga0495606_0004948 3300046507 Bacteria 13007
155 Ga0495606_0005861 3300046507 Bacteria 11582
156 Ga0495610_0000008 3300046512 Bacteria 622732
157 Ga0495610_0002638 3300046512 Bacteria 14832
158 Ga0495610_0005058 3300046512 Bacteria 9508
159 Ga0495610_0009097 3300046512 Bacteria 6328
160 Ga0495610_0017960 3300046512 Bacteria 4012
161 Ga0495610_0028272 3300046512 Bacteria 2967
162 Ga0495616_0000075 3300046513 Bacteria 84686
163 Ga0495616_0140510 3300046513 Bacteria 1099
164 Ga0495620_0283655 3300046515 Bacteria 630
165 Ga0495631_0007084 3300046518 Bacteria 5733
166 Ga0495632_0000091 3300046519 Bacteria 93600
167 Ga0495632_0000358 3300046519 Bacteria 43419
168 Ga0495632_0018197 3300046519 Bacteria 3860
169 Ga0495637_0058931 3300046520 Bacteria 1581
170 Ga0495643_0000022 3300046522 Bacteria 289691
171 Ga0495643_0000326 3300046522 Bacteria 65454
172 Ga0495643_0041640 3300046522 Bacteria 2504
173 Ga0495643_0202819 3300046522 Bacteria 951
174 Ga0495644_0015893 3300046523 Bacteria 2884
175 Ga0495648_0000078 3300046524 Bacteria 127397
176 Ga0495648_0002119 3300046524 Bacteria 18687
177 Ga0495648_0021870 3300046524 Bacteria 4417
178 Ga0495648_0063607 3300046524 Bacteria 2177
179 Ga0495648_0147118 3300046524 Bacteria 1233
180 Ga0495642_0000326 3300046528 Bacteria 26021
181 Ga0495642_0000919 3300046528 Bacteria 13828
182 Ga0495642_0051200 3300046528 Bacteria 1698
183 Ga0495642_0213901 3300046528 Bacteria 841
184 Ga0495654_0008449 3300046530 Bacteria 5686
185 Ga0495654_0032205 3300046530 Bacteria 2658
186 Ga0495654_0152652 3300046530 Bacteria 1020
187 Ga0495654_0164293 3300046530 Bacteria 972
188 Ga0495609_0005651 3300046538 Bacteria 6517
189 Ga0495609_0055969 3300046538 Bacteria 1748
190 Ga0495609_0078055 3300046538 Bacteria 1449
191 Ga0495609_0097344 3300046538 Bacteria 1276
192 Ga0495609_0161904 3300046538 Bacteria 948
193 Ga0495609_0167411 3300046538 Bacteria 929
194 Ga0495609_0433476 3300046538 Bacteria 523
195 Ga0495597_0000107 3300046542 Bacteria 73749
196 Ga0495597_0003370 3300046542 Bacteria 9381
197 Ga0495622_0000009 3300046557 Bacteria 224622
198 Ga0495622_0000043 3300046557 Bacteria 115796
199 Ga0495633_0000381 3300046558 Bacteria 47007
200 Ga0495633_0001071 3300046558 Bacteria 22118
201 Ga0495633_0006010 3300046558 Bacteria 7293
202 Ga0495633_0502939 3300046558 Bacteria 546
203 Ga0495668_0000006 3300046616 Bacteria 553404
204 Ga0495668_0000096 3300046616 Bacteria 139693
205 Ga0495668_0000180 3300046616 Bacteria 94157
206 Ga0495668_0008581 3300046616 Bacteria 6359
207 Ga0495611_0006210 3300046648 Bacteria 5099
208 Ga0495625_0000053 3300046660 Bacteria 190575
209 Ga0495625_0054292 3300046660 Bacteria 2862
210 Ga0495625_0155583 3300046660 Bacteria 1534
211 Ga0495625_0170284 3300046660 Bacteria 1454
212 Ga0495625_0206796 3300046660 Bacteria 1292
213 Ga0495625_0504487 3300046660 Bacteria 739
214 Ga0495659_0042167 3300046664 Bacteria 1633
215 Ga0495661_0002718 3300046665 Bacteria 13479
216 Ga0495661_0008008 3300046665 Bacteria 7338
217 Ga0495661_0022504 3300046665 Bacteria 4100
218 Ga0495661_0065431 3300046665 Bacteria 2142
219 Ga0495661_0158628 3300046665 Bacteria 1216
220 Ga0495661_0549881 3300046665 Bacteria 546
221 Ga0495588_0073443 3300046674 Bacteria 1781
222 Ga0495588_0136377 3300046674 Bacteria 1295
223 Ga0495669_0001637 3300046684 Bacteria 9209
224 Ga0495669_0005964 3300046684 Bacteria 5081
225 Ga0495670_0019226 3300046691 Bacteria 3366
226 Ga0495670_0036802 3300046691 Bacteria 2439
227 Ga0495671_0000002 3300046692 Bacteria 1136189
228 Ga0495671_0002321 3300046692 Bacteria 12087
229 Ga0495671_0355952 3300046692 Bacteria 702
230 Ga0495649_0002789 3300046694 Bacteria 12166
231 Ga0495649_0052270 3300046694 Bacteria 2214
232 Ga0495589_0007782 3300046794 Bacteria 5609
233 Ga0495589_0315466 3300046794 Bacteria 723
234 Ga0495660_0006110 3300046810 Bacteria 7148
235 Ga0495660_0018729 3300046810 Bacteria 3976
236 Ga0495660_0025019 3300046810 Bacteria 3393
237 Ga0495660_0032576 3300046810 Bacteria 2926
238 Ga0495636_0159253 3300047318 Bacteria 1016
239 Ga0495672_0000022 3300047320 Bacteria 420632
240 Ga0495672_0000095 3300047320 Bacteria 143883
241 Ga0495672_0025362 3300047320 Bacteria 3796
242 Ga0495683_0184962 3300047323 Bacteria 949
243 Ga0495683_0253959 3300047323 Bacteria 770
244 Ga0495687_001158 3300047443 Bacteria 25533
245 Ga0495677_0011748 3300047445 Bacteria 3201
246 Ga0495679_006944 3300047446 Bacteria 4797
247 Ga0495679_009799 3300047446 Bacteria 3806
248 Ga0495673_0000059 3300047469 Bacteria 233234
249 Ga0495681_0041047 3300047470 Bacteria 2249
250 Ga0495686_0000135 3300047472 Bacteria 148920
251 Ga0495686_0049058 3300047472 Bacteria 2658
252 Ga0495686_0403477 3300047472 Bacteria 733
253 Ga0495602_0157786 3300048088 Bacteria 1775
254 Ga0495626_0019889 3300048091 Bacteria 3350
255 Ga0495626_0041310 3300048091 Bacteria 2173
256 Ga0496100_0053112 3300048903 Bacteria 2638
257 Ga0496100_0648137 3300048903 Bacteria 822
258 Ga0496101_0511366 3300048904 Bacteria 949
259 Ga0496102_0000151 3300048905 Bacteria 94403
260 Ga0496102_0152690 3300048905 Bacteria 2170
261 Ga0496102_0825528 3300048905 Bacteria 849
262 Ga0496103_0137005 3300048906 Bacteria 1564
263 Ga0496105_0789407 3300048908 Bacteria 723
264 Ga0496106_0522057 3300048909 Bacteria 954
265 Ga0496107_0991640 3300048910 Bacteria 610
266 Ga0496107_1376649 3300048910 Bacteria 503
267 Ga0496111_0154702 3300048914 Bacteria 1701
268 Ga0496114_0112409 3300048917 Bacteria 2334
269 Ga0496116_0015645 3300048919 Bacteria 5989
270 Ga0496117_0000001 3300048920 Bacteria 2526244
271 Ga0496118_0000002 3300048921 Bacteria 1690764
272 Ga0496121_0007795 3300048924 Bacteria 12820
273 Ga0496121_0011077 3300048924 Bacteria 10062
274 Ga0496121_0281271 3300048924 Bacteria 1138
275 Ga0496121_0335220 3300048924 Bacteria 1013
276 Ga0496122_0013372 3300048925 Bacteria 8035
277 Ga0496123_0065455 3300048926 Bacteria 2310
278 Ga0496124_0065386 3300048927 Bacteria 3033
279 Ga0496124_0117641 3300048927 Bacteria 2129
280 Ga0496124_0376507 3300048927 Bacteria 994
281 Ga0496125_0034021 3300048928 Bacteria 4498
282 Ga0496126_0030419 3300048929 Bacteria 5115
283 Ga0496126_0561794 3300048929 Bacteria 904
284 Ga0501310_032708 3300049130 Bacteria 697
285 Ga0495678_000588 3300049459 Bacteria 34196
286 Ga0495678_008805 3300049459 Bacteria 5052
287 Ga0495678_026830 3300049459 Bacteria 2451
288 Ga0495678_089842 3300049459 Bacteria 1084
289 Ga0495682_0002199 3300049460 Bacteria 9440
290 Ga0495682_0012517 3300049460 Bacteria 3250
291 Ga0501315_047297 3300049531 Bacteria 667
292 Ga0501034_0115057 3300049571 Bacteria 2678
293 Ga0501034_0905848 3300049571 Bacteria 769
294 Ga0501043_0392976 3300049579 Bacteria 1049
295 Ga0501047_0237709 3300049581 Bacteria 1673
296 Ga0501047_1442756 3300049581 Bacteria 504
297 Ga0501069_0006611 3300049585 Bacteria 6065
298 Ga0501069_0081182 3300049585 Bacteria 1826
299 Ga0501070_0066972 3300049586 Bacteria 2974
300 Ga0501070_0305092 3300049586 Bacteria 1296
301 Ga0501072_0105600 3300049588 Bacteria 2240
302 Ga0501072_0738360 3300049588 Bacteria 773
303 Ga0501073_0026046 3300049589 Bacteria 4191
304 Ga0501073_0243295 3300049589 Bacteria 1242
305 Ga0501074_0137688 3300049590 Bacteria 1747
306 Ga0501227_002037 3300049665 Bacteria 4484
307 Ga0501227_126637 3300049665 Bacteria 693
308 Ga0501238_058149 3300049671 Bacteria 587
309 Ga0501249_001440 3300049679 Bacteria 4903
310 Ga0501253_154028 3300049683 Bacteria 581
311 Ga0501080_0312477 3300049742 Bacteria 1424
312 Ga0501269_000423 3300049766 Bacteria 9533
313 Ga0501279_003529 3300049775 Bacteria 2040
314 Ga0501044_0233672 3300049823 Bacteria 1785
315 Ga0501044_0314871 3300049823 Bacteria 1491
316 Ga0501045_0146284 3300049824 Bacteria 1758
317 nmdc:mga03683_423843_c1 3300050489 Bacteria 638
318 nmdc:mga03n38_26634_c1 3300050490 Bacteria 2389
319 nmdc:mga03n38_43881_c1 3300050490 Bacteria 1961
320 nmdc:mga00v17_201919_c1 3300050491 Bacteria 1285
321 nmdc:mga0k408_154479_c1 3300050493 Bacteria 1367
322 nmdc:mga06z11_263359_c1 3300050494 Bacteria 1018
323 nmdc:mga07m45_44851_c1 3300050496 Bacteria 2482
324 nmdc:mga06r32_1074360_c1 3300050510 Bacteria 755
325 nmdc:mga0sz30_385713_c1 3300050516 Bacteria 627
326 Ga0500635_0000574 3300053080 Bacteria 9762
327 Ga0500651_0000088 3300053093 Bacteria 59179
328 Ga0500641_0441621 3300053096 Bacteria 503
329 Ga0500608_000123 3300053122 Bacteria 32276
330 Ga0500618_009677 3300053125 Bacteria 2622
331 Ga0500577_0146858 3300053142 Bacteria 998
332 Ga0500586_000227 3300053145 Bacteria 11155
333 Ga0500622_0092247 3300053156 Bacteria 1501
334 Ga0590071_049280 3300059421 Bacteria 1020
335 Ga0590077_123153 3300059426 Bacteria 614
336 Ga0466962_0032130 3300061719 Bacteria 2513

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_11595831 Ga0070681_115958311 97
2 3300049588 Ga0501072_0105600 Ga0501072_0105600_28_348 97
3 3300046692 Ga0495671_0355952 Ga0495671_0355952_377_673 98
4 3300005335 Ga0070666_10762858 Ga0070666_107628581 99
5 3300005355 Ga0070671_100578118 Ga0070671_1005781182 99
6 3300005367 Ga0070667_100099977 Ga0070667_1000999773 99
7 3300025903 Ga0207680_10721131 Ga0207680_107211312 100
8 3300025931 Ga0207644_10733054 Ga0207644_107330542 100
9 3300025986 Ga0207658_10093881 Ga0207658_100938814 100
10 iso_pu_bacteria 2599185156 2599333494 100
11 iso_pu_bacteria 2842922631 2842925098 100
12 iso_pu_bacteria 3000135777 3000137330 100
13 3300005329 Ga0070683_100145245 Ga0070683_1001452453 101
14 3300005535 Ga0070684_100201566 Ga0070684_1002015662 101
15 3300005543 Ga0070672_101463825 Ga0070672_1014638252 101
16 3300025944 Ga0207661_10184642 Ga0207661_101846421 101
17 3300026121 Ga0207683_10587393 Ga0207683_105873932 101
18 3300050510 nmdc:mga06r32_1074360_c1 nmdc:mga06r32_1074360_c1_14_322 101
19 iso_pu_bacteria 2857558681 2857564516 101
20 iso_pu_bacteria 2857564685 2857568747 101
21 iso_pu_bacteria 2919476304 2919480200 101
22 iso_pu_bacteria 2937843397 2937846774 101
23 iso_pu_bacteria 2600255292 2601667868 102
24 iso_pu_bacteria 2643221638 2644212110 102
25 iso_pu_bacteria 2687453257 2688067810 102
26 iso_pu_bacteria 2842333319 2842340832 102
27 iso_pu_bacteria 2857547612 2857550099 102
28 iso_pu_bacteria 2885080285 2885084753 102
29 iso_pu_bacteria 2932410948 2932411484 102
30 iso_pu_bacteria 2932416698 2932418949 102
31 3300049571 Ga0501034_0115057 Ga0501034_0115057_1034_1345 103
32 3300049581 Ga0501047_0237709 Ga0501047_0237709_357_668 103
33 3300049589 Ga0501073_0026046 Ga0501073_0026046_3201_3512 103
34 3300005458 Ga0070681_10199112 Ga0070681_101991122 104
35 3300025912 Ga0207707_10234438 Ga0207707_102344383 104
36 3300028794 Ga0307515_10090578 Ga0307515_100905786 104
37 3300042876 Ga0451577_0057226 Ga0451577_0057226_1890_2204 104
38 3300046512 Ga0495610_0028272 Ga0495610_0028272_1897_2211 104
39 3300046522 Ga0495643_0202819 Ga0495643_0202819_193_507 104
40 3300048929 Ga0496126_0561794 Ga0496126_0561794_477_791 104
41 3300049823 Ga0501044_0233672 Ga0501044_0233672_661_975 104
42 3300050516 nmdc:mga0sz30_385713_c1 nmdc:mga0sz30_385713_c1_212_526 104
43 3300053142 Ga0500577_0146858 Ga0500577_0146858_490_804 104
44 3300053156 Ga0500622_0092247 Ga0500622_0092247_338_652 104
45 3300003763 Ga0055529_1000068 Ga0055529_100006855 105
46 3300003771 Ga0055526_1000013 Ga0055526_100001340 105
47 3300005459 Ga0068867_100135593 Ga0068867_1001355934 105
48 3300006048 Ga0075363_100034283 Ga0075363_1000342833 105
49 3300006177 Ga0075362_10126751 Ga0075362_101267513 105
50 3300009036 Ga0105244_10002659 Ga0105244_100026596 105
51 3300025272 Ga0209455_1000026 Ga0209455_1000026457 105
52 3300025295 Ga0209564_1000002 Ga0209564_1000002969 105
53 3300025728 Ga0207655_1004019 Ga0207655_100401910 105
54 3300026089 Ga0207648_10358875 Ga0207648_103588753 105
55 3300030744 Ga0316181_1031340 Ga0316181_10313402 105
56 3300046452 Ga0495617_000042 Ga0495617_000042_14363_14680 105
57 3300046453 Ga0495627_232972 Ga0495627_232972_50_367 105
58 3300046457 Ga0495590_0000010 Ga0495590_0000010_239680_239997 105
59 3300046460 Ga0495638_0000027 Ga0495638_0000027_280876_281193 105
60 3300046460 Ga0495638_0056006 Ga0495638_0056006_1338_1655 105
61 3300046460 Ga0495638_0088249 Ga0495638_0088249_266_583 105
62 3300046460 Ga0495638_0140383 Ga0495638_0140383_284_601 105
63 3300046463 Ga0495653_0000010 Ga0495653_0000010_15700_16017 105
64 3300046463 Ga0495653_0266060 Ga0495653_0266060_95_412 105
65 3300046471 Ga0495650_0000044 Ga0495650_0000044_254125_254442 105
66 3300046471 Ga0495650_0001268 Ga0495650_0001268_338_655 105
67 3300046471 Ga0495650_0003132 Ga0495650_0003132_6012_6329 105
68 3300046471 Ga0495650_0041517 Ga0495650_0041517_200_517 105
69 3300046475 Ga0495639_0013547 Ga0495639_0013547_661_978 105
70 3300046492 Ga0495585_0002878 Ga0495585_0002878_5563_5880 105
71 3300046501 Ga0495607_0005509 Ga0495607_0005509_2528_2845 105
72 3300046506 Ga0495583_0000006 Ga0495583_0000006_270302_270619 105
73 3300046507 Ga0495606_0000128 Ga0495606_0000128_42443_42760 105
74 3300046507 Ga0495606_0000557 Ga0495606_0000557_7947_8264 105
75 3300046507 Ga0495606_0004948 Ga0495606_0004948_2558_2875 105
76 3300046507 Ga0495606_0005861 Ga0495606_0005861_3157_3474 105
77 3300046512 Ga0495610_0000008 Ga0495610_0000008_170345_170662 105
78 3300046512 Ga0495610_0002638 Ga0495610_0002638_5463_5780 105
79 3300046512 Ga0495610_0005058 Ga0495610_0005058_4587_4904 105
80 3300046512 Ga0495610_0009097 Ga0495610_0009097_4067_4384 105
81 3300046512 Ga0495610_0017960 Ga0495610_0017960_3279_3596 105
82 3300046520 Ga0495637_0058931 Ga0495637_0058931_1251_1568 105
83 3300046522 Ga0495643_0000022 Ga0495643_0000022_138169_138486 105
84 3300046524 Ga0495648_0000078 Ga0495648_0000078_47948_48265 105
85 3300046524 Ga0495648_0002119 Ga0495648_0002119_7812_8129 105
86 3300046524 Ga0495648_0021870 Ga0495648_0021870_3195_3512 105
87 3300046524 Ga0495648_0063607 Ga0495648_0063607_1563_1880 105
88 3300046528 Ga0495642_0000919 Ga0495642_0000919_10724_11041 105
89 3300046530 Ga0495654_0032205 Ga0495654_0032205_2026_2343 105
90 3300046538 Ga0495609_0005651 Ga0495609_0005651_6038_6355 105
91 3300046538 Ga0495609_0055969 Ga0495609_0055969_772_1089 105
92 3300046538 Ga0495609_0078055 Ga0495609_0078055_928_1245 105
93 3300046542 Ga0495597_0000107 Ga0495597_0000107_68990_69307 105
94 3300046557 Ga0495622_0000009 Ga0495622_0000009_199665_199982 105
95 3300046557 Ga0495622_0000043 Ga0495622_0000043_103707_104024 105
96 3300046558 Ga0495633_0000381 Ga0495633_0000381_32251_32568 105
97 3300046558 Ga0495633_0006010 Ga0495633_0006010_3048_3365 105
98 3300046558 Ga0495633_0502939 Ga0495633_0502939_161_478 105
99 3300046616 Ga0495668_0000096 Ga0495668_0000096_13894_14211 105
100 3300046660 Ga0495625_0000053 Ga0495625_0000053_14160_14477 105
101 3300046660 Ga0495625_0054292 Ga0495625_0054292_1121_1438 105
102 3300046660 Ga0495625_0170284 Ga0495625_0170284_1004_1321 105
103 3300046660 Ga0495625_0206796 Ga0495625_0206796_925_1242 105
104 3300046660 Ga0495625_0504487 Ga0495625_0504487_379_696 105
105 3300046664 Ga0495659_0042167 Ga0495659_0042167_754_1071 105
106 3300046665 Ga0495661_0008008 Ga0495661_0008008_6550_6867 105
107 3300046691 Ga0495670_0036802 Ga0495670_0036802_1186_1503 105
108 3300046692 Ga0495671_0000002 Ga0495671_0000002_767520_767837 105
109 3300046692 Ga0495671_0002321 Ga0495671_0002321_10473_10790 105
110 3300046694 Ga0495649_0002789 Ga0495649_0002789_4316_4633 105
111 3300046810 Ga0495660_0018729 Ga0495660_0018729_2333_2650 105
112 3300046810 Ga0495660_0025019 Ga0495660_0025019_1877_2194 105
113 3300047320 Ga0495672_0000095 Ga0495672_0000095_53059_53376 105
114 3300047323 Ga0495683_0253959 Ga0495683_0253959_54_371 105
115 3300047443 Ga0495687_001158 Ga0495687_001158_19922_20239 105
116 3300047446 Ga0495679_006944 Ga0495679_006944_4290_4607 105
117 3300047446 Ga0495679_009799 Ga0495679_009799_3299_3616 105
118 3300047469 Ga0495673_0000059 Ga0495673_0000059_19368_19685 105
119 3300047472 Ga0495686_0403477 Ga0495686_0403477_117_434 105
120 3300048924 Ga0496121_0281271 Ga0496121_0281271_677_994 105
121 3300048929 Ga0496126_0030419 Ga0496126_0030419_4424_4741 105
122 3300049459 Ga0495678_000588 Ga0495678_000588_25660_25977 105
123 3300049459 Ga0495678_008805 Ga0495678_008805_526_843 105
124 3300049459 Ga0495678_026830 Ga0495678_026830_1654_1971 105
125 3300049679 Ga0501249_001440 Ga0501249_001440_4222_4539 105
126 3300049766 Ga0501269_000423 Ga0501269_000423_8113_8430 105
127 3300050489 nmdc:mga03683_423843_c1 nmdc:mga03683_423843_c1_220_537 105
128 3300050490 nmdc:mga03n38_26634_c1 nmdc:mga03n38_26634_c1_1447_1764 105
129 3300053096 Ga0500641_0441621 Ga0500641_0441621_85_402 105
130 3300053125 Ga0500618_009677 Ga0500618_009677_399_716 105
131 3300053145 Ga0500586_000227 Ga0500586_000227_7475_7792 105
132 3300003771 Ga0055526_1005682 Ga0055526_10056826 106
133 3300003775 Ga0055524_1004427 Ga0055524_10044275 106
134 3300003775 Ga0055524_1007872 Ga0055524_10078726 106
135 3300003784 Ga0055534_1001797 Ga0055534_10017977 106
136 3300003791 Ga0055530_10010604 Ga0055530_100106041 106
137 3300005290 Ga0065712_10335750 Ga0065712_103357501 106
138 3300005364 Ga0070673_100181644 Ga0070673_1001816442 106
139 3300005455 Ga0070663_101799628 Ga0070663_1017996281 106
140 3300005458 Ga0070681_10952578 Ga0070681_109525781 106
141 3300005466 Ga0070685_10287057 Ga0070685_102870572 106
142 3300005466 Ga0070685_10597479 Ga0070685_105974791 106
143 3300005543 Ga0070672_100467949 Ga0070672_1004679492 106
144 3300005615 Ga0070702_100146066 Ga0070702_1001460662 106
145 3300005843 Ga0068860_102517373 Ga0068860_1025173731 106
146 3300005937 Ga0081455_10281150 Ga0081455_102811501 106
147 3300006028 Ga0070717_10025687 Ga0070717_100256874 106
148 3300006353 Ga0075370_10635959 Ga0075370_106359592 106
149 3300006844 Ga0075428_100460398 Ga0075428_1004603982 106
150 3300014497 Ga0182008_10004711 Ga0182008_100047114 106
151 3300014497 Ga0182008_10223553 Ga0182008_102235532 106
152 3300017792 Ga0163161_10088590 Ga0163161_100885903 106
153 3300025208 Ga0209436_100484 Ga0209436_1004842 106
154 3300025291 Ga0209675_1006952 Ga0209675_10069521 106
155 3300025295 Ga0209564_1007930 Ga0209564_10079301 106
156 3300025298 Ga0209050_1000664 Ga0209050_100066422 106
157 3300025936 Ga0207670_10082466 Ga0207670_100824662 106
158 3300025940 Ga0207691_10247611 Ga0207691_102476112 106
159 3300025941 Ga0207711_11158629 Ga0207711_111586291 106
160 3300026067 Ga0207678_10188256 Ga0207678_101882562 106
161 3300031548 Ga0307408_100261349 Ga0307408_1002613492 106
162 3300031730 Ga0307516_10135284 Ga0307516_101352843 106
163 3300031995 Ga0307409_101900596 Ga0307409_1019005962 106
164 3300032004 Ga0307414_10003286 Ga0307414_100032864 106
165 3300032126 Ga0307415_102188441 Ga0307415_1021884412 106
166 3300035691 Ga0373931_0704864 Ga0373931_0704864_51_371 106
167 3300037418 Ga0395900_0475656 Ga0395900_0475656_804_1124 106
168 3300037471 Ga0395905_0265352 Ga0395905_0265352_656_976 106
169 3300037471 Ga0395905_1309508 Ga0395905_1309508_45_365 106
170 3300041503 Ga0451847_0669870 Ga0451847_0669870_264_584 106
171 3300044719 Ga0466971_0059650 Ga0466971_0059650_1133_1453 106
172 3300046453 Ga0495627_017646 Ga0495627_017646_1284_1604 106
173 3300046455 Ga0495603_0038096 Ga0495603_0038096_688_1008 106
174 3300046460 Ga0495638_0297117 Ga0495638_0297117_339_659 106
175 3300046474 Ga0495605_0051362 Ga0495605_0051362_108_428 106
176 3300046474 Ga0495605_0146986 Ga0495605_0146986_35_355 106
177 3300046492 Ga0495585_0000385 Ga0495585_0000385_8563_8883 106
178 3300046492 Ga0495585_0031031 Ga0495585_0031031_666_986 106
179 3300046499 Ga0495594_0043228 Ga0495594_0043228_1325_1645 106
180 3300046499 Ga0495594_0047585 Ga0495594_0047585_1282_1602 106
181 3300046500 Ga0495596_0011429 Ga0495596_0011429_1864_2184 106
182 3300046501 Ga0495607_0381892 Ga0495607_0381892_116_436 106
183 3300046506 Ga0495583_0005813 Ga0495583_0005813_1730_2050 106
184 3300046507 Ga0495606_0000015 Ga0495606_0000015_132866_133186 106
185 3300046513 Ga0495616_0000075 Ga0495616_0000075_37743_38063 106
186 3300046513 Ga0495616_0140510 Ga0495616_0140510_387_707 106
187 3300046515 Ga0495620_0283655 Ga0495620_0283655_277_597 106
188 3300046518 Ga0495631_0007084 Ga0495631_0007084_1994_2314 106
189 3300046519 Ga0495632_0000091 Ga0495632_0000091_36783_37103 106
190 3300046519 Ga0495632_0000358 Ga0495632_0000358_9828_10148 106
191 3300046519 Ga0495632_0018197 Ga0495632_0018197_2697_3017 106
192 3300046522 Ga0495643_0000326 Ga0495643_0000326_64913_65233 106
193 3300046522 Ga0495643_0041640 Ga0495643_0041640_1146_1466 106
194 3300046523 Ga0495644_0015893 Ga0495644_0015893_1519_1839 106
195 3300046528 Ga0495642_0000326 Ga0495642_0000326_20798_21118 106
196 3300046528 Ga0495642_0051200 Ga0495642_0051200_602_922 106
197 3300046530 Ga0495654_0152652 Ga0495654_0152652_425_745 106
198 3300046538 Ga0495609_0097344 Ga0495609_0097344_607_927 106
199 3300046538 Ga0495609_0161904 Ga0495609_0161904_452_772 106
200 3300046558 Ga0495633_0001071 Ga0495633_0001071_21439_21759 106
201 3300046648 Ga0495611_0006210 Ga0495611_0006210_4349_4669 106
202 3300046660 Ga0495625_0155583 Ga0495625_0155583_473_793 106
203 3300046665 Ga0495661_0002718 Ga0495661_0002718_2275_2595 106
204 3300046665 Ga0495661_0022504 Ga0495661_0022504_2449_2769 106
205 3300046665 Ga0495661_0065431 Ga0495661_0065431_1405_1725 106
206 3300046665 Ga0495661_0158628 Ga0495661_0158628_800_1120 106
207 3300046674 Ga0495588_0073443 Ga0495588_0073443_360_680 106
208 3300046674 Ga0495588_0136377 Ga0495588_0136377_255_575 106
209 3300046684 Ga0495669_0001637 Ga0495669_0001637_2338_2658 106
210 3300046684 Ga0495669_0005964 Ga0495669_0005964_2956_3276 106
211 3300046694 Ga0495649_0052270 Ga0495649_0052270_1084_1404 106
212 3300046794 Ga0495589_0315466 Ga0495589_0315466_101_421 106
213 3300046810 Ga0495660_0032576 Ga0495660_0032576_1713_2033 106
214 3300047318 Ga0495636_0159253 Ga0495636_0159253_226_546 106
215 3300047323 Ga0495683_0184962 Ga0495683_0184962_602_922 106
216 3300047445 Ga0495677_0011748 Ga0495677_0011748_534_854 106
217 3300047470 Ga0495681_0041047 Ga0495681_0041047_1499_1819 106
218 3300047472 Ga0495686_0000135 Ga0495686_0000135_96627_96947 106
219 3300048091 Ga0495626_0019889 Ga0495626_0019889_1874_2194 106
220 3300048091 Ga0495626_0041310 Ga0495626_0041310_1776_2096 106
221 3300048903 Ga0496100_0053112 Ga0496100_0053112_1570_1896 106
222 3300048904 Ga0496101_0511366 Ga0496101_0511366_417_743 106
223 3300048905 Ga0496102_0000151 Ga0496102_0000151_59402_59722 106
224 3300048905 Ga0496102_0152690 Ga0496102_0152690_893_1213 106
225 3300048905 Ga0496102_0825528 Ga0496102_0825528_319_639 106
226 3300048909 Ga0496106_0522057 Ga0496106_0522057_377_703 106
227 3300048910 Ga0496107_0991640 Ga0496107_0991640_218_538 106
228 3300048910 Ga0496107_1376649 Ga0496107_1376649_67_393 106
229 3300048914 Ga0496111_0154702 Ga0496111_0154702_340_660 106
230 3300048917 Ga0496114_0112409 Ga0496114_0112409_952_1278 106
231 3300048919 Ga0496116_0015645 Ga0496116_0015645_1422_1742 106
232 3300048920 Ga0496117_0000001 Ga0496117_0000001_1223973_1224293 106
233 3300048921 Ga0496118_0000002 Ga0496118_0000002_1223973_1224293 106
234 3300048924 Ga0496121_0007795 Ga0496121_0007795_3253_3573 106
235 3300048924 Ga0496121_0011077 Ga0496121_0011077_8407_8727 106
236 3300048924 Ga0496121_0335220 Ga0496121_0335220_261_581 106
237 3300048925 Ga0496122_0013372 Ga0496122_0013372_3476_3796 106
238 3300048926 Ga0496123_0065455 Ga0496123_0065455_533_853 106
239 3300048927 Ga0496124_0065386 Ga0496124_0065386_1508_1828 106
240 3300048927 Ga0496124_0117641 Ga0496124_0117641_1541_1861 106
241 3300048927 Ga0496124_0376507 Ga0496124_0376507_285_605 106
242 3300048928 Ga0496125_0034021 Ga0496125_0034021_608_928 106
243 3300049130 Ga0501310_032708 Ga0501310_032708_64_384 106
244 3300049460 Ga0495682_0002199 Ga0495682_0002199_8375_8695 106
245 3300049460 Ga0495682_0012517 Ga0495682_0012517_1715_2035 106
246 3300049579 Ga0501043_0392976 Ga0501043_0392976_608_928 106
247 3300049581 Ga0501047_1442756 Ga0501047_1442756_32_352 106
248 3300049585 Ga0501069_0006611 Ga0501069_0006611_131_451 106
249 3300049585 Ga0501069_0081182 Ga0501069_0081182_1256_1576 106
250 3300049586 Ga0501070_0066972 Ga0501070_0066972_708_1028 106
251 3300049586 Ga0501070_0305092 Ga0501070_0305092_782_1102 106
252 3300049588 Ga0501072_0738360 Ga0501072_0738360_173_493 106
253 3300049589 Ga0501073_0243295 Ga0501073_0243295_740_1060 106
254 3300049590 Ga0501074_0137688 Ga0501074_0137688_1268_1588 106
255 3300049671 Ga0501238_058149 Ga0501238_058149_30_350 106
256 3300049742 Ga0501080_0312477 Ga0501080_0312477_115_435 106
257 3300049823 Ga0501044_0314871 Ga0501044_0314871_1154_1474 106
258 3300049824 Ga0501045_0146284 Ga0501045_0146284_76_396 106
259 3300050491 nmdc:mga00v17_201919_c1 nmdc:mga00v17_201919_c1_366_686 106
260 3300053093 Ga0500651_0000088 Ga0500651_0000088_58589_58912 106
261 3300059421 Ga0590071_049280 Ga0590071_049280_38_358 106
262 3300059426 Ga0590077_123153 Ga0590077_123153_35_355 106
263 3300061719 Ga0466962_0032130 Ga0466962_0032130_556_876 106
264 3300046810 Ga0495660_0006110 Ga0495660_0006110_1657_1980 107
265 3300047320 Ga0495672_0000022 Ga0495672_0000022_62221_62544 107
266 3300047472 Ga0495686_0049058 Ga0495686_0049058_1023_1346 107
267 3300049571 Ga0501034_0905848 Ga0501034_0905848_278_601 107
268 3300046474 Ga0495605_0075369 Ga0495605_0075369_91_417 108
269 3300046491 Ga0495584_0010996 Ga0495584_0010996_3007_3333 108
270 3300046528 Ga0495642_0213901 Ga0495642_0213901_91_417 108
271 3300046530 Ga0495654_0008449 Ga0495654_0008449_4564_4890 108
272 3300046538 Ga0495609_0433476 Ga0495609_0433476_180_506 108
273 3300046542 Ga0495597_0003370 Ga0495597_0003370_6961_7287 108
274 3300046616 Ga0495668_0000180 Ga0495668_0000180_17770_18096 108
275 3300046616 Ga0495668_0008581 Ga0495668_0008581_1903_2229 108
276 3300046794 Ga0495589_0007782 Ga0495589_0007782_4041_4367 108
277 3300047320 Ga0495672_0025362 Ga0495672_0025362_3006_3332 108
278 3300006178 Ga0075367_10311787 Ga0075367_103117871 109
279 3300006195 Ga0075366_10083307 Ga0075366_100833072 109
280 3300006353 Ga0075370_10014834 Ga0075370_100148345 109
281 3300013104 Ga0157370_10559386 Ga0157370_105593863 109
282 3300050490 nmdc:mga03n38_43881_c1 nmdc:mga03n38_43881_c1_1405_1752 109
283 3300050493 nmdc:mga0k408_154479_c1 nmdc:mga0k408_154479_c1_854_1201 109
284 3300050494 nmdc:mga06z11_263359_c1 nmdc:mga06z11_263359_c1_530_877 109
285 3300050496 nmdc:mga07m45_44851_c1 nmdc:mga07m45_44851_c1_2108_2455 109
286 3300053122 Ga0500608_000123 Ga0500608_000123_27106_27441 109
287 3300046524 Ga0495648_0147118 Ga0495648_0147118_241_573 110
288 3300046530 Ga0495654_0164293 Ga0495654_0164293_163_495 110
289 3300046538 Ga0495609_0167411 Ga0495609_0167411_329_661 110
290 3300046665 Ga0495661_0549881 Ga0495661_0549881_78_410 110
291 3300046691 Ga0495670_0019226 Ga0495670_0019226_1210_1542 110
292 3300048088 Ga0495602_0157786 Ga0495602_0157786_33_365 110
293 3300048908 Ga0496105_0789407 Ga0496105_0789407_175_507 110
294 3300053080 Ga0500635_0000574 Ga0500635_0000574_5320_5670 111
295 3300002774 JGI25150J39212_1000571 JGI25150J39212_10005717 112
296 3300002987 JGI25159J45721_1004574 JGI25159J45721_10045743 112
297 3300003215 JGI25153J46596_10005856 JGI25153J46596_100058564 112
298 3300003374 JGI25161J50226_1000182 JGI25161J50226_100018254 112
299 3300003771 Ga0055526_1000934 Ga0055526_100093418 112
300 3300003773 Ga0055537_1000039 Ga0055537_100003945 112
301 3300003773 Ga0055537_1002487 Ga0055537_10024877 112
302 3300003784 Ga0055534_1000174 Ga0055534_100017410 112
303 3300003790 Ga0055528_1000066 Ga0055528_100006647 112
304 3300003791 Ga0055530_10024830 Ga0055530_100248303 112
305 3300003791 Ga0055530_10024978 Ga0055530_100249783 112
306 3300003794 Ga0055531_10005354 Ga0055531_100053547 112
307 3300004625 Ga0055543_1000112 Ga0055543_100011229 112
308 3300004625 Ga0055543_1020853 Ga0055543_10208531 112
309 3300004625 Ga0055543_1020856 Ga0055543_10208561 112
310 3300005262 Ga0065165_1001216 Ga0065165_100121629 112
311 3300005262 Ga0065165_1047977 Ga0065165_10479771 112
312 3300015261 Ga0182006_1000002 Ga0182006_1000002785 112
313 3300015262 Ga0182007_10000997 Ga0182007_1000099715 112
314 3300015265 Ga0182005_1000002 Ga0182005_1000002318 112
315 3300017792 Ga0163161_10436269 Ga0163161_104362692 112
316 3300025208 Ga0209436_113303 Ga0209436_1133032 112
317 3300025208 Ga0209436_113304 Ga0209436_1133042 112
318 3300025245 Ga0207425_1000001 Ga0207425_1000001202 112
319 3300025245 Ga0207425_1000130 Ga0207425_100013025 112
320 3300025258 Ga0209129_1000003 Ga0209129_1000003202 112
321 3300025263 Ga0209565_1000003 Ga0209565_1000003319 112
322 3300025263 Ga0209565_1012852 Ga0209565_10128523 112
323 3300025273 Ga0209673_1000003 Ga0209673_1000003205 112
324 3300025284 Ga0209130_1000237 Ga0209130_100023754 112
325 3300025284 Ga0209130_1021306 Ga0209130_10213062 112
326 3300025284 Ga0209130_1021309 Ga0209130_10213092 112
327 3300025291 Ga0209675_1000003 Ga0209675_1000003719 112
328 3300025295 Ga0209564_1000012 Ga0209564_1000012527 112
329 3300025295 Ga0209564_1000311 Ga0209564_100031151 112
330 3300025297 Ga0209758_1000041 Ga0209758_1000041150 112
331 3300025298 Ga0209050_1000011 Ga0209050_1000011226 112
332 3300025298 Ga0209050_1000164 Ga0209050_100016429 112
333 3300025299 Ga0209256_1000068 Ga0209256_100006878 112
334 3300025299 Ga0209256_1000395 Ga0209256_100039536 112
335 3300025299 Ga0209256_1000952 Ga0209256_100095229 112
336 3300025302 Ga0207426_1011742 Ga0207426_10117425 112
337 3300025302 Ga0207426_1052226 Ga0207426_10522262 112
338 3300025304 Ga0209257_1000003 Ga0209257_1000003998 112
339 3300031548 Ga0307408_100001185 Ga0307408_10000118513 112
340 3300031548 Ga0307408_100184087 Ga0307408_1001840871 112
341 3300032004 Ga0307414_12221909 Ga0307414_122219091 112
342 3300042156 Ga0439446_0331958 Ga0439446_0331958_103_441 112
343 3300046616 Ga0495668_0000006 Ga0495668_0000006_259997_260335 112
344 3300048903 Ga0496100_0648137 Ga0496100_0648137_360_701 112
345 3300048906 Ga0496103_0137005 Ga0496103_0137005_656_1000 112
346 3300049459 Ga0495678_089842 Ga0495678_089842_349_687 112
347 3300049531 Ga0501315_047297 Ga0501315_047297_27_365 112
348 3300049665 Ga0501227_002037 Ga0501227_002037_2204_2542 112
349 3300049665 Ga0501227_126637 Ga0501227_126637_287_625 112
350 3300049683 Ga0501253_154028 Ga0501253_154028_105_443 112
351 3300049775 Ga0501279_003529 Ga0501279_003529_282_620 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

13

105

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8932 8 110
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8771 8 110
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8557 8 101
7ssu-assembly1.cif.gz_B structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8312 8 104
8tgy-assembly1.cif.gz_E crystal structure of gdx-clo from small multidrug resistance family of transporters in complex with guanylurea 0.8287 8 110
ID Description Score Start End Superfamily
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9794 9 108 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9564 11 108 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9416 8 112 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.937 8 112 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9249 9 108 1.10.3730.20
ID Description Score Start End GO Terms
AF-W6RB08-F1-model_v4 Guanidinium exporter 0.9908 4 107 GO:0005886
GO:0022857
AF-A0A1H8E1J1-F1-model_v4 Guanidinium exporter 0.9905 8 108 GO:0005886
GO:0022857
AF-A0A1Z8M630-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9886 8 111 GO:0005886
GO:0022857
AF-A0A7S6MCV9-F1-model_v4 Multidrug efflux SMR transporter 0.9882 8 112 GO:0005886
GO:0022857
AF-A0A1H3KKG8-F1-model_v4 Guanidinium exporter 0.988 4 108 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.54 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map