F418616
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 173 | 351 | 389 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10175674|Ga0114129_101756742 |
| Length | 416 |
| Sequence | MLGVGRCTFDVFSSMKRKRIVVIGFMGSMPIAGVVWQHIHYVVGLQRLGHDVFYIEDSARLPYNPETFEVTDEFDYTAKVLARLAREFDFKNRWGYCARYLPGTPTAGMSLKRIRQLYHDAEAILNVCGAQEFNEDLLVSDRILYIESDPGVEQIKIDKGIRSTVEYLRRHRALFTFGENIGTKDFPVPLHGFKWLPTRQPVVTDLWKTTRSPALCPTHSVAAESSRAAVFTTIANWSTSGLKDITWRGKKYLWSKSREFLRFIVAPKKARETFEMATNIDDTNTRRKFEQKGWRLASPLQLSVDYWLYRDYIQRSKGEFTVAKDQYVRLNTGWFSDRSACYLAAGRPVITQETGFVKNYGGKKGLLSFRTVEEVADAVKRINADYAKHSRAARDVAREIFEAETVLKSVLDRAGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 128 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 129 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 130 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 134 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 135 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 139 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 160 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 164 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.98 |
| Rhizosphere | 93.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000022 | 3300000545 | Bacteria | 32122 |
| 2 | JGI24035J26624_1000642 | 3300002126 | Bacteria | 3236 |
| 3 | JGI24035J26624_1001249 | 3300002126 | Bacteria | 2418 |
| 4 | JGI25406J46586_10000003 | 3300003203 | Bacteria | 161718 |
| 5 | JGI25405J52794_10000430 | 3300003911 | Bacteria | 5915 |
| 6 | JGI25405J52794_10000820 | 3300003911 | Bacteria | 4832 |
| 7 | Ga0065712_10023624 | 3300005290 | Bacteria | 1539 |
| 8 | Ga0065712_10137148 | 3300005290 | Bacteria | 1485 |
| 9 | Ga0065715_10001311 | 3300005293 | Bacteria | 6540 |
| 10 | Ga0065715_10129084 | 3300005293 | Unclassified | 2052 |
| 11 | Ga0065707_10004363 | 3300005295 | Bacteria | 3246 |
| 12 | Ga0065707_10006784 | 3300005295 | Bacteria | 5005 |
| 13 | Ga0070676_10001580 | 3300005328 | Bacteria | 11578 |
| 14 | Ga0070676_10034826 | 3300005328 | Bacteria | 2892 |
| 15 | Ga0070683_100017436 | 3300005329 | Bacteria | 6347 |
| 16 | Ga0070683_100021122 | 3300005329 | Bacteria | 5806 |
| 17 | Ga0070683_100123081 | 3300005329 | Bacteria | 2451 |
| 18 | Ga0070690_100012629 | 3300005330 | Bacteria | 4972 |
| 19 | Ga0070690_100194367 | 3300005330 | Unclassified | 1408 |
| 20 | Ga0070670_100008797 | 3300005331 | Bacteria | 8617 |
| 21 | Ga0070670_100132551 | 3300005331 | Unclassified | 2152 |
| 22 | Ga0070666_10093584 | 3300005335 | Unclassified | 2066 |
| 23 | Ga0068868_100146061 | 3300005338 | Bacteria | 1945 |
| 24 | Ga0068868_100147835 | 3300005338 | Bacteria | 1933 |
| 25 | Ga0068868_100226555 | 3300005338 | Unclassified | 1567 |
| 26 | Ga0070689_100001968 | 3300005340 | Bacteria | 13326 |
| 27 | Ga0070689_100155887 | 3300005340 | Bacteria | 1844 |
| 28 | Ga0070687_100009468 | 3300005343 | Bacteria | 4176 |
| 29 | Ga0070668_100095561 | 3300005347 | Bacteria | 2348 |
| 30 | Ga0070668_100096530 | 3300005347 | Bacteria | 2336 |
| 31 | Ga0070668_100118145 | 3300005347 | Unclassified | 2116 |
| 32 | Ga0070669_100003462 | 3300005353 | Bacteria | 11380 |
| 33 | Ga0070669_100020820 | 3300005353 | Bacteria | 4686 |
| 34 | Ga0070669_100053461 | 3300005353 | Bacteria | 2956 |
| 35 | Ga0070675_100026047 | 3300005354 | Unclassified | 4690 |
| 36 | Ga0070675_100031549 | 3300005354 | Bacteria | 4284 |
| 37 | Ga0070675_100052100 | 3300005354 | Bacteria | 3364 |
| 38 | Ga0070675_100068535 | 3300005354 | Bacteria | 2938 |
| 39 | Ga0070675_100083834 | 3300005354 | Bacteria | 2661 |
| 40 | Ga0070675_100315196 | 3300005354 | Unclassified | 1381 |
| 41 | Ga0070671_100065607 | 3300005355 | Bacteria | 3024 |
| 42 | Ga0070671_100163596 | 3300005355 | Bacteria | 1881 |
| 43 | Ga0070671_100290860 | 3300005355 | Unclassified | 1390 |
| 44 | Ga0070674_100054123 | 3300005356 | Bacteria | 2774 |
| 45 | Ga0070674_100145326 | 3300005356 | Unclassified | 1784 |
| 46 | Ga0070673_100044222 | 3300005364 | Unclassified | 3447 |
| 47 | Ga0070673_100274924 | 3300005364 | Unclassified | 1475 |
| 48 | Ga0070688_100001230 | 3300005365 | Bacteria | 12784 |
| 49 | Ga0070688_100067182 | 3300005365 | Bacteria | 2283 |
| 50 | Ga0070659_100001289 | 3300005366 | Bacteria | 18164 |
| 51 | Ga0070667_100007261 | 3300005367 | Bacteria | 9207 |
| 52 | Ga0070667_100015277 | 3300005367 | Bacteria | 6346 |
| 53 | Ga0070667_100300646 | 3300005367 | Unclassified | 1445 |
| 54 | Ga0070711_100020523 | 3300005439 | Unclassified | 4259 |
| 55 | Ga0070711_100023831 | 3300005439 | Unclassified | 3986 |
| 56 | Ga0070711_100042168 | 3300005439 | Bacteria | 3083 |
| 57 | Ga0070705_100011555 | 3300005440 | Unclassified | 4459 |
| 58 | Ga0070705_100043504 | 3300005440 | Bacteria | 2574 |
| 59 | Ga0070700_100009585 | 3300005441 | Bacteria | 5320 |
| 60 | Ga0070694_100005026 | 3300005444 | Bacteria | 7980 |
| 61 | Ga0070708_100018410 | 3300005445 | Bacteria | 5846 |
| 62 | Ga0070708_100048394 | 3300005445 | Bacteria | 3758 |
| 63 | Ga0070708_100053934 | 3300005445 | Bacteria | 3569 |
| 64 | Ga0070708_100093801 | 3300005445 | Bacteria | 2737 |
| 65 | Ga0070708_100146884 | 3300005445 | Bacteria | 2191 |
| 66 | Ga0070708_100200299 | 3300005445 | Bacteria | 1869 |
| 67 | Ga0070663_100099453 | 3300005455 | Bacteria | 2168 |
| 68 | Ga0070662_100011871 | 3300005457 | Bacteria | 5760 |
| 69 | Ga0070662_100148533 | 3300005457 | Bacteria | 1822 |
| 70 | Ga0070681_10138177 | 3300005458 | Unclassified | 2366 |
| 71 | Ga0068867_100016841 | 3300005459 | Bacteria | 5195 |
| 72 | Ga0070685_10017556 | 3300005466 | Unclassified | 3832 |
| 73 | Ga0070685_10111460 | 3300005466 | Bacteria | 1686 |
| 74 | Ga0070706_100000210 | 3300005467 | Bacteria | 71893 |
| 75 | Ga0070706_100006044 | 3300005467 | Bacteria | 11439 |
| 76 | Ga0070706_100007139 | 3300005467 | Bacteria | 10508 |
| 77 | Ga0070706_100007665 | 3300005467 | Bacteria | 10095 |
| 78 | Ga0070706_100008800 | 3300005467 | Bacteria | 9408 |
| 79 | Ga0070706_100041805 | 3300005467 | Bacteria | 4233 |
| 80 | Ga0070707_100021135 | 3300005468 | Bacteria | 6149 |
| 81 | Ga0070707_100026721 | 3300005468 | Bacteria | 5483 |
| 82 | Ga0070707_100027105 | 3300005468 | Bacteria | 5448 |
| 83 | Ga0070707_100050972 | 3300005468 | Unclassified | 3968 |
| 84 | Ga0070707_100102606 | 3300005468 | Unclassified | 2771 |
| 85 | Ga0070707_100128358 | 3300005468 | Bacteria | 2464 |
| 86 | Ga0070707_100190734 | 3300005468 | Bacteria | 1998 |
| 87 | Ga0070707_100294934 | 3300005468 | Unclassified | 1576 |
| 88 | Ga0070698_100006879 | 3300005471 | Bacteria | 12320 |
| 89 | Ga0070698_100017365 | 3300005471 | Bacteria | 7583 |
| 90 | Ga0070698_100028705 | 3300005471 | Bacteria | 5776 |
| 91 | Ga0070698_100183600 | 3300005471 | Bacteria | 2030 |
| 92 | Ga0070698_100192731 | 3300005471 | Unclassified | 1975 |
| 93 | Ga0070699_100069751 | 3300005518 | Bacteria | 3055 |
| 94 | Ga0070699_100133515 | 3300005518 | Bacteria | 2189 |
| 95 | Ga0070699_100270895 | 3300005518 | Unclassified | 1520 |
| 96 | Ga0070679_100035110 | 3300005530 | Bacteria | 4973 |
| 97 | Ga0070684_100000274 | 3300005535 | Bacteria | 35734 |
| 98 | Ga0070684_100005213 | 3300005535 | Bacteria | 9940 |
| 99 | Ga0070684_100100697 | 3300005535 | Bacteria | 2580 |
| 100 | Ga0070697_100004643 | 3300005536 | Bacteria | 10540 |
| 101 | Ga0070697_100008638 | 3300005536 | Bacteria | 7956 |
| 102 | Ga0070697_100019236 | 3300005536 | Bacteria | 5393 |
| 103 | Ga0070697_100024646 | 3300005536 | Bacteria | 4791 |
| 104 | Ga0070697_100108745 | 3300005536 | Bacteria | 2308 |
| 105 | Ga0070697_100153432 | 3300005536 | Bacteria | 1943 |
| 106 | Ga0070697_100350564 | 3300005536 | Unclassified | 1275 |
| 107 | Ga0070672_100006785 | 3300005543 | Bacteria | 7731 |
| 108 | Ga0070672_100028047 | 3300005543 | Unclassified | 4207 |
| 109 | Ga0070672_100172620 | 3300005543 | Bacteria | 1799 |
| 110 | Ga0070672_100178601 | 3300005543 | Unclassified | 1768 |
| 111 | Ga0070665_100012314 | 3300005548 | Bacteria | 8619 |
| 112 | Ga0070665_100022020 | 3300005548 | Bacteria | 6412 |
| 113 | Ga0070665_100037716 | 3300005548 | Bacteria | 4859 |
| 114 | Ga0070704_100002448 | 3300005549 | Bacteria | 10421 |
| 115 | Ga0070664_100239775 | 3300005564 | Bacteria | 1627 |
| 116 | Ga0068856_100025130 | 3300005614 | Bacteria | 5804 |
| 117 | Ga0070702_100029734 | 3300005615 | Bacteria | 2974 |
| 118 | Ga0068861_100085995 | 3300005719 | Bacteria | 2471 |
| 119 | Ga0068861_100298141 | 3300005719 | Unclassified | 1395 |
| 120 | Ga0068863_100027730 | 3300005841 | Bacteria | 5404 |
| 121 | Ga0068858_100008388 | 3300005842 | Bacteria | 9939 |
| 122 | Ga0068860_100159897 | 3300005843 | Bacteria | 2172 |
| 123 | Ga0068860_100316949 | 3300005843 | Bacteria | 1530 |
| 124 | Ga0081455_10000314 | 3300005937 | Bacteria | 63484 |
| 125 | Ga0081455_10003842 | 3300005937 | Bacteria | 17128 |
| 126 | Ga0081455_10004746 | 3300005937 | Bacteria | 15106 |
| 127 | Ga0081455_10010007 | 3300005937 | Bacteria | 9693 |
| 128 | Ga0081455_10016014 | 3300005937 | Bacteria | 7255 |
| 129 | Ga0081540_1000111 | 3300005983 | Bacteria | 86926 |
| 130 | Ga0081539_10000077 | 3300005985 | Bacteria | 228125 |
| 131 | Ga0081539_10001712 | 3300005985 | Bacteria | 35198 |
| 132 | Ga0081539_10028069 | 3300005985 | Bacteria | 3547 |
| 133 | Ga0081539_10037123 | 3300005985 | Bacteria | 2905 |
| 134 | Ga0070717_10002291 | 3300006028 | Bacteria | 13425 |
| 135 | Ga0070717_10017212 | 3300006028 | Bacteria | 5619 |
| 136 | Ga0070717_10075783 | 3300006028 | Unclassified | 2814 |
| 137 | Ga0070715_10043170 | 3300006163 | Unclassified | 1899 |
| 138 | Ga0070716_100010532 | 3300006173 | Unclassified | 4638 |
| 139 | Ga0070712_100005167 | 3300006175 | Bacteria | 8074 |
| 140 | Ga0070712_100059829 | 3300006175 | Bacteria | 2684 |
| 141 | Ga0070712_100070525 | 3300006175 | Bacteria | 2497 |
| 142 | Ga0070712_100104742 | 3300006175 | Bacteria | 2100 |
| 143 | Ga0097621_100117090 | 3300006237 | Unclassified | 2257 |
| 144 | Ga0097621_100156066 | 3300006237 | Bacteria | 1959 |
| 145 | Ga0068871_100127695 | 3300006358 | Bacteria | 2153 |
| 146 | Ga0075428_100337041 | 3300006844 | Bacteria | 1620 |
| 147 | Ga0075428_100349402 | 3300006844 | Bacteria | 1587 |
| 148 | Ga0075434_100240770 | 3300006871 | Bacteria | 1829 |
| 149 | Ga0075434_100256392 | 3300006871 | Bacteria | 1768 |
| 150 | Ga0075434_100436980 | 3300006871 | Bacteria | 1330 |
| 151 | Ga0068865_100048220 | 3300006881 | Bacteria | 2930 |
| 152 | Ga0075436_100025743 | 3300006914 | Bacteria | 4049 |
| 153 | Ga0105240_10000041 | 3300009093 | Bacteria | 264078 |
| 154 | Ga0111539_10401434 | 3300009094 | Unclassified | 1596 |
| 155 | Ga0105245_10110938 | 3300009098 | Bacteria | 2551 |
| 156 | Ga0105245_10137785 | 3300009098 | Unclassified | 2295 |
| 157 | Ga0114129_10006405 | 3300009147 | Bacteria | 16690 |
| 158 | Ga0114129_10175674 | 3300009147 | Unclassified | 2917 |
| 159 | Ga0114129_10396216 | 3300009147 | Bacteria | 1820 |
| 160 | Ga0105243_10128913 | 3300009148 | Bacteria | 2144 |
| 161 | Ga0105241_10232717 | 3300009174 | Bacteria | 1554 |
| 162 | Ga0105242_10039142 | 3300009176 | Unclassified | 3815 |
| 163 | Ga0105242_10081128 | 3300009176 | Bacteria | 2712 |
| 164 | Ga0105237_10151145 | 3300009545 | Bacteria | 2318 |
| 165 | Ga0105249_10002167 | 3300009553 | Bacteria | 17013 |
| 166 | Ga0105249_10194318 | 3300009553 | Bacteria | 1982 |
| 167 | Ga0105239_10126623 | 3300010375 | Unclassified | 2839 |
| 168 | Ga0105239_10264879 | 3300010375 | Bacteria | 1932 |
| 169 | Ga0157369_10093864 | 3300013105 | Bacteria | 3203 |
| 170 | Ga0157374_10029524 | 3300013296 | Bacteria | 4967 |
| 171 | Ga0157374_10057560 | 3300013296 | Bacteria | 3631 |
| 172 | Ga0157374_10057848 | 3300013296 | Bacteria | 3622 |
| 173 | Ga0157374_10088033 | 3300013296 | Bacteria | 2957 |
| 174 | Ga0157374_10103080 | 3300013296 | Bacteria | 2737 |
| 175 | Ga0157374_10119935 | 3300013296 | Bacteria | 2537 |
| 176 | Ga0157374_10230327 | 3300013296 | Bacteria | 1820 |
| 177 | Ga0157374_10261494 | 3300013296 | Unclassified | 1704 |
| 178 | Ga0157378_10043161 | 3300013297 | Bacteria | 4003 |
| 179 | Ga0157378_10118511 | 3300013297 | Bacteria | 2437 |
| 180 | Ga0163162_10006422 | 3300013306 | Bacteria | 11386 |
| 181 | Ga0163162_10055301 | 3300013306 | Bacteria | 3995 |
| 182 | Ga0163162_10069068 | 3300013306 | Unclassified | 3586 |
| 183 | Ga0163162_10142889 | 3300013306 | Bacteria | 2507 |
| 184 | Ga0163162_10157925 | 3300013306 | Unclassified | 2389 |
| 185 | Ga0163162_10202872 | 3300013306 | Bacteria | 2112 |
| 186 | Ga0163162_10236345 | 3300013306 | Bacteria | 1958 |
| 187 | Ga0163162_10253576 | 3300013306 | Bacteria | 1891 |
| 188 | Ga0157372_10094722 | 3300013307 | Bacteria | 3401 |
| 189 | Ga0157372_10435329 | 3300013307 | Unclassified | 1528 |
| 190 | Ga0157375_10002340 | 3300013308 | Bacteria | 16367 |
| 191 | Ga0157375_10032485 | 3300013308 | Bacteria | 4951 |
| 192 | Ga0157375_10072350 | 3300013308 | Unclassified | 3464 |
| 193 | Ga0157375_10089349 | 3300013308 | Bacteria | 3137 |
| 194 | Ga0157375_10379759 | 3300013308 | Bacteria | 1580 |
| 195 | Ga0163163_10175778 | 3300014325 | Bacteria | 2188 |
| 196 | Ga0163163_10259057 | 3300014325 | Bacteria | 1790 |
| 197 | Ga0157379_10002419 | 3300014968 | Bacteria | 15611 |
| 198 | Ga0157376_10013545 | 3300014969 | Bacteria | 6090 |
| 199 | Ga0157376_10031341 | 3300014969 | Bacteria | 4256 |
| 200 | Ga0157376_10085185 | 3300014969 | Bacteria | 2723 |
| 201 | Ga0157376_10106062 | 3300014969 | Bacteria | 2465 |
| 202 | Ga0157376_10127235 | 3300014969 | Bacteria | 2268 |
| 203 | Ga0157376_10173686 | 3300014969 | Bacteria | 1964 |
| 204 | Ga0182007_10042462 | 3300015262 | Bacteria | 1513 |
| 205 | Ga0163161_10039191 | 3300017792 | Bacteria | 3401 |
| 206 | Ga0207666_1000200 | 3300025271 | Bacteria | 8918 |
| 207 | Ga0207697_10000048 | 3300025315 | Bacteria | 47739 |
| 208 | Ga0207697_10000154 | 3300025315 | Bacteria | 34024 |
| 209 | Ga0207697_10001979 | 3300025315 | Bacteria | 10862 |
| 210 | Ga0207697_10002714 | 3300025315 | Bacteria | 9034 |
| 211 | Ga0207697_10026069 | 3300025315 | Unclassified | 2390 |
| 212 | Ga0207688_10006813 | 3300025901 | Bacteria | 6218 |
| 213 | Ga0207680_10049884 | 3300025903 | Bacteria | 2494 |
| 214 | Ga0207699_10008493 | 3300025906 | Bacteria | 5073 |
| 215 | Ga0207645_10000452 | 3300025907 | Bacteria | 34086 |
| 216 | Ga0207645_10003126 | 3300025907 | Bacteria | 12688 |
| 217 | Ga0207645_10007585 | 3300025907 | Bacteria | 7648 |
| 218 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 219 | Ga0207684_10011607 | 3300025910 | Bacteria | 7697 |
| 220 | Ga0207684_10014850 | 3300025910 | Bacteria | 6703 |
| 221 | Ga0207684_10016531 | 3300025910 | Bacteria | 6334 |
| 222 | Ga0207684_10030911 | 3300025910 | Unclassified | 4558 |
| 223 | Ga0207684_10032803 | 3300025910 | Bacteria | 4416 |
| 224 | Ga0207684_10066160 | 3300025910 | Bacteria | 3069 |
| 225 | Ga0207684_10085281 | 3300025910 | Bacteria | 2691 |
| 226 | Ga0207695_10000125 | 3300025913 | Bacteria | 228810 |
| 227 | Ga0207693_10002954 | 3300025915 | Bacteria | 14720 |
| 228 | Ga0207693_10010972 | 3300025915 | Bacteria | 7342 |
| 229 | Ga0207693_10024152 | 3300025915 | Bacteria | 4827 |
| 230 | Ga0207693_10094311 | 3300025915 | Bacteria | 2346 |
| 231 | Ga0207663_10008736 | 3300025916 | Bacteria | 5321 |
| 232 | Ga0207663_10024432 | 3300025916 | Unclassified | 3480 |
| 233 | Ga0207663_10032014 | 3300025916 | Bacteria | 3118 |
| 234 | Ga0207663_10164696 | 3300025916 | Unclassified | 1569 |
| 235 | Ga0207662_10000206 | 3300025918 | Bacteria | 27413 |
| 236 | Ga0207646_10017435 | 3300025922 | Bacteria | 6720 |
| 237 | Ga0207646_10052743 | 3300025922 | Bacteria | 3639 |
| 238 | Ga0207646_10111772 | 3300025922 | Unclassified | 2452 |
| 239 | Ga0207681_10057718 | 3300025923 | Unclassified | 2654 |
| 240 | Ga0207650_10085759 | 3300025925 | Bacteria | 2396 |
| 241 | Ga0207650_10137126 | 3300025925 | Unclassified | 1920 |
| 242 | Ga0207659_10028524 | 3300025926 | Bacteria | 3794 |
| 243 | Ga0207659_10050237 | 3300025926 | Bacteria | 2962 |
| 244 | Ga0207659_10050564 | 3300025926 | Bacteria | 2953 |
| 245 | Ga0207664_10031523 | 3300025929 | Bacteria | 4056 |
| 246 | Ga0207664_10315212 | 3300025929 | Bacteria | 1379 |
| 247 | Ga0207644_10135650 | 3300025931 | Bacteria | 1889 |
| 248 | Ga0207644_10186591 | 3300025931 | Unclassified | 1628 |
| 249 | Ga0207690_10007947 | 3300025932 | Bacteria | 6298 |
| 250 | Ga0207706_10000716 | 3300025933 | Bacteria | 34628 |
| 251 | Ga0207706_10074082 | 3300025933 | Bacteria | 2994 |
| 252 | Ga0207706_10109941 | 3300025933 | Unclassified | 2425 |
| 253 | Ga0207686_10002573 | 3300025934 | Bacteria | 9865 |
| 254 | Ga0207686_10075020 | 3300025934 | Bacteria | 2188 |
| 255 | Ga0207670_10010861 | 3300025936 | Bacteria | 5256 |
| 256 | Ga0207670_10218579 | 3300025936 | Bacteria | 1457 |
| 257 | Ga0207669_10061459 | 3300025937 | Unclassified | 2308 |
| 258 | Ga0207704_10067497 | 3300025938 | Unclassified | 2250 |
| 259 | Ga0207665_10002528 | 3300025939 | Bacteria | 12311 |
| 260 | Ga0207665_10020666 | 3300025939 | Bacteria | 4328 |
| 261 | Ga0207665_10079030 | 3300025939 | Bacteria | 2261 |
| 262 | Ga0207691_10003206 | 3300025940 | Bacteria | 15956 |
| 263 | Ga0207691_10011980 | 3300025940 | Bacteria | 8317 |
| 264 | Ga0207691_10015062 | 3300025940 | Bacteria | 7359 |
| 265 | Ga0207691_10162666 | 3300025940 | Bacteria | 1957 |
| 266 | Ga0207691_10292794 | 3300025940 | Unclassified | 1400 |
| 267 | Ga0207689_10322769 | 3300025942 | Unclassified | 1281 |
| 268 | Ga0207661_10013451 | 3300025944 | Bacteria | 5977 |
| 269 | Ga0207679_10029745 | 3300025945 | Bacteria | 3806 |
| 270 | Ga0207679_10202194 | 3300025945 | Unclassified | 1660 |
| 271 | Ga0207712_10063758 | 3300025961 | Bacteria | 2624 |
| 272 | Ga0207668_10005212 | 3300025972 | Bacteria | 7649 |
| 273 | Ga0207668_10055158 | 3300025972 | Bacteria | 2761 |
| 274 | Ga0207668_10112890 | 3300025972 | Unclassified | 2042 |
| 275 | Ga0207658_10073739 | 3300025986 | Unclassified | 2591 |
| 276 | Ga0207658_10077310 | 3300025986 | Bacteria | 2539 |
| 277 | Ga0207677_10170522 | 3300026023 | Unclassified | 1701 |
| 278 | Ga0207703_10004493 | 3300026035 | Bacteria | 11452 |
| 279 | Ga0207678_10123752 | 3300026067 | Bacteria | 2207 |
| 280 | Ga0207641_10039433 | 3300026088 | Bacteria | 3950 |
| 281 | Ga0207648_10120137 | 3300026089 | Bacteria | 2310 |
| 282 | Ga0207675_100065813 | 3300026118 | Bacteria | 3387 |
| 283 | Ga0207683_10007015 | 3300026121 | Bacteria | 9662 |
| 284 | Ga0207683_10017751 | 3300026121 | Bacteria | 6068 |
| 285 | Ga0207683_10156633 | 3300026121 | Bacteria | 2058 |
| 286 | Ga0268266_10209166 | 3300028379 | Unclassified | 1788 |
| 287 | Ga0268265_10045446 | 3300028380 | Bacteria | 3277 |
| 288 | Ga0268264_10117216 | 3300028381 | Unclassified | 2342 |
| 289 | Ga0307513_10020758 | 3300031456 | Bacteria | 7775 |
| 290 | Ga0373944_0041227 | 3300035089 | Bacteria | 1428 |
| 291 | Ga0373936_0060796 | 3300035113 | Unclassified | 1542 |
| 292 | Ga0373955_0018375 | 3300035172 | Bacteria | 3476 |
| 293 | Ga0316574_0088726 | 3300035398 | Bacteria | 1970 |
| 294 | Ga0373931_0028909 | 3300035691 | Unclassified | 2842 |
| 295 | Ga0373931_0041269 | 3300035691 | Unclassified | 2424 |
| 296 | Ga0373927_0024281 | 3300035695 | Bacteria | 3966 |
| 297 | Ga0373927_0043959 | 3300035695 | Bacteria | 2891 |
| 298 | Ga0373947_0014374 | 3300035725 | Bacteria | 4541 |
| 299 | Ga0373937_0019229 | 3300036401 | Bacteria | 6115 |
| 300 | Ga0373937_0121938 | 3300036401 | Bacteria | 2430 |
| 301 | Ga0395898_0021566 | 3300037466 | Bacteria | 6530 |
| 302 | Ga0395901_0007215 | 3300038443 | Bacteria | 11207 |
| 303 | Ga0395901_0111343 | 3300038443 | Bacteria | 2875 |
| 304 | Ga0395901_0382234 | 3300038443 | Bacteria | 1449 |
| 305 | Ga0451576_0255369 | 3300045051 | Bacteria | 1832 |
| 306 | Ga0495592_0018248 | 3300046454 | Bacteria | 5333 |
| 307 | Ga0495651_0059235 | 3300046462 | Bacteria | 2937 |
| 308 | Ga0495653_0162424 | 3300046463 | Bacteria | 1550 |
| 309 | Ga0495582_0036650 | 3300046473 | Unclassified | 2698 |
| 310 | Ga0495662_0084678 | 3300046476 | Bacteria | 1543 |
| 311 | Ga0495628_0021231 | 3300046516 | Bacteria | 5345 |
| 312 | Ga0495630_0074018 | 3300046517 | Bacteria | 2565 |
| 313 | Ga0495652_0080322 | 3300046529 | Bacteria | 2694 |
| 314 | Ga0495640_0197658 | 3300046533 | Bacteria | 1275 |
| 315 | Ga0495586_0034251 | 3300046535 | Bacteria | 2727 |
| 316 | Ga0495587_0046149 | 3300046536 | Unclassified | 2587 |
| 317 | Ga0495659_0024540 | 3300046664 | Bacteria | 2057 |
| 318 | Ga0495647_0058714 | 3300046681 | Bacteria | 1513 |
| 319 | Ga0495658_0062068 | 3300046683 | Unclassified | 2148 |
| 320 | Ga0495658_0123193 | 3300046683 | Bacteria | 1570 |
| 321 | Ga0495669_0006499 | 3300046684 | Unclassified | 4885 |
| 322 | Ga0495624_0062603 | 3300046690 | Bacteria | 2327 |
| 323 | Ga0495600_0181685 | 3300046809 | Bacteria | 1356 |
| 324 | Ga0495675_0100003 | 3300047444 | Bacteria | 1816 |
| 325 | Ga0495684_0089618 | 3300047471 | Bacteria | 2330 |
| 326 | Ga0496101_0007385 | 3300048904 | Bacteria | 7119 |
| 327 | Ga0496101_0023992 | 3300048904 | Unclassified | 4219 |
| 328 | Ga0496102_0107672 | 3300048905 | Unclassified | 2595 |
| 329 | Ga0496103_0070587 | 3300048906 | Unclassified | 2185 |
| 330 | Ga0496104_0104448 | 3300048907 | Bacteria | 2714 |
| 331 | Ga0496104_0265689 | 3300048907 | Bacteria | 1628 |
| 332 | Ga0496105_0015096 | 3300048908 | Bacteria | 6148 |
| 333 | Ga0496107_0024301 | 3300048910 | Bacteria | 4287 |
| 334 | Ga0496108_0035884 | 3300048911 | Unclassified | 4124 |
| 335 | Ga0496108_0207088 | 3300048911 | Unclassified | 1702 |
| 336 | Ga0496108_0342972 | 3300048911 | Unclassified | 1303 |
| 337 | Ga0496109_0044121 | 3300048912 | Bacteria | 4044 |
| 338 | Ga0496109_0100859 | 3300048912 | Bacteria | 2679 |
| 339 | Ga0496109_0195582 | 3300048912 | Bacteria | 1901 |
| 340 | Ga0496109_0240809 | 3300048912 | Unclassified | 1703 |
| 341 | Ga0496112_0096488 | 3300048915 | Bacteria | 2927 |
| 342 | Ga0496112_0138767 | 3300048915 | Bacteria | 2401 |
| 343 | Ga0496113_0053986 | 3300048916 | Bacteria | 3006 |
| 344 | Ga0496114_0057982 | 3300048917 | Bacteria | 3233 |
| 345 | Ga0496115_0009602 | 3300048918 | Bacteria | 7193 |
| 346 | Ga0496115_0130456 | 3300048918 | Bacteria | 2071 |
| 347 | nmdc:mga05p37_143168_c1 | 3300050507 | Unclassified | 2928 |
| 348 | nmdc:mga05p37_9008_c1 | 3300050507 | Bacteria | 11803 |
| 349 | nmdc:mga0n895_377271_c1 | 3300050512 | Bacteria | 1435 |
| 350 | nmdc:mga08x19_67323_c1 | 3300050514 | Unclassified | 2329 |
| 351 | Ga0495601_0066573 | 3300053077 | Bacteria | 2293 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100048394 | Ga0070708_1000483942 | 355 |
| 2 | 3300005467 | Ga0070706_100007665 | Ga0070706_1000076654 | 355 |
| 3 | 3300005536 | Ga0070697_100004643 | Ga0070697_1000046439 | 355 |
| 4 | 3300025910 | Ga0207684_10014850 | Ga0207684_100148504 | 355 |
| 5 | 3300025922 | Ga0207646_10052743 | Ga0207646_100527432 | 355 |
| 6 | 3300005295 | Ga0065707_10004363 | Ga0065707_100043633 | 370 |
| 7 | 3300006844 | Ga0075428_100337041 | Ga0075428_1003370411 | 372 |
| 8 | 3300005295 | Ga0065707_10006784 | Ga0065707_100067843 | 374 |
| 9 | 3300025933 | Ga0207706_10109941 | Ga0207706_101099412 | 374 |
| 10 | 3300035695 | Ga0373927_0043959 | Ga0373927_0043959_1476_2648 | 374 |
| 11 | 3300046664 | Ga0495659_0024540 | Ga0495659_0024540_664_1836 | 374 |
| 12 | 3300046684 | Ga0495669_0006499 | Ga0495669_0006499_3348_4520 | 374 |
| 13 | 3300006871 | Ga0075434_100256392 | Ga0075434_1002563922 | 375 |
| 14 | 3300005293 | Ga0065715_10129084 | Ga0065715_101290841 | 379 |
| 15 | 3300025940 | Ga0207691_10292794 | Ga0207691_102927941 | 380 |
| 16 | 3300003911 | JGI25405J52794_10000820 | JGI25405J52794_100008201 | 382 |
| 17 | 3300005340 | Ga0070689_100001968 | Ga0070689_1000019689 | 382 |
| 18 | 3300005354 | Ga0070675_100068535 | Ga0070675_1000685353 | 382 |
| 19 | 3300005355 | Ga0070671_100163596 | Ga0070671_1001635962 | 382 |
| 20 | 3300005356 | Ga0070674_100145326 | Ga0070674_1001453262 | 382 |
| 21 | 3300005365 | Ga0070688_100001230 | Ga0070688_1000012307 | 382 |
| 22 | 3300005366 | Ga0070659_100001289 | Ga0070659_10000128910 | 382 |
| 23 | 3300005367 | Ga0070667_100007261 | Ga0070667_1000072612 | 382 |
| 24 | 3300005440 | Ga0070705_100011555 | Ga0070705_1000115552 | 382 |
| 25 | 3300005444 | Ga0070694_100005026 | Ga0070694_1000050262 | 382 |
| 26 | 3300005445 | Ga0070708_100053934 | Ga0070708_1000539342 | 382 |
| 27 | 3300005468 | Ga0070707_100021135 | Ga0070707_1000211352 | 382 |
| 28 | 3300005468 | Ga0070707_100128358 | Ga0070707_1001283581 | 382 |
| 29 | 3300005468 | Ga0070707_100294934 | Ga0070707_1002949341 | 382 |
| 30 | 3300005471 | Ga0070698_100183600 | Ga0070698_1001836001 | 382 |
| 31 | 3300005471 | Ga0070698_100192731 | Ga0070698_1001927312 | 382 |
| 32 | 3300005518 | Ga0070699_100069751 | Ga0070699_1000697512 | 382 |
| 33 | 3300005518 | Ga0070699_100133515 | Ga0070699_1001335152 | 382 |
| 34 | 3300005518 | Ga0070699_100270895 | Ga0070699_1002708951 | 382 |
| 35 | 3300005535 | Ga0070684_100000274 | Ga0070684_1000002749 | 382 |
| 36 | 3300005536 | Ga0070697_100108745 | Ga0070697_1001087451 | 382 |
| 37 | 3300005549 | Ga0070704_100002448 | Ga0070704_1000024488 | 382 |
| 38 | 3300005841 | Ga0068863_100027730 | Ga0068863_1000277305 | 382 |
| 39 | 3300005842 | Ga0068858_100008388 | Ga0068858_1000083889 | 382 |
| 40 | 3300005937 | Ga0081455_10000314 | Ga0081455_1000031427 | 382 |
| 41 | 3300005937 | Ga0081455_10010007 | Ga0081455_100100074 | 382 |
| 42 | 3300005937 | Ga0081455_10016014 | Ga0081455_100160145 | 382 |
| 43 | 3300006028 | Ga0070717_10017212 | Ga0070717_100172125 | 382 |
| 44 | 3300006175 | Ga0070712_100104742 | Ga0070712_1001047422 | 382 |
| 45 | 3300006914 | Ga0075436_100025743 | Ga0075436_1000257433 | 382 |
| 46 | 3300013296 | Ga0157374_10057560 | Ga0157374_100575602 | 382 |
| 47 | 3300025315 | Ga0207697_10001979 | Ga0207697_100019796 | 382 |
| 48 | 3300025910 | Ga0207684_10011607 | Ga0207684_100116072 | 382 |
| 49 | 3300025910 | Ga0207684_10085281 | Ga0207684_100852812 | 382 |
| 50 | 3300025922 | Ga0207646_10111772 | Ga0207646_101117722 | 382 |
| 51 | 3300025926 | Ga0207659_10028524 | Ga0207659_100285243 | 382 |
| 52 | 3300025929 | Ga0207664_10315212 | Ga0207664_103152122 | 382 |
| 53 | 3300025933 | Ga0207706_10074082 | Ga0207706_100740823 | 382 |
| 54 | 3300025934 | Ga0207686_10075020 | Ga0207686_100750202 | 382 |
| 55 | 3300025936 | Ga0207670_10010861 | Ga0207670_100108613 | 382 |
| 56 | 3300025944 | Ga0207661_10013451 | Ga0207661_100134516 | 382 |
| 57 | 3300025961 | Ga0207712_10063758 | Ga0207712_100637584 | 382 |
| 58 | 3300026035 | Ga0207703_10004493 | Ga0207703_100044934 | 382 |
| 59 | 3300026088 | Ga0207641_10039433 | Ga0207641_100394334 | 382 |
| 60 | 3300026118 | Ga0207675_100065813 | Ga0207675_1000658133 | 382 |
| 61 | 3300031456 | Ga0307513_10020758 | Ga0307513_100207582 | 382 |
| 62 | 3300035695 | Ga0373927_0024281 | Ga0373927_0024281_2024_3172 | 382 |
| 63 | 3300035725 | Ga0373947_0014374 | Ga0373947_0014374_3273_4421 | 382 |
| 64 | 3300002126 | JGI24035J26624_1000642 | JGI24035J26624_10006423 | 390 |
| 65 | 3300002126 | JGI24035J26624_1001249 | JGI24035J26624_10012494 | 390 |
| 66 | 3300005290 | Ga0065712_10023624 | Ga0065712_100236242 | 390 |
| 67 | 3300005290 | Ga0065712_10137148 | Ga0065712_101371481 | 390 |
| 68 | 3300005293 | Ga0065715_10001311 | Ga0065715_100013115 | 390 |
| 69 | 3300005328 | Ga0070676_10001580 | Ga0070676_100015803 | 390 |
| 70 | 3300005329 | Ga0070683_100017436 | Ga0070683_1000174363 | 390 |
| 71 | 3300005329 | Ga0070683_100021122 | Ga0070683_1000211224 | 390 |
| 72 | 3300005329 | Ga0070683_100123081 | Ga0070683_1001230812 | 390 |
| 73 | 3300005330 | Ga0070690_100012629 | Ga0070690_1000126294 | 390 |
| 74 | 3300005330 | Ga0070690_100194367 | Ga0070690_1001943671 | 390 |
| 75 | 3300005331 | Ga0070670_100008797 | Ga0070670_1000087974 | 390 |
| 76 | 3300005331 | Ga0070670_100132551 | Ga0070670_1001325511 | 390 |
| 77 | 3300005335 | Ga0070666_10093584 | Ga0070666_100935842 | 390 |
| 78 | 3300005338 | Ga0068868_100146061 | Ga0068868_1001460612 | 390 |
| 79 | 3300005338 | Ga0068868_100147835 | Ga0068868_1001478351 | 390 |
| 80 | 3300005338 | Ga0068868_100226555 | Ga0068868_1002265551 | 390 |
| 81 | 3300005340 | Ga0070689_100155887 | Ga0070689_1001558873 | 390 |
| 82 | 3300005343 | Ga0070687_100009468 | Ga0070687_1000094683 | 390 |
| 83 | 3300005347 | Ga0070668_100095561 | Ga0070668_1000955612 | 390 |
| 84 | 3300005347 | Ga0070668_100096530 | Ga0070668_1000965303 | 390 |
| 85 | 3300005347 | Ga0070668_100118145 | Ga0070668_1001181452 | 390 |
| 86 | 3300005353 | Ga0070669_100020820 | Ga0070669_1000208204 | 390 |
| 87 | 3300005353 | Ga0070669_100053461 | Ga0070669_1000534613 | 390 |
| 88 | 3300005354 | Ga0070675_100026047 | Ga0070675_1000260472 | 390 |
| 89 | 3300005354 | Ga0070675_100031549 | Ga0070675_1000315493 | 390 |
| 90 | 3300005354 | Ga0070675_100052100 | Ga0070675_1000521002 | 390 |
| 91 | 3300005354 | Ga0070675_100083834 | Ga0070675_1000838343 | 390 |
| 92 | 3300005354 | Ga0070675_100315196 | Ga0070675_1003151961 | 390 |
| 93 | 3300005355 | Ga0070671_100065607 | Ga0070671_1000656072 | 390 |
| 94 | 3300005355 | Ga0070671_100290860 | Ga0070671_1002908601 | 390 |
| 95 | 3300005356 | Ga0070674_100054123 | Ga0070674_1000541232 | 390 |
| 96 | 3300005364 | Ga0070673_100044222 | Ga0070673_1000442222 | 390 |
| 97 | 3300005364 | Ga0070673_100274924 | Ga0070673_1002749241 | 390 |
| 98 | 3300005365 | Ga0070688_100067182 | Ga0070688_1000671822 | 390 |
| 99 | 3300005367 | Ga0070667_100015277 | Ga0070667_1000152773 | 390 |
| 100 | 3300005367 | Ga0070667_100300646 | Ga0070667_1003006461 | 390 |
| 101 | 3300005439 | Ga0070711_100020523 | Ga0070711_1000205231 | 390 |
| 102 | 3300005439 | Ga0070711_100023831 | Ga0070711_1000238314 | 390 |
| 103 | 3300005439 | Ga0070711_100042168 | Ga0070711_1000421683 | 390 |
| 104 | 3300005440 | Ga0070705_100043504 | Ga0070705_1000435044 | 390 |
| 105 | 3300005441 | Ga0070700_100009585 | Ga0070700_1000095855 | 390 |
| 106 | 3300005445 | Ga0070708_100018410 | Ga0070708_1000184103 | 390 |
| 107 | 3300005445 | Ga0070708_100093801 | Ga0070708_1000938012 | 390 |
| 108 | 3300005445 | Ga0070708_100146884 | Ga0070708_1001468842 | 390 |
| 109 | 3300005445 | Ga0070708_100200299 | Ga0070708_1002002992 | 390 |
| 110 | 3300005455 | Ga0070663_100099453 | Ga0070663_1000994533 | 390 |
| 111 | 3300005457 | Ga0070662_100011871 | Ga0070662_1000118715 | 390 |
| 112 | 3300005457 | Ga0070662_100148533 | Ga0070662_1001485332 | 390 |
| 113 | 3300005458 | Ga0070681_10138177 | Ga0070681_101381772 | 390 |
| 114 | 3300005459 | Ga0068867_100016841 | Ga0068867_1000168415 | 390 |
| 115 | 3300005466 | Ga0070685_10017556 | Ga0070685_100175562 | 390 |
| 116 | 3300005466 | Ga0070685_10111460 | Ga0070685_101114602 | 390 |
| 117 | 3300005467 | Ga0070706_100000210 | Ga0070706_10000021038 | 390 |
| 118 | 3300005467 | Ga0070706_100006044 | Ga0070706_1000060442 | 390 |
| 119 | 3300005467 | Ga0070706_100007139 | Ga0070706_1000071395 | 390 |
| 120 | 3300005467 | Ga0070706_100008800 | Ga0070706_1000088002 | 390 |
| 121 | 3300005467 | Ga0070706_100041805 | Ga0070706_1000418051 | 390 |
| 122 | 3300005468 | Ga0070707_100026721 | Ga0070707_1000267213 | 390 |
| 123 | 3300005468 | Ga0070707_100027105 | Ga0070707_1000271052 | 390 |
| 124 | 3300005468 | Ga0070707_100050972 | Ga0070707_1000509723 | 390 |
| 125 | 3300005468 | Ga0070707_100102606 | Ga0070707_1001026062 | 390 |
| 126 | 3300005471 | Ga0070698_100006879 | Ga0070698_1000068793 | 390 |
| 127 | 3300005471 | Ga0070698_100028705 | Ga0070698_1000287051 | 390 |
| 128 | 3300005530 | Ga0070679_100035110 | Ga0070679_1000351102 | 390 |
| 129 | 3300005535 | Ga0070684_100005213 | Ga0070684_1000052137 | 390 |
| 130 | 3300005535 | Ga0070684_100100697 | Ga0070684_1001006973 | 390 |
| 131 | 3300005536 | Ga0070697_100008638 | Ga0070697_1000086384 | 390 |
| 132 | 3300005536 | Ga0070697_100019236 | Ga0070697_1000192362 | 390 |
| 133 | 3300005536 | Ga0070697_100024646 | Ga0070697_1000246463 | 390 |
| 134 | 3300005536 | Ga0070697_100153432 | Ga0070697_1001534322 | 390 |
| 135 | 3300005536 | Ga0070697_100350564 | Ga0070697_1003505641 | 390 |
| 136 | 3300005543 | Ga0070672_100028047 | Ga0070672_1000280472 | 390 |
| 137 | 3300005543 | Ga0070672_100172620 | Ga0070672_1001726202 | 390 |
| 138 | 3300005543 | Ga0070672_100178601 | Ga0070672_1001786012 | 390 |
| 139 | 3300005548 | Ga0070665_100012314 | Ga0070665_1000123143 | 390 |
| 140 | 3300005548 | Ga0070665_100022020 | Ga0070665_1000220204 | 390 |
| 141 | 3300005548 | Ga0070665_100037716 | Ga0070665_1000377161 | 390 |
| 142 | 3300005564 | Ga0070664_100239775 | Ga0070664_1002397752 | 390 |
| 143 | 3300005614 | Ga0068856_100025130 | Ga0068856_1000251301 | 390 |
| 144 | 3300005615 | Ga0070702_100029734 | Ga0070702_1000297342 | 390 |
| 145 | 3300005719 | Ga0068861_100085995 | Ga0068861_1000859953 | 390 |
| 146 | 3300005719 | Ga0068861_100298141 | Ga0068861_1002981412 | 390 |
| 147 | 3300005843 | Ga0068860_100159897 | Ga0068860_1001598973 | 390 |
| 148 | 3300005843 | Ga0068860_100316949 | Ga0068860_1003169492 | 390 |
| 149 | 3300005937 | Ga0081455_10003842 | Ga0081455_100038421 | 390 |
| 150 | 3300005937 | Ga0081455_10004746 | Ga0081455_100047469 | 390 |
| 151 | 3300005983 | Ga0081540_1000111 | Ga0081540_10001119 | 390 |
| 152 | 3300005985 | Ga0081539_10028069 | Ga0081539_100280692 | 390 |
| 153 | 3300005985 | Ga0081539_10037123 | Ga0081539_100371233 | 390 |
| 154 | 3300006028 | Ga0070717_10002291 | Ga0070717_100022912 | 390 |
| 155 | 3300006028 | Ga0070717_10075783 | Ga0070717_100757832 | 390 |
| 156 | 3300006163 | Ga0070715_10043170 | Ga0070715_100431702 | 390 |
| 157 | 3300006173 | Ga0070716_100010532 | Ga0070716_1000105322 | 390 |
| 158 | 3300006175 | Ga0070712_100005167 | Ga0070712_1000051674 | 390 |
| 159 | 3300006175 | Ga0070712_100059829 | Ga0070712_1000598293 | 390 |
| 160 | 3300006175 | Ga0070712_100070525 | Ga0070712_1000705252 | 390 |
| 161 | 3300006237 | Ga0097621_100117090 | Ga0097621_1001170903 | 390 |
| 162 | 3300006237 | Ga0097621_100156066 | Ga0097621_1001560662 | 390 |
| 163 | 3300006358 | Ga0068871_100127695 | Ga0068871_1001276951 | 390 |
| 164 | 3300006844 | Ga0075428_100349402 | Ga0075428_1003494022 | 390 |
| 165 | 3300006871 | Ga0075434_100240770 | Ga0075434_1002407702 | 390 |
| 166 | 3300006871 | Ga0075434_100436980 | Ga0075434_1004369801 | 390 |
| 167 | 3300006881 | Ga0068865_100048220 | Ga0068865_1000482203 | 390 |
| 168 | 3300009093 | Ga0105240_10000041 | Ga0105240_1000004145 | 390 |
| 169 | 3300009094 | Ga0111539_10401434 | Ga0111539_104014342 | 390 |
| 170 | 3300009098 | Ga0105245_10110938 | Ga0105245_101109382 | 390 |
| 171 | 3300009098 | Ga0105245_10137785 | Ga0105245_101377851 | 390 |
| 172 | 3300009147 | Ga0114129_10006405 | Ga0114129_1000640512 | 390 |
| 173 | 3300009147 | Ga0114129_10396216 | Ga0114129_103962162 | 390 |
| 174 | 3300009148 | Ga0105243_10128913 | Ga0105243_101289133 | 390 |
| 175 | 3300009174 | Ga0105241_10232717 | Ga0105241_102327172 | 390 |
| 176 | 3300009176 | Ga0105242_10039142 | Ga0105242_100391423 | 390 |
| 177 | 3300009176 | Ga0105242_10081128 | Ga0105242_100811283 | 390 |
| 178 | 3300009545 | Ga0105237_10151145 | Ga0105237_101511452 | 390 |
| 179 | 3300009553 | Ga0105249_10002167 | Ga0105249_100021677 | 390 |
| 180 | 3300010375 | Ga0105239_10126623 | Ga0105239_101266232 | 390 |
| 181 | 3300010375 | Ga0105239_10264879 | Ga0105239_102648792 | 390 |
| 182 | 3300013296 | Ga0157374_10029524 | Ga0157374_100295243 | 390 |
| 183 | 3300013296 | Ga0157374_10057848 | Ga0157374_100578484 | 390 |
| 184 | 3300013296 | Ga0157374_10088033 | Ga0157374_100880332 | 390 |
| 185 | 3300013296 | Ga0157374_10103080 | Ga0157374_101030804 | 390 |
| 186 | 3300013296 | Ga0157374_10119935 | Ga0157374_101199352 | 390 |
| 187 | 3300013296 | Ga0157374_10230327 | Ga0157374_102303272 | 390 |
| 188 | 3300013296 | Ga0157374_10261494 | Ga0157374_102614942 | 390 |
| 189 | 3300013297 | Ga0157378_10043161 | Ga0157378_100431614 | 390 |
| 190 | 3300013297 | Ga0157378_10118511 | Ga0157378_101185112 | 390 |
| 191 | 3300013306 | Ga0163162_10006422 | Ga0163162_100064229 | 390 |
| 192 | 3300013306 | Ga0163162_10055301 | Ga0163162_100553012 | 390 |
| 193 | 3300013306 | Ga0163162_10069068 | Ga0163162_100690684 | 390 |
| 194 | 3300013306 | Ga0163162_10142889 | Ga0163162_101428892 | 390 |
| 195 | 3300013306 | Ga0163162_10202872 | Ga0163162_102028723 | 390 |
| 196 | 3300013306 | Ga0163162_10236345 | Ga0163162_102363452 | 390 |
| 197 | 3300013306 | Ga0163162_10253576 | Ga0163162_102535762 | 390 |
| 198 | 3300013307 | Ga0157372_10094722 | Ga0157372_100947223 | 390 |
| 199 | 3300013307 | Ga0157372_10435329 | Ga0157372_104353292 | 390 |
| 200 | 3300013308 | Ga0157375_10002340 | Ga0157375_100023408 | 390 |
| 201 | 3300013308 | Ga0157375_10032485 | Ga0157375_100324852 | 390 |
| 202 | 3300013308 | Ga0157375_10072350 | Ga0157375_100723505 | 390 |
| 203 | 3300013308 | Ga0157375_10089349 | Ga0157375_100893493 | 390 |
| 204 | 3300013308 | Ga0157375_10379759 | Ga0157375_103797591 | 390 |
| 205 | 3300014325 | Ga0163163_10175778 | Ga0163163_101757782 | 390 |
| 206 | 3300014325 | Ga0163163_10259057 | Ga0163163_102590572 | 390 |
| 207 | 3300014968 | Ga0157379_10002419 | Ga0157379_100024197 | 390 |
| 208 | 3300014969 | Ga0157376_10013545 | Ga0157376_100135453 | 390 |
| 209 | 3300014969 | Ga0157376_10085185 | Ga0157376_100851853 | 390 |
| 210 | 3300014969 | Ga0157376_10106062 | Ga0157376_101060623 | 390 |
| 211 | 3300014969 | Ga0157376_10127235 | Ga0157376_101272352 | 390 |
| 212 | 3300014969 | Ga0157376_10173686 | Ga0157376_101736862 | 390 |
| 213 | 3300017792 | Ga0163161_10039191 | Ga0163161_100391912 | 390 |
| 214 | 3300025271 | Ga0207666_1000200 | Ga0207666_10002009 | 390 |
| 215 | 3300025315 | Ga0207697_10000048 | Ga0207697_1000004833 | 390 |
| 216 | 3300025315 | Ga0207697_10000154 | Ga0207697_1000015419 | 390 |
| 217 | 3300025315 | Ga0207697_10026069 | Ga0207697_100260692 | 390 |
| 218 | 3300025901 | Ga0207688_10006813 | Ga0207688_100068134 | 390 |
| 219 | 3300025906 | Ga0207699_10008493 | Ga0207699_100084934 | 390 |
| 220 | 3300025907 | Ga0207645_10000452 | Ga0207645_1000045235 | 390 |
| 221 | 3300025907 | Ga0207645_10003126 | Ga0207645_100031263 | 390 |
| 222 | 3300025910 | Ga0207684_10000028 | Ga0207684_1000002843 | 390 |
| 223 | 3300025910 | Ga0207684_10016531 | Ga0207684_100165315 | 390 |
| 224 | 3300025910 | Ga0207684_10030911 | Ga0207684_100309112 | 390 |
| 225 | 3300025910 | Ga0207684_10032803 | Ga0207684_100328032 | 390 |
| 226 | 3300025910 | Ga0207684_10066160 | Ga0207684_100661602 | 390 |
| 227 | 3300025913 | Ga0207695_10000125 | Ga0207695_1000012591 | 390 |
| 228 | 3300025915 | Ga0207693_10002954 | Ga0207693_100029548 | 390 |
| 229 | 3300025915 | Ga0207693_10010972 | Ga0207693_100109722 | 390 |
| 230 | 3300025915 | Ga0207693_10024152 | Ga0207693_100241523 | 390 |
| 231 | 3300025916 | Ga0207663_10008736 | Ga0207663_100087362 | 390 |
| 232 | 3300025916 | Ga0207663_10024432 | Ga0207663_100244323 | 390 |
| 233 | 3300025916 | Ga0207663_10032014 | Ga0207663_100320143 | 390 |
| 234 | 3300025916 | Ga0207663_10164696 | Ga0207663_101646962 | 390 |
| 235 | 3300025918 | Ga0207662_10000206 | Ga0207662_100002065 | 390 |
| 236 | 3300025922 | Ga0207646_10017435 | Ga0207646_100174353 | 390 |
| 237 | 3300025923 | Ga0207681_10057718 | Ga0207681_100577182 | 390 |
| 238 | 3300025925 | Ga0207650_10085759 | Ga0207650_100857594 | 390 |
| 239 | 3300025925 | Ga0207650_10137126 | Ga0207650_101371261 | 390 |
| 240 | 3300025926 | Ga0207659_10050237 | Ga0207659_100502373 | 390 |
| 241 | 3300025926 | Ga0207659_10050564 | Ga0207659_100505643 | 390 |
| 242 | 3300025931 | Ga0207644_10135650 | Ga0207644_101356502 | 390 |
| 243 | 3300025931 | Ga0207644_10186591 | Ga0207644_101865912 | 390 |
| 244 | 3300025932 | Ga0207690_10007947 | Ga0207690_100079473 | 390 |
| 245 | 3300025933 | Ga0207706_10000716 | Ga0207706_1000071617 | 390 |
| 246 | 3300025934 | Ga0207686_10002573 | Ga0207686_100025733 | 390 |
| 247 | 3300025936 | Ga0207670_10218579 | Ga0207670_102185791 | 390 |
| 248 | 3300025937 | Ga0207669_10061459 | Ga0207669_100614592 | 390 |
| 249 | 3300025938 | Ga0207704_10067497 | Ga0207704_100674972 | 390 |
| 250 | 3300025939 | Ga0207665_10020666 | Ga0207665_100206662 | 390 |
| 251 | 3300025939 | Ga0207665_10079030 | Ga0207665_100790303 | 390 |
| 252 | 3300025940 | Ga0207691_10011980 | Ga0207691_100119802 | 390 |
| 253 | 3300025940 | Ga0207691_10015062 | Ga0207691_100150627 | 390 |
| 254 | 3300025940 | Ga0207691_10162666 | Ga0207691_101626662 | 390 |
| 255 | 3300025942 | Ga0207689_10322769 | Ga0207689_103227691 | 390 |
| 256 | 3300025945 | Ga0207679_10029745 | Ga0207679_100297452 | 390 |
| 257 | 3300025945 | Ga0207679_10202194 | Ga0207679_102021941 | 390 |
| 258 | 3300025972 | Ga0207668_10005212 | Ga0207668_100052125 | 390 |
| 259 | 3300025972 | Ga0207668_10055158 | Ga0207668_100551582 | 390 |
| 260 | 3300025972 | Ga0207668_10112890 | Ga0207668_101128902 | 390 |
| 261 | 3300025986 | Ga0207658_10073739 | Ga0207658_100737392 | 390 |
| 262 | 3300025986 | Ga0207658_10077310 | Ga0207658_100773102 | 390 |
| 263 | 3300026023 | Ga0207677_10170522 | Ga0207677_101705222 | 390 |
| 264 | 3300026067 | Ga0207678_10123752 | Ga0207678_101237523 | 390 |
| 265 | 3300026089 | Ga0207648_10120137 | Ga0207648_101201372 | 390 |
| 266 | 3300026121 | Ga0207683_10156633 | Ga0207683_101566332 | 390 |
| 267 | 3300028379 | Ga0268266_10209166 | Ga0268266_102091662 | 390 |
| 268 | 3300028380 | Ga0268265_10045446 | Ga0268265_100454463 | 390 |
| 269 | 3300028381 | Ga0268264_10117216 | Ga0268264_101172162 | 390 |
| 270 | 3300035089 | Ga0373944_0041227 | Ga0373944_0041227_188_1360 | 390 |
| 271 | 3300035113 | Ga0373936_0060796 | Ga0373936_0060796_311_1483 | 390 |
| 272 | 3300035172 | Ga0373955_0018375 | Ga0373955_0018375_1174_2346 | 390 |
| 273 | 3300035398 | Ga0316574_0088726 | Ga0316574_0088726_93_1265 | 390 |
| 274 | 3300035691 | Ga0373931_0028909 | Ga0373931_0028909_387_1559 | 390 |
| 275 | 3300035691 | Ga0373931_0041269 | Ga0373931_0041269_563_1735 | 390 |
| 276 | 3300036401 | Ga0373937_0019229 | Ga0373937_0019229_839_2011 | 390 |
| 277 | 3300036401 | Ga0373937_0121938 | Ga0373937_0121938_940_2112 | 390 |
| 278 | 3300037466 | Ga0395898_0021566 | Ga0395898_0021566_3378_4550 | 390 |
| 279 | 3300038443 | Ga0395901_0007215 | Ga0395901_0007215_4834_6006 | 390 |
| 280 | 3300038443 | Ga0395901_0111343 | Ga0395901_0111343_352_1524 | 390 |
| 281 | 3300038443 | Ga0395901_0382234 | Ga0395901_0382234_175_1347 | 390 |
| 282 | 3300045051 | Ga0451576_0255369 | Ga0451576_0255369_268_1440 | 390 |
| 283 | 3300046462 | Ga0495651_0059235 | Ga0495651_0059235_274_1446 | 390 |
| 284 | 3300046463 | Ga0495653_0162424 | Ga0495653_0162424_253_1425 | 390 |
| 285 | 3300046517 | Ga0495630_0074018 | Ga0495630_0074018_1064_2236 | 390 |
| 286 | 3300046529 | Ga0495652_0080322 | Ga0495652_0080322_188_1360 | 390 |
| 287 | 3300046533 | Ga0495640_0197658 | Ga0495640_0197658_68_1240 | 390 |
| 288 | 3300046535 | Ga0495586_0034251 | Ga0495586_0034251_756_1928 | 390 |
| 289 | 3300046681 | Ga0495647_0058714 | Ga0495647_0058714_72_1244 | 390 |
| 290 | 3300046683 | Ga0495658_0062068 | Ga0495658_0062068_833_2005 | 390 |
| 291 | 3300046690 | Ga0495624_0062603 | Ga0495624_0062603_343_1515 | 390 |
| 292 | 3300046809 | Ga0495600_0181685 | Ga0495600_0181685_76_1248 | 390 |
| 293 | 3300047471 | Ga0495684_0089618 | Ga0495684_0089618_507_1679 | 390 |
| 294 | 3300048904 | Ga0496101_0007385 | Ga0496101_0007385_687_1859 | 390 |
| 295 | 3300048904 | Ga0496101_0023992 | Ga0496101_0023992_2157_3329 | 390 |
| 296 | 3300048905 | Ga0496102_0107672 | Ga0496102_0107672_219_1391 | 390 |
| 297 | 3300048906 | Ga0496103_0070587 | Ga0496103_0070587_485_1657 | 390 |
| 298 | 3300048907 | Ga0496104_0104448 | Ga0496104_0104448_211_1383 | 390 |
| 299 | 3300048907 | Ga0496104_0265689 | Ga0496104_0265689_168_1340 | 390 |
| 300 | 3300048908 | Ga0496105_0015096 | Ga0496105_0015096_4181_5389 | 390 |
| 301 | 3300048910 | Ga0496107_0024301 | Ga0496107_0024301_20_1192 | 390 |
| 302 | 3300048911 | Ga0496108_0035884 | Ga0496108_0035884_506_1678 | 390 |
| 303 | 3300048911 | Ga0496108_0207088 | Ga0496108_0207088_351_1523 | 390 |
| 304 | 3300048911 | Ga0496108_0342972 | Ga0496108_0342972_35_1207 | 390 |
| 305 | 3300048912 | Ga0496109_0044121 | Ga0496109_0044121_1366_2538 | 390 |
| 306 | 3300048912 | Ga0496109_0100859 | Ga0496109_0100859_1388_2560 | 390 |
| 307 | 3300048912 | Ga0496109_0195582 | Ga0496109_0195582_40_1212 | 390 |
| 308 | 3300048912 | Ga0496109_0240809 | Ga0496109_0240809_47_1219 | 390 |
| 309 | 3300048915 | Ga0496112_0096488 | Ga0496112_0096488_548_1720 | 390 |
| 310 | 3300048915 | Ga0496112_0138767 | Ga0496112_0138767_169_1341 | 390 |
| 311 | 3300048916 | Ga0496113_0053986 | Ga0496113_0053986_1450_2622 | 390 |
| 312 | 3300048917 | Ga0496114_0057982 | Ga0496114_0057982_1074_2282 | 390 |
| 313 | 3300048918 | Ga0496115_0009602 | Ga0496115_0009602_4796_5968 | 390 |
| 314 | 3300048918 | Ga0496115_0130456 | Ga0496115_0130456_68_1240 | 390 |
| 315 | 3300050507 | nmdc:mga05p37_9008_c1 | nmdc:mga05p37_9008_c1_6711_7883 | 390 |
| 316 | 3300050512 | nmdc:mga0n895_377271_c1 | nmdc:mga0n895_377271_c1_239_1411 | 390 |
| 317 | 3300050514 | nmdc:mga08x19_67323_c1 | nmdc:mga08x19_67323_c1_533_1705 | 390 |
| 318 | 3300003203 | JGI25406J46586_10000003 | JGI25406J46586_10000003116 | 391 |
| 319 | 3300005985 | Ga0081539_10000077 | Ga0081539_10000077185 | 391 |
| 320 | 3300025915 | Ga0207693_10094311 | Ga0207693_100943112 | 391 |
| 321 | 3300003911 | JGI25405J52794_10000430 | JGI25405J52794_100004303 | 396 |
| 322 | 3300005985 | Ga0081539_10001712 | Ga0081539_100017123 | 396 |
| 323 | 3300005328 | Ga0070676_10034826 | Ga0070676_100348262 | 397 |
| 324 | 3300005353 | Ga0070669_100003462 | Ga0070669_1000034623 | 397 |
| 325 | 3300005543 | Ga0070672_100006785 | Ga0070672_1000067853 | 397 |
| 326 | 3300013306 | Ga0163162_10157925 | Ga0163162_101579253 | 397 |
| 327 | 3300014969 | Ga0157376_10031341 | Ga0157376_100313411 | 397 |
| 328 | 3300025315 | Ga0207697_10002714 | Ga0207697_100027142 | 397 |
| 329 | 3300025903 | Ga0207680_10049884 | Ga0207680_100498842 | 397 |
| 330 | 3300025907 | Ga0207645_10007585 | Ga0207645_100075858 | 397 |
| 331 | 3300025940 | Ga0207691_10003206 | Ga0207691_100032066 | 397 |
| 332 | 3300026121 | Ga0207683_10007015 | Ga0207683_100070157 | 397 |
| 333 | 3300005468 | Ga0070707_100190734 | Ga0070707_1001907342 | 399 |
| 334 | 3300005471 | Ga0070698_100017365 | Ga0070698_1000173655 | 403 |
| 335 | 3300026121 | Ga0207683_10017751 | Ga0207683_100177514 | 403 |
| 336 | 3300009147 | Ga0114129_10175674 | Ga0114129_101756742 | 404 |
| 337 | 3300009553 | Ga0105249_10194318 | Ga0105249_101943182 | 404 |
| 338 | 3300013105 | Ga0157369_10093864 | Ga0157369_100938644 | 404 |
| 339 | 3300015262 | Ga0182007_10042462 | Ga0182007_100424622 | 404 |
| 340 | 3300025929 | Ga0207664_10031523 | Ga0207664_100315234 | 404 |
| 341 | 3300025939 | Ga0207665_10002528 | Ga0207665_100025287 | 404 |
| 342 | 3300046454 | Ga0495592_0018248 | Ga0495592_0018248_540_1754 | 404 |
| 343 | 3300046473 | Ga0495582_0036650 | Ga0495582_0036650_231_1445 | 404 |
| 344 | 3300046476 | Ga0495662_0084678 | Ga0495662_0084678_57_1271 | 404 |
| 345 | 3300046516 | Ga0495628_0021231 | Ga0495628_0021231_3430_4644 | 404 |
| 346 | 3300046536 | Ga0495587_0046149 | Ga0495587_0046149_1081_2295 | 404 |
| 347 | 3300046683 | Ga0495658_0123193 | Ga0495658_0123193_212_1426 | 404 |
| 348 | 3300047444 | Ga0495675_0100003 | Ga0495675_0100003_333_1547 | 404 |
| 349 | 3300050507 | nmdc:mga05p37_143168_c1 | nmdc:mga05p37_143168_c1_782_2032 | 404 |
| 350 | 3300053077 | Ga0495601_0066573 | Ga0495601_0066573_378_1592 | 404 |
| 351 | 3300000545 | CNXas_1000022 | CNXas_100002219 | 405 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8evy-assembly1.cif.gz_B | ddlb from pseudomonas aeruginosa pao1 in complex with atp and d-ala-d-ala | 0.7139 | 20 | 59 |
| 4egq-assembly5.cif.gz_B-3 | crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei | 0.7097 | 20 | 57 |
| 4egq-assembly5.cif.gz_C | crystal structure of d-alanine-d-alanine ligase b from burkholderia pseudomallei | 0.7085 | 20 | 57 |
| 4egj-assembly5.cif.gz_A | crystal structure of d-alanine-d-alanine ligase from burkholderia xenovorans | 0.7057 | 20 | 57 |
| 6wg9-assembly2.cif.gz_B | crystal structure of tetracycline destructase tet(x7) | 0.7032 | 19 | 59 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0EIF9_8_114_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7336 | 324 | 401 | 3.40.50.2000 |
| af_Q8H191_31_475_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.7279 | 22 | 61 | 3.50.50.60 |
| af_P96407_190_356_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7098 | 208 | 386 | 3.40.50.2000 |
| af_P96407_190_356_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.699 | 208 | 386 | 3.40.50.2000 |
| af_E0AHD3_2_449_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.6898 | 20 | 61 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9ETQ1-F1-model_v4 | Glycosyltransferase | 0.9893 | 16 | 405 |
GO:0016020
GO:0016740 |
| AF-A0A7V9ETQ1-F1-model_v4 | Glycosyltransferase | 0.9868 | 16 | 405 |
GO:0016020
GO:0016740 |
| AF-A0A2V5UU61-F1-model_v4 | Glycosyltransferase family 1 protein | 0.9847 | 16 | 402 |
GO:0016020
|
| AF-A0A2V6E7N7-F1-model_v4 | Glycosyltransferase family 1 protein | 0.9815 | 142 | 405 |
|
| AF-A0A7V9MU54-F1-model_v4 | Glycosyltransferase family 1 protein | 0.9815 | 16 | 119 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar