F418616

General Info

Members Datasets Scaffolds Average Seq Length
351 173 351 389

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10175674|Ga0114129_101756742
Length 416
Sequence MLGVGRCTFDVFSSMKRKRIVVIGFMGSMPIAGVVWQHIHYVVGLQRLGHDVFYIEDSARLPYNPETFEVTDEFDYTAKVLARLAREFDFKNRWGYCARYLPGTPTAGMSLKRIRQLYHDAEAILNVCGAQEFNEDLLVSDRILYIESDPGVEQIKIDKGIRSTVEYLRRHRALFTFGENIGTKDFPVPLHGFKWLPTRQPVVTDLWKTTRSPALCPTHSVAAESSRAAVFTTIANWSTSGLKDITWRGKKYLWSKSREFLRFIVAPKKARETFEMATNIDDTNTRRKFEQKGWRLASPLQLSVDYWLYRDYIQRSKGEFTVAKDQYVRLNTGWFSDRSACYLAAGRPVITQETGFVKNYGGKKGLLSFRTVEEVADAVKRINADYAKHSRAARDVAREIFEAETVLKSVLDRAGI

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
129 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.98
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000022 3300000545 Bacteria 32122
2 JGI24035J26624_1000642 3300002126 Bacteria 3236
3 JGI24035J26624_1001249 3300002126 Bacteria 2418
4 JGI25406J46586_10000003 3300003203 Bacteria 161718
5 JGI25405J52794_10000430 3300003911 Bacteria 5915
6 JGI25405J52794_10000820 3300003911 Bacteria 4832
7 Ga0065712_10023624 3300005290 Bacteria 1539
8 Ga0065712_10137148 3300005290 Bacteria 1485
9 Ga0065715_10001311 3300005293 Bacteria 6540
10 Ga0065715_10129084 3300005293 Unclassified 2052
11 Ga0065707_10004363 3300005295 Bacteria 3246
12 Ga0065707_10006784 3300005295 Bacteria 5005
13 Ga0070676_10001580 3300005328 Bacteria 11578
14 Ga0070676_10034826 3300005328 Bacteria 2892
15 Ga0070683_100017436 3300005329 Bacteria 6347
16 Ga0070683_100021122 3300005329 Bacteria 5806
17 Ga0070683_100123081 3300005329 Bacteria 2451
18 Ga0070690_100012629 3300005330 Bacteria 4972
19 Ga0070690_100194367 3300005330 Unclassified 1408
20 Ga0070670_100008797 3300005331 Bacteria 8617
21 Ga0070670_100132551 3300005331 Unclassified 2152
22 Ga0070666_10093584 3300005335 Unclassified 2066
23 Ga0068868_100146061 3300005338 Bacteria 1945
24 Ga0068868_100147835 3300005338 Bacteria 1933
25 Ga0068868_100226555 3300005338 Unclassified 1567
26 Ga0070689_100001968 3300005340 Bacteria 13326
27 Ga0070689_100155887 3300005340 Bacteria 1844
28 Ga0070687_100009468 3300005343 Bacteria 4176
29 Ga0070668_100095561 3300005347 Bacteria 2348
30 Ga0070668_100096530 3300005347 Bacteria 2336
31 Ga0070668_100118145 3300005347 Unclassified 2116
32 Ga0070669_100003462 3300005353 Bacteria 11380
33 Ga0070669_100020820 3300005353 Bacteria 4686
34 Ga0070669_100053461 3300005353 Bacteria 2956
35 Ga0070675_100026047 3300005354 Unclassified 4690
36 Ga0070675_100031549 3300005354 Bacteria 4284
37 Ga0070675_100052100 3300005354 Bacteria 3364
38 Ga0070675_100068535 3300005354 Bacteria 2938
39 Ga0070675_100083834 3300005354 Bacteria 2661
40 Ga0070675_100315196 3300005354 Unclassified 1381
41 Ga0070671_100065607 3300005355 Bacteria 3024
42 Ga0070671_100163596 3300005355 Bacteria 1881
43 Ga0070671_100290860 3300005355 Unclassified 1390
44 Ga0070674_100054123 3300005356 Bacteria 2774
45 Ga0070674_100145326 3300005356 Unclassified 1784
46 Ga0070673_100044222 3300005364 Unclassified 3447
47 Ga0070673_100274924 3300005364 Unclassified 1475
48 Ga0070688_100001230 3300005365 Bacteria 12784
49 Ga0070688_100067182 3300005365 Bacteria 2283
50 Ga0070659_100001289 3300005366 Bacteria 18164
51 Ga0070667_100007261 3300005367 Bacteria 9207
52 Ga0070667_100015277 3300005367 Bacteria 6346
53 Ga0070667_100300646 3300005367 Unclassified 1445
54 Ga0070711_100020523 3300005439 Unclassified 4259
55 Ga0070711_100023831 3300005439 Unclassified 3986
56 Ga0070711_100042168 3300005439 Bacteria 3083
57 Ga0070705_100011555 3300005440 Unclassified 4459
58 Ga0070705_100043504 3300005440 Bacteria 2574
59 Ga0070700_100009585 3300005441 Bacteria 5320
60 Ga0070694_100005026 3300005444 Bacteria 7980
61 Ga0070708_100018410 3300005445 Bacteria 5846
62 Ga0070708_100048394 3300005445 Bacteria 3758
63 Ga0070708_100053934 3300005445 Bacteria 3569
64 Ga0070708_100093801 3300005445 Bacteria 2737
65 Ga0070708_100146884 3300005445 Bacteria 2191
66 Ga0070708_100200299 3300005445 Bacteria 1869
67 Ga0070663_100099453 3300005455 Bacteria 2168
68 Ga0070662_100011871 3300005457 Bacteria 5760
69 Ga0070662_100148533 3300005457 Bacteria 1822
70 Ga0070681_10138177 3300005458 Unclassified 2366
71 Ga0068867_100016841 3300005459 Bacteria 5195
72 Ga0070685_10017556 3300005466 Unclassified 3832
73 Ga0070685_10111460 3300005466 Bacteria 1686
74 Ga0070706_100000210 3300005467 Bacteria 71893
75 Ga0070706_100006044 3300005467 Bacteria 11439
76 Ga0070706_100007139 3300005467 Bacteria 10508
77 Ga0070706_100007665 3300005467 Bacteria 10095
78 Ga0070706_100008800 3300005467 Bacteria 9408
79 Ga0070706_100041805 3300005467 Bacteria 4233
80 Ga0070707_100021135 3300005468 Bacteria 6149
81 Ga0070707_100026721 3300005468 Bacteria 5483
82 Ga0070707_100027105 3300005468 Bacteria 5448
83 Ga0070707_100050972 3300005468 Unclassified 3968
84 Ga0070707_100102606 3300005468 Unclassified 2771
85 Ga0070707_100128358 3300005468 Bacteria 2464
86 Ga0070707_100190734 3300005468 Bacteria 1998
87 Ga0070707_100294934 3300005468 Unclassified 1576
88 Ga0070698_100006879 3300005471 Bacteria 12320
89 Ga0070698_100017365 3300005471 Bacteria 7583
90 Ga0070698_100028705 3300005471 Bacteria 5776
91 Ga0070698_100183600 3300005471 Bacteria 2030
92 Ga0070698_100192731 3300005471 Unclassified 1975
93 Ga0070699_100069751 3300005518 Bacteria 3055
94 Ga0070699_100133515 3300005518 Bacteria 2189
95 Ga0070699_100270895 3300005518 Unclassified 1520
96 Ga0070679_100035110 3300005530 Bacteria 4973
97 Ga0070684_100000274 3300005535 Bacteria 35734
98 Ga0070684_100005213 3300005535 Bacteria 9940
99 Ga0070684_100100697 3300005535 Bacteria 2580
100 Ga0070697_100004643 3300005536 Bacteria 10540
101 Ga0070697_100008638 3300005536 Bacteria 7956
102 Ga0070697_100019236 3300005536 Bacteria 5393
103 Ga0070697_100024646 3300005536 Bacteria 4791
104 Ga0070697_100108745 3300005536 Bacteria 2308
105 Ga0070697_100153432 3300005536 Bacteria 1943
106 Ga0070697_100350564 3300005536 Unclassified 1275
107 Ga0070672_100006785 3300005543 Bacteria 7731
108 Ga0070672_100028047 3300005543 Unclassified 4207
109 Ga0070672_100172620 3300005543 Bacteria 1799
110 Ga0070672_100178601 3300005543 Unclassified 1768
111 Ga0070665_100012314 3300005548 Bacteria 8619
112 Ga0070665_100022020 3300005548 Bacteria 6412
113 Ga0070665_100037716 3300005548 Bacteria 4859
114 Ga0070704_100002448 3300005549 Bacteria 10421
115 Ga0070664_100239775 3300005564 Bacteria 1627
116 Ga0068856_100025130 3300005614 Bacteria 5804
117 Ga0070702_100029734 3300005615 Bacteria 2974
118 Ga0068861_100085995 3300005719 Bacteria 2471
119 Ga0068861_100298141 3300005719 Unclassified 1395
120 Ga0068863_100027730 3300005841 Bacteria 5404
121 Ga0068858_100008388 3300005842 Bacteria 9939
122 Ga0068860_100159897 3300005843 Bacteria 2172
123 Ga0068860_100316949 3300005843 Bacteria 1530
124 Ga0081455_10000314 3300005937 Bacteria 63484
125 Ga0081455_10003842 3300005937 Bacteria 17128
126 Ga0081455_10004746 3300005937 Bacteria 15106
127 Ga0081455_10010007 3300005937 Bacteria 9693
128 Ga0081455_10016014 3300005937 Bacteria 7255
129 Ga0081540_1000111 3300005983 Bacteria 86926
130 Ga0081539_10000077 3300005985 Bacteria 228125
131 Ga0081539_10001712 3300005985 Bacteria 35198
132 Ga0081539_10028069 3300005985 Bacteria 3547
133 Ga0081539_10037123 3300005985 Bacteria 2905
134 Ga0070717_10002291 3300006028 Bacteria 13425
135 Ga0070717_10017212 3300006028 Bacteria 5619
136 Ga0070717_10075783 3300006028 Unclassified 2814
137 Ga0070715_10043170 3300006163 Unclassified 1899
138 Ga0070716_100010532 3300006173 Unclassified 4638
139 Ga0070712_100005167 3300006175 Bacteria 8074
140 Ga0070712_100059829 3300006175 Bacteria 2684
141 Ga0070712_100070525 3300006175 Bacteria 2497
142 Ga0070712_100104742 3300006175 Bacteria 2100
143 Ga0097621_100117090 3300006237 Unclassified 2257
144 Ga0097621_100156066 3300006237 Bacteria 1959
145 Ga0068871_100127695 3300006358 Bacteria 2153
146 Ga0075428_100337041 3300006844 Bacteria 1620
147 Ga0075428_100349402 3300006844 Bacteria 1587
148 Ga0075434_100240770 3300006871 Bacteria 1829
149 Ga0075434_100256392 3300006871 Bacteria 1768
150 Ga0075434_100436980 3300006871 Bacteria 1330
151 Ga0068865_100048220 3300006881 Bacteria 2930
152 Ga0075436_100025743 3300006914 Bacteria 4049
153 Ga0105240_10000041 3300009093 Bacteria 264078
154 Ga0111539_10401434 3300009094 Unclassified 1596
155 Ga0105245_10110938 3300009098 Bacteria 2551
156 Ga0105245_10137785 3300009098 Unclassified 2295
157 Ga0114129_10006405 3300009147 Bacteria 16690
158 Ga0114129_10175674 3300009147 Unclassified 2917
159 Ga0114129_10396216 3300009147 Bacteria 1820
160 Ga0105243_10128913 3300009148 Bacteria 2144
161 Ga0105241_10232717 3300009174 Bacteria 1554
162 Ga0105242_10039142 3300009176 Unclassified 3815
163 Ga0105242_10081128 3300009176 Bacteria 2712
164 Ga0105237_10151145 3300009545 Bacteria 2318
165 Ga0105249_10002167 3300009553 Bacteria 17013
166 Ga0105249_10194318 3300009553 Bacteria 1982
167 Ga0105239_10126623 3300010375 Unclassified 2839
168 Ga0105239_10264879 3300010375 Bacteria 1932
169 Ga0157369_10093864 3300013105 Bacteria 3203
170 Ga0157374_10029524 3300013296 Bacteria 4967
171 Ga0157374_10057560 3300013296 Bacteria 3631
172 Ga0157374_10057848 3300013296 Bacteria 3622
173 Ga0157374_10088033 3300013296 Bacteria 2957
174 Ga0157374_10103080 3300013296 Bacteria 2737
175 Ga0157374_10119935 3300013296 Bacteria 2537
176 Ga0157374_10230327 3300013296 Bacteria 1820
177 Ga0157374_10261494 3300013296 Unclassified 1704
178 Ga0157378_10043161 3300013297 Bacteria 4003
179 Ga0157378_10118511 3300013297 Bacteria 2437
180 Ga0163162_10006422 3300013306 Bacteria 11386
181 Ga0163162_10055301 3300013306 Bacteria 3995
182 Ga0163162_10069068 3300013306 Unclassified 3586
183 Ga0163162_10142889 3300013306 Bacteria 2507
184 Ga0163162_10157925 3300013306 Unclassified 2389
185 Ga0163162_10202872 3300013306 Bacteria 2112
186 Ga0163162_10236345 3300013306 Bacteria 1958
187 Ga0163162_10253576 3300013306 Bacteria 1891
188 Ga0157372_10094722 3300013307 Bacteria 3401
189 Ga0157372_10435329 3300013307 Unclassified 1528
190 Ga0157375_10002340 3300013308 Bacteria 16367
191 Ga0157375_10032485 3300013308 Bacteria 4951
192 Ga0157375_10072350 3300013308 Unclassified 3464
193 Ga0157375_10089349 3300013308 Bacteria 3137
194 Ga0157375_10379759 3300013308 Bacteria 1580
195 Ga0163163_10175778 3300014325 Bacteria 2188
196 Ga0163163_10259057 3300014325 Bacteria 1790
197 Ga0157379_10002419 3300014968 Bacteria 15611
198 Ga0157376_10013545 3300014969 Bacteria 6090
199 Ga0157376_10031341 3300014969 Bacteria 4256
200 Ga0157376_10085185 3300014969 Bacteria 2723
201 Ga0157376_10106062 3300014969 Bacteria 2465
202 Ga0157376_10127235 3300014969 Bacteria 2268
203 Ga0157376_10173686 3300014969 Bacteria 1964
204 Ga0182007_10042462 3300015262 Bacteria 1513
205 Ga0163161_10039191 3300017792 Bacteria 3401
206 Ga0207666_1000200 3300025271 Bacteria 8918
207 Ga0207697_10000048 3300025315 Bacteria 47739
208 Ga0207697_10000154 3300025315 Bacteria 34024
209 Ga0207697_10001979 3300025315 Bacteria 10862
210 Ga0207697_10002714 3300025315 Bacteria 9034
211 Ga0207697_10026069 3300025315 Unclassified 2390
212 Ga0207688_10006813 3300025901 Bacteria 6218
213 Ga0207680_10049884 3300025903 Bacteria 2494
214 Ga0207699_10008493 3300025906 Bacteria 5073
215 Ga0207645_10000452 3300025907 Bacteria 34086
216 Ga0207645_10003126 3300025907 Bacteria 12688
217 Ga0207645_10007585 3300025907 Bacteria 7648
218 Ga0207684_10000028 3300025910 Bacteria 306450
219 Ga0207684_10011607 3300025910 Bacteria 7697
220 Ga0207684_10014850 3300025910 Bacteria 6703
221 Ga0207684_10016531 3300025910 Bacteria 6334
222 Ga0207684_10030911 3300025910 Unclassified 4558
223 Ga0207684_10032803 3300025910 Bacteria 4416
224 Ga0207684_10066160 3300025910 Bacteria 3069
225 Ga0207684_10085281 3300025910 Bacteria 2691
226 Ga0207695_10000125 3300025913 Bacteria 228810
227 Ga0207693_10002954 3300025915 Bacteria 14720
228 Ga0207693_10010972 3300025915 Bacteria 7342
229 Ga0207693_10024152 3300025915 Bacteria 4827
230 Ga0207693_10094311 3300025915 Bacteria 2346
231 Ga0207663_10008736 3300025916 Bacteria 5321
232 Ga0207663_10024432 3300025916 Unclassified 3480
233 Ga0207663_10032014 3300025916 Bacteria 3118
234 Ga0207663_10164696 3300025916 Unclassified 1569
235 Ga0207662_10000206 3300025918 Bacteria 27413
236 Ga0207646_10017435 3300025922 Bacteria 6720
237 Ga0207646_10052743 3300025922 Bacteria 3639
238 Ga0207646_10111772 3300025922 Unclassified 2452
239 Ga0207681_10057718 3300025923 Unclassified 2654
240 Ga0207650_10085759 3300025925 Bacteria 2396
241 Ga0207650_10137126 3300025925 Unclassified 1920
242 Ga0207659_10028524 3300025926 Bacteria 3794
243 Ga0207659_10050237 3300025926 Bacteria 2962
244 Ga0207659_10050564 3300025926 Bacteria 2953
245 Ga0207664_10031523 3300025929 Bacteria 4056
246 Ga0207664_10315212 3300025929 Bacteria 1379
247 Ga0207644_10135650 3300025931 Bacteria 1889
248 Ga0207644_10186591 3300025931 Unclassified 1628
249 Ga0207690_10007947 3300025932 Bacteria 6298
250 Ga0207706_10000716 3300025933 Bacteria 34628
251 Ga0207706_10074082 3300025933 Bacteria 2994
252 Ga0207706_10109941 3300025933 Unclassified 2425
253 Ga0207686_10002573 3300025934 Bacteria 9865
254 Ga0207686_10075020 3300025934 Bacteria 2188
255 Ga0207670_10010861 3300025936 Bacteria 5256
256 Ga0207670_10218579 3300025936 Bacteria 1457
257 Ga0207669_10061459 3300025937 Unclassified 2308
258 Ga0207704_10067497 3300025938 Unclassified 2250
259 Ga0207665_10002528 3300025939 Bacteria 12311
260 Ga0207665_10020666 3300025939 Bacteria 4328
261 Ga0207665_10079030 3300025939 Bacteria 2261
262 Ga0207691_10003206 3300025940 Bacteria 15956
263 Ga0207691_10011980 3300025940 Bacteria 8317
264 Ga0207691_10015062 3300025940 Bacteria 7359
265 Ga0207691_10162666 3300025940 Bacteria 1957
266 Ga0207691_10292794 3300025940 Unclassified 1400
267 Ga0207689_10322769 3300025942 Unclassified 1281
268 Ga0207661_10013451 3300025944 Bacteria 5977
269 Ga0207679_10029745 3300025945 Bacteria 3806
270 Ga0207679_10202194 3300025945 Unclassified 1660
271 Ga0207712_10063758 3300025961 Bacteria 2624
272 Ga0207668_10005212 3300025972 Bacteria 7649
273 Ga0207668_10055158 3300025972 Bacteria 2761
274 Ga0207668_10112890 3300025972 Unclassified 2042
275 Ga0207658_10073739 3300025986 Unclassified 2591
276 Ga0207658_10077310 3300025986 Bacteria 2539
277 Ga0207677_10170522 3300026023 Unclassified 1701
278 Ga0207703_10004493 3300026035 Bacteria 11452
279 Ga0207678_10123752 3300026067 Bacteria 2207
280 Ga0207641_10039433 3300026088 Bacteria 3950
281 Ga0207648_10120137 3300026089 Bacteria 2310
282 Ga0207675_100065813 3300026118 Bacteria 3387
283 Ga0207683_10007015 3300026121 Bacteria 9662
284 Ga0207683_10017751 3300026121 Bacteria 6068
285 Ga0207683_10156633 3300026121 Bacteria 2058
286 Ga0268266_10209166 3300028379 Unclassified 1788
287 Ga0268265_10045446 3300028380 Bacteria 3277
288 Ga0268264_10117216 3300028381 Unclassified 2342
289 Ga0307513_10020758 3300031456 Bacteria 7775
290 Ga0373944_0041227 3300035089 Bacteria 1428
291 Ga0373936_0060796 3300035113 Unclassified 1542
292 Ga0373955_0018375 3300035172 Bacteria 3476
293 Ga0316574_0088726 3300035398 Bacteria 1970
294 Ga0373931_0028909 3300035691 Unclassified 2842
295 Ga0373931_0041269 3300035691 Unclassified 2424
296 Ga0373927_0024281 3300035695 Bacteria 3966
297 Ga0373927_0043959 3300035695 Bacteria 2891
298 Ga0373947_0014374 3300035725 Bacteria 4541
299 Ga0373937_0019229 3300036401 Bacteria 6115
300 Ga0373937_0121938 3300036401 Bacteria 2430
301 Ga0395898_0021566 3300037466 Bacteria 6530
302 Ga0395901_0007215 3300038443 Bacteria 11207
303 Ga0395901_0111343 3300038443 Bacteria 2875
304 Ga0395901_0382234 3300038443 Bacteria 1449
305 Ga0451576_0255369 3300045051 Bacteria 1832
306 Ga0495592_0018248 3300046454 Bacteria 5333
307 Ga0495651_0059235 3300046462 Bacteria 2937
308 Ga0495653_0162424 3300046463 Bacteria 1550
309 Ga0495582_0036650 3300046473 Unclassified 2698
310 Ga0495662_0084678 3300046476 Bacteria 1543
311 Ga0495628_0021231 3300046516 Bacteria 5345
312 Ga0495630_0074018 3300046517 Bacteria 2565
313 Ga0495652_0080322 3300046529 Bacteria 2694
314 Ga0495640_0197658 3300046533 Bacteria 1275
315 Ga0495586_0034251 3300046535 Bacteria 2727
316 Ga0495587_0046149 3300046536 Unclassified 2587
317 Ga0495659_0024540 3300046664 Bacteria 2057
318 Ga0495647_0058714 3300046681 Bacteria 1513
319 Ga0495658_0062068 3300046683 Unclassified 2148
320 Ga0495658_0123193 3300046683 Bacteria 1570
321 Ga0495669_0006499 3300046684 Unclassified 4885
322 Ga0495624_0062603 3300046690 Bacteria 2327
323 Ga0495600_0181685 3300046809 Bacteria 1356
324 Ga0495675_0100003 3300047444 Bacteria 1816
325 Ga0495684_0089618 3300047471 Bacteria 2330
326 Ga0496101_0007385 3300048904 Bacteria 7119
327 Ga0496101_0023992 3300048904 Unclassified 4219
328 Ga0496102_0107672 3300048905 Unclassified 2595
329 Ga0496103_0070587 3300048906 Unclassified 2185
330 Ga0496104_0104448 3300048907 Bacteria 2714
331 Ga0496104_0265689 3300048907 Bacteria 1628
332 Ga0496105_0015096 3300048908 Bacteria 6148
333 Ga0496107_0024301 3300048910 Bacteria 4287
334 Ga0496108_0035884 3300048911 Unclassified 4124
335 Ga0496108_0207088 3300048911 Unclassified 1702
336 Ga0496108_0342972 3300048911 Unclassified 1303
337 Ga0496109_0044121 3300048912 Bacteria 4044
338 Ga0496109_0100859 3300048912 Bacteria 2679
339 Ga0496109_0195582 3300048912 Bacteria 1901
340 Ga0496109_0240809 3300048912 Unclassified 1703
341 Ga0496112_0096488 3300048915 Bacteria 2927
342 Ga0496112_0138767 3300048915 Bacteria 2401
343 Ga0496113_0053986 3300048916 Bacteria 3006
344 Ga0496114_0057982 3300048917 Bacteria 3233
345 Ga0496115_0009602 3300048918 Bacteria 7193
346 Ga0496115_0130456 3300048918 Bacteria 2071
347 nmdc:mga05p37_143168_c1 3300050507 Unclassified 2928
348 nmdc:mga05p37_9008_c1 3300050507 Bacteria 11803
349 nmdc:mga0n895_377271_c1 3300050512 Bacteria 1435
350 nmdc:mga08x19_67323_c1 3300050514 Unclassified 2329
351 Ga0495601_0066573 3300053077 Bacteria 2293

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100048394 Ga0070708_1000483942 355
2 3300005467 Ga0070706_100007665 Ga0070706_1000076654 355
3 3300005536 Ga0070697_100004643 Ga0070697_1000046439 355
4 3300025910 Ga0207684_10014850 Ga0207684_100148504 355
5 3300025922 Ga0207646_10052743 Ga0207646_100527432 355
6 3300005295 Ga0065707_10004363 Ga0065707_100043633 370
7 3300006844 Ga0075428_100337041 Ga0075428_1003370411 372
8 3300005295 Ga0065707_10006784 Ga0065707_100067843 374
9 3300025933 Ga0207706_10109941 Ga0207706_101099412 374
10 3300035695 Ga0373927_0043959 Ga0373927_0043959_1476_2648 374
11 3300046664 Ga0495659_0024540 Ga0495659_0024540_664_1836 374
12 3300046684 Ga0495669_0006499 Ga0495669_0006499_3348_4520 374
13 3300006871 Ga0075434_100256392 Ga0075434_1002563922 375
14 3300005293 Ga0065715_10129084 Ga0065715_101290841 379
15 3300025940 Ga0207691_10292794 Ga0207691_102927941 380
16 3300003911 JGI25405J52794_10000820 JGI25405J52794_100008201 382
17 3300005340 Ga0070689_100001968 Ga0070689_1000019689 382
18 3300005354 Ga0070675_100068535 Ga0070675_1000685353 382
19 3300005355 Ga0070671_100163596 Ga0070671_1001635962 382
20 3300005356 Ga0070674_100145326 Ga0070674_1001453262 382
21 3300005365 Ga0070688_100001230 Ga0070688_1000012307 382
22 3300005366 Ga0070659_100001289 Ga0070659_10000128910 382
23 3300005367 Ga0070667_100007261 Ga0070667_1000072612 382
24 3300005440 Ga0070705_100011555 Ga0070705_1000115552 382
25 3300005444 Ga0070694_100005026 Ga0070694_1000050262 382
26 3300005445 Ga0070708_100053934 Ga0070708_1000539342 382
27 3300005468 Ga0070707_100021135 Ga0070707_1000211352 382
28 3300005468 Ga0070707_100128358 Ga0070707_1001283581 382
29 3300005468 Ga0070707_100294934 Ga0070707_1002949341 382
30 3300005471 Ga0070698_100183600 Ga0070698_1001836001 382
31 3300005471 Ga0070698_100192731 Ga0070698_1001927312 382
32 3300005518 Ga0070699_100069751 Ga0070699_1000697512 382
33 3300005518 Ga0070699_100133515 Ga0070699_1001335152 382
34 3300005518 Ga0070699_100270895 Ga0070699_1002708951 382
35 3300005535 Ga0070684_100000274 Ga0070684_1000002749 382
36 3300005536 Ga0070697_100108745 Ga0070697_1001087451 382
37 3300005549 Ga0070704_100002448 Ga0070704_1000024488 382
38 3300005841 Ga0068863_100027730 Ga0068863_1000277305 382
39 3300005842 Ga0068858_100008388 Ga0068858_1000083889 382
40 3300005937 Ga0081455_10000314 Ga0081455_1000031427 382
41 3300005937 Ga0081455_10010007 Ga0081455_100100074 382
42 3300005937 Ga0081455_10016014 Ga0081455_100160145 382
43 3300006028 Ga0070717_10017212 Ga0070717_100172125 382
44 3300006175 Ga0070712_100104742 Ga0070712_1001047422 382
45 3300006914 Ga0075436_100025743 Ga0075436_1000257433 382
46 3300013296 Ga0157374_10057560 Ga0157374_100575602 382
47 3300025315 Ga0207697_10001979 Ga0207697_100019796 382
48 3300025910 Ga0207684_10011607 Ga0207684_100116072 382
49 3300025910 Ga0207684_10085281 Ga0207684_100852812 382
50 3300025922 Ga0207646_10111772 Ga0207646_101117722 382
51 3300025926 Ga0207659_10028524 Ga0207659_100285243 382
52 3300025929 Ga0207664_10315212 Ga0207664_103152122 382
53 3300025933 Ga0207706_10074082 Ga0207706_100740823 382
54 3300025934 Ga0207686_10075020 Ga0207686_100750202 382
55 3300025936 Ga0207670_10010861 Ga0207670_100108613 382
56 3300025944 Ga0207661_10013451 Ga0207661_100134516 382
57 3300025961 Ga0207712_10063758 Ga0207712_100637584 382
58 3300026035 Ga0207703_10004493 Ga0207703_100044934 382
59 3300026088 Ga0207641_10039433 Ga0207641_100394334 382
60 3300026118 Ga0207675_100065813 Ga0207675_1000658133 382
61 3300031456 Ga0307513_10020758 Ga0307513_100207582 382
62 3300035695 Ga0373927_0024281 Ga0373927_0024281_2024_3172 382
63 3300035725 Ga0373947_0014374 Ga0373947_0014374_3273_4421 382
64 3300002126 JGI24035J26624_1000642 JGI24035J26624_10006423 390
65 3300002126 JGI24035J26624_1001249 JGI24035J26624_10012494 390
66 3300005290 Ga0065712_10023624 Ga0065712_100236242 390
67 3300005290 Ga0065712_10137148 Ga0065712_101371481 390
68 3300005293 Ga0065715_10001311 Ga0065715_100013115 390
69 3300005328 Ga0070676_10001580 Ga0070676_100015803 390
70 3300005329 Ga0070683_100017436 Ga0070683_1000174363 390
71 3300005329 Ga0070683_100021122 Ga0070683_1000211224 390
72 3300005329 Ga0070683_100123081 Ga0070683_1001230812 390
73 3300005330 Ga0070690_100012629 Ga0070690_1000126294 390
74 3300005330 Ga0070690_100194367 Ga0070690_1001943671 390
75 3300005331 Ga0070670_100008797 Ga0070670_1000087974 390
76 3300005331 Ga0070670_100132551 Ga0070670_1001325511 390
77 3300005335 Ga0070666_10093584 Ga0070666_100935842 390
78 3300005338 Ga0068868_100146061 Ga0068868_1001460612 390
79 3300005338 Ga0068868_100147835 Ga0068868_1001478351 390
80 3300005338 Ga0068868_100226555 Ga0068868_1002265551 390
81 3300005340 Ga0070689_100155887 Ga0070689_1001558873 390
82 3300005343 Ga0070687_100009468 Ga0070687_1000094683 390
83 3300005347 Ga0070668_100095561 Ga0070668_1000955612 390
84 3300005347 Ga0070668_100096530 Ga0070668_1000965303 390
85 3300005347 Ga0070668_100118145 Ga0070668_1001181452 390
86 3300005353 Ga0070669_100020820 Ga0070669_1000208204 390
87 3300005353 Ga0070669_100053461 Ga0070669_1000534613 390
88 3300005354 Ga0070675_100026047 Ga0070675_1000260472 390
89 3300005354 Ga0070675_100031549 Ga0070675_1000315493 390
90 3300005354 Ga0070675_100052100 Ga0070675_1000521002 390
91 3300005354 Ga0070675_100083834 Ga0070675_1000838343 390
92 3300005354 Ga0070675_100315196 Ga0070675_1003151961 390
93 3300005355 Ga0070671_100065607 Ga0070671_1000656072 390
94 3300005355 Ga0070671_100290860 Ga0070671_1002908601 390
95 3300005356 Ga0070674_100054123 Ga0070674_1000541232 390
96 3300005364 Ga0070673_100044222 Ga0070673_1000442222 390
97 3300005364 Ga0070673_100274924 Ga0070673_1002749241 390
98 3300005365 Ga0070688_100067182 Ga0070688_1000671822 390
99 3300005367 Ga0070667_100015277 Ga0070667_1000152773 390
100 3300005367 Ga0070667_100300646 Ga0070667_1003006461 390
101 3300005439 Ga0070711_100020523 Ga0070711_1000205231 390
102 3300005439 Ga0070711_100023831 Ga0070711_1000238314 390
103 3300005439 Ga0070711_100042168 Ga0070711_1000421683 390
104 3300005440 Ga0070705_100043504 Ga0070705_1000435044 390
105 3300005441 Ga0070700_100009585 Ga0070700_1000095855 390
106 3300005445 Ga0070708_100018410 Ga0070708_1000184103 390
107 3300005445 Ga0070708_100093801 Ga0070708_1000938012 390
108 3300005445 Ga0070708_100146884 Ga0070708_1001468842 390
109 3300005445 Ga0070708_100200299 Ga0070708_1002002992 390
110 3300005455 Ga0070663_100099453 Ga0070663_1000994533 390
111 3300005457 Ga0070662_100011871 Ga0070662_1000118715 390
112 3300005457 Ga0070662_100148533 Ga0070662_1001485332 390
113 3300005458 Ga0070681_10138177 Ga0070681_101381772 390
114 3300005459 Ga0068867_100016841 Ga0068867_1000168415 390
115 3300005466 Ga0070685_10017556 Ga0070685_100175562 390
116 3300005466 Ga0070685_10111460 Ga0070685_101114602 390
117 3300005467 Ga0070706_100000210 Ga0070706_10000021038 390
118 3300005467 Ga0070706_100006044 Ga0070706_1000060442 390
119 3300005467 Ga0070706_100007139 Ga0070706_1000071395 390
120 3300005467 Ga0070706_100008800 Ga0070706_1000088002 390
121 3300005467 Ga0070706_100041805 Ga0070706_1000418051 390
122 3300005468 Ga0070707_100026721 Ga0070707_1000267213 390
123 3300005468 Ga0070707_100027105 Ga0070707_1000271052 390
124 3300005468 Ga0070707_100050972 Ga0070707_1000509723 390
125 3300005468 Ga0070707_100102606 Ga0070707_1001026062 390
126 3300005471 Ga0070698_100006879 Ga0070698_1000068793 390
127 3300005471 Ga0070698_100028705 Ga0070698_1000287051 390
128 3300005530 Ga0070679_100035110 Ga0070679_1000351102 390
129 3300005535 Ga0070684_100005213 Ga0070684_1000052137 390
130 3300005535 Ga0070684_100100697 Ga0070684_1001006973 390
131 3300005536 Ga0070697_100008638 Ga0070697_1000086384 390
132 3300005536 Ga0070697_100019236 Ga0070697_1000192362 390
133 3300005536 Ga0070697_100024646 Ga0070697_1000246463 390
134 3300005536 Ga0070697_100153432 Ga0070697_1001534322 390
135 3300005536 Ga0070697_100350564 Ga0070697_1003505641 390
136 3300005543 Ga0070672_100028047 Ga0070672_1000280472 390
137 3300005543 Ga0070672_100172620 Ga0070672_1001726202 390
138 3300005543 Ga0070672_100178601 Ga0070672_1001786012 390
139 3300005548 Ga0070665_100012314 Ga0070665_1000123143 390
140 3300005548 Ga0070665_100022020 Ga0070665_1000220204 390
141 3300005548 Ga0070665_100037716 Ga0070665_1000377161 390
142 3300005564 Ga0070664_100239775 Ga0070664_1002397752 390
143 3300005614 Ga0068856_100025130 Ga0068856_1000251301 390
144 3300005615 Ga0070702_100029734 Ga0070702_1000297342 390
145 3300005719 Ga0068861_100085995 Ga0068861_1000859953 390
146 3300005719 Ga0068861_100298141 Ga0068861_1002981412 390
147 3300005843 Ga0068860_100159897 Ga0068860_1001598973 390
148 3300005843 Ga0068860_100316949 Ga0068860_1003169492 390
149 3300005937 Ga0081455_10003842 Ga0081455_100038421 390
150 3300005937 Ga0081455_10004746 Ga0081455_100047469 390
151 3300005983 Ga0081540_1000111 Ga0081540_10001119 390
152 3300005985 Ga0081539_10028069 Ga0081539_100280692 390
153 3300005985 Ga0081539_10037123 Ga0081539_100371233 390
154 3300006028 Ga0070717_10002291 Ga0070717_100022912 390
155 3300006028 Ga0070717_10075783 Ga0070717_100757832 390
156 3300006163 Ga0070715_10043170 Ga0070715_100431702 390
157 3300006173 Ga0070716_100010532 Ga0070716_1000105322 390
158 3300006175 Ga0070712_100005167 Ga0070712_1000051674 390
159 3300006175 Ga0070712_100059829 Ga0070712_1000598293 390
160 3300006175 Ga0070712_100070525 Ga0070712_1000705252 390
161 3300006237 Ga0097621_100117090 Ga0097621_1001170903 390
162 3300006237 Ga0097621_100156066 Ga0097621_1001560662 390
163 3300006358 Ga0068871_100127695 Ga0068871_1001276951 390
164 3300006844 Ga0075428_100349402 Ga0075428_1003494022 390
165 3300006871 Ga0075434_100240770 Ga0075434_1002407702 390
166 3300006871 Ga0075434_100436980 Ga0075434_1004369801 390
167 3300006881 Ga0068865_100048220 Ga0068865_1000482203 390
168 3300009093 Ga0105240_10000041 Ga0105240_1000004145 390
169 3300009094 Ga0111539_10401434 Ga0111539_104014342 390
170 3300009098 Ga0105245_10110938 Ga0105245_101109382 390
171 3300009098 Ga0105245_10137785 Ga0105245_101377851 390
172 3300009147 Ga0114129_10006405 Ga0114129_1000640512 390
173 3300009147 Ga0114129_10396216 Ga0114129_103962162 390
174 3300009148 Ga0105243_10128913 Ga0105243_101289133 390
175 3300009174 Ga0105241_10232717 Ga0105241_102327172 390
176 3300009176 Ga0105242_10039142 Ga0105242_100391423 390
177 3300009176 Ga0105242_10081128 Ga0105242_100811283 390
178 3300009545 Ga0105237_10151145 Ga0105237_101511452 390
179 3300009553 Ga0105249_10002167 Ga0105249_100021677 390
180 3300010375 Ga0105239_10126623 Ga0105239_101266232 390
181 3300010375 Ga0105239_10264879 Ga0105239_102648792 390
182 3300013296 Ga0157374_10029524 Ga0157374_100295243 390
183 3300013296 Ga0157374_10057848 Ga0157374_100578484 390
184 3300013296 Ga0157374_10088033 Ga0157374_100880332 390
185 3300013296 Ga0157374_10103080 Ga0157374_101030804 390
186 3300013296 Ga0157374_10119935 Ga0157374_101199352 390
187 3300013296 Ga0157374_10230327 Ga0157374_102303272 390
188 3300013296 Ga0157374_10261494 Ga0157374_102614942 390
189 3300013297 Ga0157378_10043161 Ga0157378_100431614 390
190 3300013297 Ga0157378_10118511 Ga0157378_101185112 390
191 3300013306 Ga0163162_10006422 Ga0163162_100064229 390
192 3300013306 Ga0163162_10055301 Ga0163162_100553012 390
193 3300013306 Ga0163162_10069068 Ga0163162_100690684 390
194 3300013306 Ga0163162_10142889 Ga0163162_101428892 390
195 3300013306 Ga0163162_10202872 Ga0163162_102028723 390
196 3300013306 Ga0163162_10236345 Ga0163162_102363452 390
197 3300013306 Ga0163162_10253576 Ga0163162_102535762 390
198 3300013307 Ga0157372_10094722 Ga0157372_100947223 390
199 3300013307 Ga0157372_10435329 Ga0157372_104353292 390
200 3300013308 Ga0157375_10002340 Ga0157375_100023408 390
201 3300013308 Ga0157375_10032485 Ga0157375_100324852 390
202 3300013308 Ga0157375_10072350 Ga0157375_100723505 390
203 3300013308 Ga0157375_10089349 Ga0157375_100893493 390
204 3300013308 Ga0157375_10379759 Ga0157375_103797591 390
205 3300014325 Ga0163163_10175778 Ga0163163_101757782 390
206 3300014325 Ga0163163_10259057 Ga0163163_102590572 390
207 3300014968 Ga0157379_10002419 Ga0157379_100024197 390
208 3300014969 Ga0157376_10013545 Ga0157376_100135453 390
209 3300014969 Ga0157376_10085185 Ga0157376_100851853 390
210 3300014969 Ga0157376_10106062 Ga0157376_101060623 390
211 3300014969 Ga0157376_10127235 Ga0157376_101272352 390
212 3300014969 Ga0157376_10173686 Ga0157376_101736862 390
213 3300017792 Ga0163161_10039191 Ga0163161_100391912 390
214 3300025271 Ga0207666_1000200 Ga0207666_10002009 390
215 3300025315 Ga0207697_10000048 Ga0207697_1000004833 390
216 3300025315 Ga0207697_10000154 Ga0207697_1000015419 390
217 3300025315 Ga0207697_10026069 Ga0207697_100260692 390
218 3300025901 Ga0207688_10006813 Ga0207688_100068134 390
219 3300025906 Ga0207699_10008493 Ga0207699_100084934 390
220 3300025907 Ga0207645_10000452 Ga0207645_1000045235 390
221 3300025907 Ga0207645_10003126 Ga0207645_100031263 390
222 3300025910 Ga0207684_10000028 Ga0207684_1000002843 390
223 3300025910 Ga0207684_10016531 Ga0207684_100165315 390
224 3300025910 Ga0207684_10030911 Ga0207684_100309112 390
225 3300025910 Ga0207684_10032803 Ga0207684_100328032 390
226 3300025910 Ga0207684_10066160 Ga0207684_100661602 390
227 3300025913 Ga0207695_10000125 Ga0207695_1000012591 390
228 3300025915 Ga0207693_10002954 Ga0207693_100029548 390
229 3300025915 Ga0207693_10010972 Ga0207693_100109722 390
230 3300025915 Ga0207693_10024152 Ga0207693_100241523 390
231 3300025916 Ga0207663_10008736 Ga0207663_100087362 390
232 3300025916 Ga0207663_10024432 Ga0207663_100244323 390
233 3300025916 Ga0207663_10032014 Ga0207663_100320143 390
234 3300025916 Ga0207663_10164696 Ga0207663_101646962 390
235 3300025918 Ga0207662_10000206 Ga0207662_100002065 390
236 3300025922 Ga0207646_10017435 Ga0207646_100174353 390
237 3300025923 Ga0207681_10057718 Ga0207681_100577182 390
238 3300025925 Ga0207650_10085759 Ga0207650_100857594 390
239 3300025925 Ga0207650_10137126 Ga0207650_101371261 390
240 3300025926 Ga0207659_10050237 Ga0207659_100502373 390
241 3300025926 Ga0207659_10050564 Ga0207659_100505643 390
242 3300025931 Ga0207644_10135650 Ga0207644_101356502 390
243 3300025931 Ga0207644_10186591 Ga0207644_101865912 390
244 3300025932 Ga0207690_10007947 Ga0207690_100079473 390
245 3300025933 Ga0207706_10000716 Ga0207706_1000071617 390
246 3300025934 Ga0207686_10002573 Ga0207686_100025733 390
247 3300025936 Ga0207670_10218579 Ga0207670_102185791 390
248 3300025937 Ga0207669_10061459 Ga0207669_100614592 390
249 3300025938 Ga0207704_10067497 Ga0207704_100674972 390
250 3300025939 Ga0207665_10020666 Ga0207665_100206662 390
251 3300025939 Ga0207665_10079030 Ga0207665_100790303 390
252 3300025940 Ga0207691_10011980 Ga0207691_100119802 390
253 3300025940 Ga0207691_10015062 Ga0207691_100150627 390
254 3300025940 Ga0207691_10162666 Ga0207691_101626662 390
255 3300025942 Ga0207689_10322769 Ga0207689_103227691 390
256 3300025945 Ga0207679_10029745 Ga0207679_100297452 390
257 3300025945 Ga0207679_10202194 Ga0207679_102021941 390
258 3300025972 Ga0207668_10005212 Ga0207668_100052125 390
259 3300025972 Ga0207668_10055158 Ga0207668_100551582 390
260 3300025972 Ga0207668_10112890 Ga0207668_101128902 390
261 3300025986 Ga0207658_10073739 Ga0207658_100737392 390
262 3300025986 Ga0207658_10077310 Ga0207658_100773102 390
263 3300026023 Ga0207677_10170522 Ga0207677_101705222 390
264 3300026067 Ga0207678_10123752 Ga0207678_101237523 390
265 3300026089 Ga0207648_10120137 Ga0207648_101201372 390
266 3300026121 Ga0207683_10156633 Ga0207683_101566332 390
267 3300028379 Ga0268266_10209166 Ga0268266_102091662 390
268 3300028380 Ga0268265_10045446 Ga0268265_100454463 390
269 3300028381 Ga0268264_10117216 Ga0268264_101172162 390
270 3300035089 Ga0373944_0041227 Ga0373944_0041227_188_1360 390
271 3300035113 Ga0373936_0060796 Ga0373936_0060796_311_1483 390
272 3300035172 Ga0373955_0018375 Ga0373955_0018375_1174_2346 390
273 3300035398 Ga0316574_0088726 Ga0316574_0088726_93_1265 390
274 3300035691 Ga0373931_0028909 Ga0373931_0028909_387_1559 390
275 3300035691 Ga0373931_0041269 Ga0373931_0041269_563_1735 390
276 3300036401 Ga0373937_0019229 Ga0373937_0019229_839_2011 390
277 3300036401 Ga0373937_0121938 Ga0373937_0121938_940_2112 390
278 3300037466 Ga0395898_0021566 Ga0395898_0021566_3378_4550 390
279 3300038443 Ga0395901_0007215 Ga0395901_0007215_4834_6006 390
280 3300038443 Ga0395901_0111343 Ga0395901_0111343_352_1524 390
281 3300038443 Ga0395901_0382234 Ga0395901_0382234_175_1347 390
282 3300045051 Ga0451576_0255369 Ga0451576_0255369_268_1440 390
283 3300046462 Ga0495651_0059235 Ga0495651_0059235_274_1446 390
284 3300046463 Ga0495653_0162424 Ga0495653_0162424_253_1425 390
285 3300046517 Ga0495630_0074018 Ga0495630_0074018_1064_2236 390
286 3300046529 Ga0495652_0080322 Ga0495652_0080322_188_1360 390
287 3300046533 Ga0495640_0197658 Ga0495640_0197658_68_1240 390
288 3300046535 Ga0495586_0034251 Ga0495586_0034251_756_1928 390
289 3300046681 Ga0495647_0058714 Ga0495647_0058714_72_1244 390
290 3300046683 Ga0495658_0062068 Ga0495658_0062068_833_2005 390
291 3300046690 Ga0495624_0062603 Ga0495624_0062603_343_1515 390
292 3300046809 Ga0495600_0181685 Ga0495600_0181685_76_1248 390
293 3300047471 Ga0495684_0089618 Ga0495684_0089618_507_1679 390
294 3300048904 Ga0496101_0007385 Ga0496101_0007385_687_1859 390
295 3300048904 Ga0496101_0023992 Ga0496101_0023992_2157_3329 390
296 3300048905 Ga0496102_0107672 Ga0496102_0107672_219_1391 390
297 3300048906 Ga0496103_0070587 Ga0496103_0070587_485_1657 390
298 3300048907 Ga0496104_0104448 Ga0496104_0104448_211_1383 390
299 3300048907 Ga0496104_0265689 Ga0496104_0265689_168_1340 390
300 3300048908 Ga0496105_0015096 Ga0496105_0015096_4181_5389 390
301 3300048910 Ga0496107_0024301 Ga0496107_0024301_20_1192 390
302 3300048911 Ga0496108_0035884 Ga0496108_0035884_506_1678 390
303 3300048911 Ga0496108_0207088 Ga0496108_0207088_351_1523 390
304 3300048911 Ga0496108_0342972 Ga0496108_0342972_35_1207 390
305 3300048912 Ga0496109_0044121 Ga0496109_0044121_1366_2538 390
306 3300048912 Ga0496109_0100859 Ga0496109_0100859_1388_2560 390
307 3300048912 Ga0496109_0195582 Ga0496109_0195582_40_1212 390
308 3300048912 Ga0496109_0240809 Ga0496109_0240809_47_1219 390
309 3300048915 Ga0496112_0096488 Ga0496112_0096488_548_1720 390
310 3300048915 Ga0496112_0138767 Ga0496112_0138767_169_1341 390
311 3300048916 Ga0496113_0053986 Ga0496113_0053986_1450_2622 390
312 3300048917 Ga0496114_0057982 Ga0496114_0057982_1074_2282 390
313 3300048918 Ga0496115_0009602 Ga0496115_0009602_4796_5968 390
314 3300048918 Ga0496115_0130456 Ga0496115_0130456_68_1240 390
315 3300050507 nmdc:mga05p37_9008_c1 nmdc:mga05p37_9008_c1_6711_7883 390
316 3300050512 nmdc:mga0n895_377271_c1 nmdc:mga0n895_377271_c1_239_1411 390
317 3300050514 nmdc:mga08x19_67323_c1 nmdc:mga08x19_67323_c1_533_1705 390
318 3300003203 JGI25406J46586_10000003 JGI25406J46586_10000003116 391
319 3300005985 Ga0081539_10000077 Ga0081539_10000077185 391
320 3300025915 Ga0207693_10094311 Ga0207693_100943112 391
321 3300003911 JGI25405J52794_10000430 JGI25405J52794_100004303 396
322 3300005985 Ga0081539_10001712 Ga0081539_100017123 396
323 3300005328 Ga0070676_10034826 Ga0070676_100348262 397
324 3300005353 Ga0070669_100003462 Ga0070669_1000034623 397
325 3300005543 Ga0070672_100006785 Ga0070672_1000067853 397
326 3300013306 Ga0163162_10157925 Ga0163162_101579253 397
327 3300014969 Ga0157376_10031341 Ga0157376_100313411 397
328 3300025315 Ga0207697_10002714 Ga0207697_100027142 397
329 3300025903 Ga0207680_10049884 Ga0207680_100498842 397
330 3300025907 Ga0207645_10007585 Ga0207645_100075858 397
331 3300025940 Ga0207691_10003206 Ga0207691_100032066 397
332 3300026121 Ga0207683_10007015 Ga0207683_100070157 397
333 3300005468 Ga0070707_100190734 Ga0070707_1001907342 399
334 3300005471 Ga0070698_100017365 Ga0070698_1000173655 403
335 3300026121 Ga0207683_10017751 Ga0207683_100177514 403
336 3300009147 Ga0114129_10175674 Ga0114129_101756742 404
337 3300009553 Ga0105249_10194318 Ga0105249_101943182 404
338 3300013105 Ga0157369_10093864 Ga0157369_100938644 404
339 3300015262 Ga0182007_10042462 Ga0182007_100424622 404
340 3300025929 Ga0207664_10031523 Ga0207664_100315234 404
341 3300025939 Ga0207665_10002528 Ga0207665_100025287 404
342 3300046454 Ga0495592_0018248 Ga0495592_0018248_540_1754 404
343 3300046473 Ga0495582_0036650 Ga0495582_0036650_231_1445 404
344 3300046476 Ga0495662_0084678 Ga0495662_0084678_57_1271 404
345 3300046516 Ga0495628_0021231 Ga0495628_0021231_3430_4644 404
346 3300046536 Ga0495587_0046149 Ga0495587_0046149_1081_2295 404
347 3300046683 Ga0495658_0123193 Ga0495658_0123193_212_1426 404
348 3300047444 Ga0495675_0100003 Ga0495675_0100003_333_1547 404
349 3300050507 nmdc:mga05p37_143168_c1 nmdc:mga05p37_143168_c1_782_2032 404
350 3300053077 Ga0495601_0066573 Ga0495601_0066573_378_1592 404
351 3300000545 CNXas_1000022 CNXas_100002219 405

Structural Annotation

Top 5 Hits

ID Description Score Start End
8evy-assembly1.cif.gz_B ddlb from pseudomonas aeruginosa pao1 in complex with atp and d-ala-d-ala 0.7139 20 59
4egq-assembly5.cif.gz_B-3 crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei 0.7097 20 57
4egq-assembly5.cif.gz_C crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei 0.7085 20 57
4egj-assembly5.cif.gz_A crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans 0.7057 20 57
6wg9-assembly2.cif.gz_B crystal structure of tetracycline destructase tet(x7) 0.7032 19 59
ID Description Score Start End Superfamily
af_A0A0R0EIF9_8_114_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7336 324 401 3.40.50.2000
af_Q8H191_31_475_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7279 22 61 3.50.50.60
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7098 208 386 3.40.50.2000
af_P96407_190_356_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.699 208 386 3.40.50.2000
af_E0AHD3_2_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6898 20 61 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7V9ETQ1-F1-model_v4 Glycosyltransferase 0.9893 16 405 GO:0016020
GO:0016740
AF-A0A7V9ETQ1-F1-model_v4 Glycosyltransferase 0.9868 16 405 GO:0016020
GO:0016740
AF-A0A2V5UU61-F1-model_v4 Glycosyltransferase family 1 protein 0.9847 16 402 GO:0016020
AF-A0A2V6E7N7-F1-model_v4 Glycosyltransferase family 1 protein 0.9815 142 405
AF-A0A7V9MU54-F1-model_v4 Glycosyltransferase family 1 protein 0.9815 16 119

Feature Viewer

pLDDT pTM Quality
91.58 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map