F418568

General Info

Members Datasets Scaffolds Average Seq Length
351 155 702 171

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100253446|Ga0068864_1002534462
Length 190
Sequence MRTWLRSSRKINSSDLLHLMRVNYPKLILAIPLTLYCLWIAYDPMQGSFLDNVDLLIHESGHLLFGLFGEFMMVAGGSLFQVIMPLTFVGYFAWKRQFYSTAIVALWVGQSILNVYVYAADAVVMQLVLTSGFTGSEGSFHDWNYLLTATGLLGSTKTVAGIIRLLGTLTIIGAGVSAIYYSFYGGESSE

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
141 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
142 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
143 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
144 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
145 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
146 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
148 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
149 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
150 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
151 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
152 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
153 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.85
Rhizosphere 98.86
Stem 0
Stem Tuber 0
Unclassified 35.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100253446 3300005618 Unclassified 1635
2 LJQas_1000037 3300000549 Bacteria 20776
3 rootL2_10076214 3300003322 Unclassified 1591
4 Ga0065712_10114993 3300005290 Bacteria 1758
5 Ga0065712_10245555 3300005290 Unclassified 973
6 Ga0065712_10325611 3300005290 Bacteria 820
7 Ga0065707_10091392 3300005295 Bacteria 3955
8 Ga0070676_10177936 3300005328 Bacteria 1381
9 Ga0070683_100400373 3300005329 Bacteria 1309
10 Ga0070683_101233542 3300005329 Bacteria 719
11 Ga0070683_101240194 3300005329 Unclassified 717
12 Ga0070690_100048194 3300005330 Unclassified 2712
13 Ga0070670_100002753 3300005331 Bacteria 14522
14 Ga0070670_100141335 3300005331 Bacteria 2082
15 Ga0070670_100396732 3300005331 Bacteria 1217
16 Ga0070677_10003590 3300005333 Bacteria 5006
17 Ga0070677_10106624 3300005333 Bacteria 1244
18 Ga0068869_101031437 3300005334 Bacteria 717
19 Ga0070666_10083102 3300005335 Bacteria 2190
20 Ga0070666_10413088 3300005335 Unclassified 971
21 Ga0070680_101587141 3300005336 Unclassified 567
22 Ga0070682_100200364 3300005337 Unclassified 1408
23 Ga0068868_100082765 3300005338 Bacteria 2575
24 Ga0070689_100023120 3300005340 Bacteria 4650
25 Ga0070689_100243565 3300005340 Bacteria 1482
26 Ga0070689_100772028 3300005340 Bacteria 844
27 Ga0070687_100055980 3300005343 Bacteria 2062
28 Ga0070661_100067315 3300005344 Bacteria 2632
29 Ga0070675_100018113 3300005354 Bacteria 5606
30 Ga0070675_100134349 3300005354 Bacteria 2110
31 Ga0070675_100139842 3300005354 Unclassified 2069
32 Ga0070675_100156596 3300005354 Bacteria 1956
33 Ga0070675_100198414 3300005354 Bacteria 1741
34 Ga0070675_100544424 3300005354 Unclassified 1049
35 Ga0070671_100048090 3300005355 Unclassified 3546
36 Ga0070671_100180060 3300005355 Bacteria 1789
37 Ga0070671_100194758 3300005355 Bacteria 1718
38 Ga0070671_100736217 3300005355 Unclassified 856
39 Ga0070674_100011211 3300005356 Bacteria 5448
40 Ga0070674_100698340 3300005356 Bacteria 867
41 Ga0070673_100445899 3300005364 Bacteria 1164
42 Ga0070688_100203103 3300005365 Bacteria 1388
43 Ga0070688_100415052 3300005365 Bacteria 999
44 Ga0070659_100005683 3300005366 Bacteria 8971
45 Ga0070667_100023762 3300005367 Bacteria 5088
46 Ga0070667_100786159 3300005367 Bacteria 883
47 Ga0070700_100038593 3300005441 Bacteria 2912
48 Ga0070700_100097034 3300005441 Bacteria 1935
49 Ga0070694_100209866 3300005444 Unclassified 1456
50 Ga0070663_100073193 3300005455 Bacteria 2499
51 Ga0070678_100155501 3300005456 Unclassified 1847
52 Ga0070678_100805758 3300005456 Bacteria 853
53 Ga0070662_100017270 3300005457 Bacteria 4861
54 Ga0070662_100467339 3300005457 Bacteria 1049
55 Ga0068867_101420789 3300005459 Unclassified 644
56 Ga0070685_10066939 3300005466 Bacteria 2119
57 Ga0070685_10252933 3300005466 Unclassified 1168
58 Ga0070684_100503756 3300005535 Unclassified 1121
59 Ga0070684_100840037 3300005535 Bacteria 859
60 Ga0070684_101042148 3300005535 Bacteria 768
61 Ga0068853_100014507 3300005539 Bacteria 6456
62 Ga0068853_100016709 3300005539 Bacteria 6043
63 Ga0068853_100050810 3300005539 Unclassified 3566
64 Ga0068853_100342625 3300005539 Unclassified 1389
65 Ga0070672_100061126 3300005543 Unclassified 2969
66 Ga0070672_100391050 3300005543 Bacteria 1191
67 Ga0070686_100017182 3300005544 Bacteria 4223
68 Ga0070695_100177462 3300005545 Bacteria 1507
69 Ga0070665_100938065 3300005548 Bacteria 878
70 Ga0068855_100052502 3300005563 Unclassified 4799
71 Ga0068855_100092979 3300005563 Unclassified 3478
72 Ga0068855_101077041 3300005563 Bacteria 841
73 Ga0070664_100027952 3300005564 Unclassified 4691
74 Ga0070664_100063867 3300005564 Unclassified 3139
75 Ga0070664_100072277 3300005564 Bacteria 2958
76 Ga0070664_100514605 3300005564 Bacteria 1104
77 Ga0070664_100547145 3300005564 Unclassified 1070
78 Ga0068857_100021435 3300005577 Bacteria 5688
79 Ga0068857_100067479 3300005577 Bacteria 3184
80 Ga0068857_100085300 3300005577 Bacteria 2822
81 Ga0068857_100280251 3300005577 Bacteria 1533
82 Ga0068857_100513350 3300005577 Bacteria 1126
83 Ga0068854_100025919 3300005578 Unclassified 4024
84 Ga0068854_100119707 3300005578 Bacteria 1997
85 Ga0068854_100194166 3300005578 Bacteria 1592
86 Ga0068854_100209944 3300005578 Bacteria 1535
87 Ga0068852_100121254 3300005616 Unclassified 2394
88 Ga0068852_100282373 3300005616 Bacteria 1601
89 Ga0068852_101580505 3300005616 Unclassified 678
90 Ga0068859_100007860 3300005617 Bacteria 10824
91 Ga0068859_100069578 3300005617 Bacteria 3555
92 Ga0068859_100127341 3300005617 Bacteria 2616
93 Ga0068864_100008232 3300005618 Bacteria 8600
94 Ga0068864_100107829 3300005618 Bacteria 2478
95 Ga0068864_100630812 3300005618 Unclassified 1042
96 Ga0068864_100733930 3300005618 Unclassified 967
97 Ga0068866_10128653 3300005718 Bacteria 1437
98 Ga0068870_10059568 3300005840 Bacteria 2047
99 Ga0068870_10137705 3300005840 Unclassified 1425
100 Ga0068863_100125763 3300005841 Bacteria 2446
101 Ga0068863_100159347 3300005841 Unclassified 2162
102 Ga0068863_100651645 3300005841 Unclassified 1044
103 Ga0068858_100033105 3300005842 Bacteria 4800
104 Ga0068858_100047252 3300005842 Unclassified 3990
105 Ga0068858_100061408 3300005842 Unclassified 3474
106 Ga0068858_100121835 3300005842 Bacteria 2439
107 Ga0068860_100075045 3300005843 Bacteria 3216
108 Ga0068860_100113199 3300005843 Bacteria 2594
109 Ga0068860_100387000 3300005843 Unclassified 1381
110 Ga0068862_100041603 3300005844 Unclassified 3911
111 Ga0068862_100133313 3300005844 Unclassified 2199
112 Ga0068862_100160461 3300005844 Bacteria 2006
113 Ga0068862_100379372 3300005844 Bacteria 1318
114 Ga0097621_100128063 3300006237 Bacteria 2158
115 Ga0097621_101570275 3300006237 Unclassified 625
116 Ga0068871_100082548 3300006358 Bacteria 2665
117 Ga0068871_100218326 3300006358 Bacteria 1651
118 Ga0097620_100007859 3300006931 Bacteria 10824
119 Ga0097620_100069577 3300006931 Bacteria 3555
120 Ga0097620_100127334 3300006931 Bacteria 2616
121 Ga0105240_10121961 3300009093 Unclassified 3138
122 Ga0111539_10105169 3300009094 Unclassified 3312
123 Ga0105245_10183870 3300009098 Unclassified 1998
124 Ga0105247_10030949 3300009101 Unclassified 3246
125 Ga0105247_10142138 3300009101 Bacteria 1574
126 Ga0114129_11888903 3300009147 Unclassified 724
127 Ga0105243_11204027 3300009148 Bacteria 771
128 Ga0105241_10447313 3300009174 Unclassified 1142
129 Ga0105248_10033426 3300009177 Bacteria 5745
130 Ga0105248_10919334 3300009177 Bacteria 988
131 Ga0105237_10122802 3300009545 Bacteria 2591
132 Ga0105237_10272106 3300009545 Bacteria 1697
133 Ga0105249_10027612 3300009553 Bacteria 5122
134 Ga0105249_10102500 3300009553 Bacteria 2694
135 Ga0105249_10125309 3300009553 Bacteria 2446
136 Ga0105249_10131466 3300009553 Bacteria 2390
137 Ga0105249_10626207 3300009553 Bacteria 1132
138 Ga0105239_11117733 3300010375 Bacteria 907
139 Ga0105239_11280406 3300010375 Unclassified 846
140 Ga0157373_10019974 3300013100 Bacteria 4873
141 Ga0157373_10055071 3300013100 Bacteria 2826
142 Ga0157370_10232317 3300013104 Bacteria 1707
143 Ga0157370_10245907 3300013104 Bacteria 1655
144 Ga0157370_10254194 3300013104 Bacteria 1625
145 Ga0157369_10065279 3300013105 Bacteria 3917
146 Ga0157369_10121170 3300013105 Unclassified 2776
147 Ga0157369_11090949 3300013105 Unclassified 816
148 Ga0157374_10224657 3300013296 Unclassified 1843
149 Ga0157374_11364726 3300013296 Bacteria 731
150 Ga0157378_10139652 3300013297 Bacteria 2249
151 Ga0157378_10569385 3300013297 Bacteria 1141
152 Ga0163162_10024269 3300013306 Bacteria 5985
153 Ga0163162_10120212 3300013306 Bacteria 2730
154 Ga0163162_10179165 3300013306 Unclassified 2245
155 Ga0163162_10648666 3300013306 Bacteria 1179
156 Ga0163162_10690949 3300013306 Bacteria 1142
157 Ga0157372_10015098 3300013307 Bacteria 8268
158 Ga0157372_10062668 3300013307 Bacteria 4167
159 Ga0157372_10143317 3300013307 Bacteria 2755
160 Ga0157372_10377401 3300013307 Bacteria 1652
161 Ga0157372_11043297 3300013307 Unclassified 946
162 Ga0157375_10019724 3300013308 Bacteria 6142
163 Ga0157375_10027137 3300013308 Bacteria 5349
164 Ga0157375_10132092 3300013308 Bacteria 2617
165 Ga0157375_10288455 3300013308 Unclassified 1804
166 Ga0157375_10712584 3300013308 Unclassified 1157
167 Ga0157375_12283897 3300013308 Bacteria 645
168 Ga0163163_10417239 3300014325 Unclassified 1401
169 Ga0163163_10884641 3300014325 Unclassified 957
170 Ga0157380_10024418 3300014326 Unclassified 4576
171 Ga0157380_10058751 3300014326 Bacteria 3067
172 Ga0157380_10274615 3300014326 Bacteria 1538
173 Ga0163161_10000575 3300017792 Bacteria 29515
174 Ga0163161_10034856 3300017792 Bacteria 3600
175 Ga0163161_10040616 3300017792 Bacteria 3342
176 Ga0207656_10228857 3300025321 Unclassified 905
177 Ga0207682_10119645 3300025893 Bacteria 1167
178 Ga0207710_10081001 3300025900 Bacteria 1506
179 Ga0207680_10076510 3300025903 Bacteria 2090
180 Ga0207680_10844203 3300025903 Unclassified 657
181 Ga0207645_10093315 3300025907 Bacteria 1936
182 Ga0207645_10190819 3300025907 Bacteria 1346
183 Ga0207643_10382445 3300025908 Bacteria 888
184 Ga0207705_10053414 3300025909 Bacteria 2911
185 Ga0207707_10005245 3300025912 Bacteria 11357
186 Ga0207695_10091344 3300025913 Bacteria 3059
187 Ga0207695_11011108 3300025913 Bacteria 711
188 Ga0207671_10651038 3300025914 Unclassified 839
189 Ga0207660_11100224 3300025917 Unclassified 648
190 Ga0207657_10163203 3300025919 Bacteria 1809
191 Ga0207652_10045882 3300025921 Bacteria 3726
192 Ga0207650_10135425 3300025925 Unclassified 1932
193 Ga0207650_10792316 3300025925 Unclassified 803
194 Ga0207659_10054220 3300025926 Unclassified 2862
195 Ga0207659_10055144 3300025926 Unclassified 2841
196 Ga0207659_10256791 3300025926 Unclassified 1420
197 Ga0207644_10048074 3300025931 Bacteria 3048
198 Ga0207644_10516377 3300025931 Bacteria 987
199 Ga0207644_10569247 3300025931 Unclassified 939
200 Ga0207706_10022255 3300025933 Bacteria 5688
201 Ga0207706_10122122 3300025933 Bacteria 2291
202 Ga0207706_10387904 3300025933 Bacteria 1212
203 Ga0207670_10339565 3300025936 Unclassified 1187
204 Ga0207670_10902766 3300025936 Bacteria 740
205 Ga0207669_10761959 3300025937 Bacteria 800
206 Ga0207669_10861954 3300025937 Unclassified 754
207 Ga0207691_10024852 3300025940 Bacteria 5631
208 Ga0207691_10036496 3300025940 Unclassified 4554
209 Ga0207691_10046001 3300025940 Bacteria 4012
210 Ga0207711_10179354 3300025941 Unclassified 1925
211 Ga0207711_10933589 3300025941 Unclassified 806
212 Ga0207689_10064942 3300025942 Unclassified 3002
213 Ga0207689_10086668 3300025942 Unclassified 2574
214 Ga0207661_10468466 3300025944 Unclassified 1149
215 Ga0207661_10965399 3300025944 Bacteria 785
216 Ga0207679_10010787 3300025945 Bacteria 5893
217 Ga0207679_10109768 3300025945 Bacteria 2175
218 Ga0207679_10167259 3300025945 Unclassified 1807
219 Ga0207679_11588154 3300025945 Unclassified 599
220 Ga0207667_10059306 3300025949 Bacteria 4008
221 Ga0207667_10188012 3300025949 Bacteria 2120
222 Ga0207651_10309348 3300025960 Bacteria 1317
223 Ga0207651_10370894 3300025960 Unclassified 1211
224 Ga0207712_10016262 3300025961 Bacteria 4814
225 Ga0207712_10020049 3300025961 Bacteria 4375
226 Ga0207712_10549994 3300025961 Bacteria 993
227 Ga0207712_10879236 3300025961 Bacteria 791
228 Ga0207712_10893735 3300025961 Bacteria 785
229 Ga0207668_10079929 3300025972 Archaea 2367
230 Ga0207640_10160409 3300025981 Unclassified 1663
231 Ga0207640_10337982 3300025981 Bacteria 1205
232 Ga0207640_10776378 3300025981 Bacteria 828
233 Ga0207658_10082089 3300025986 Bacteria 2474
234 Ga0207677_11014172 3300026023 Unclassified 753
235 Ga0207703_10065175 3300026035 Bacteria 2993
236 Ga0207703_10110559 3300026035 Unclassified 2344
237 Ga0207703_10117299 3300026035 Unclassified 2280
238 Ga0207703_10148642 3300026035 Unclassified 2041
239 Ga0207639_10001302 3300026041 Bacteria 16865
240 Ga0207639_10039819 3300026041 Unclassified 3504
241 Ga0207678_10011896 3300026067 Bacteria 7641
242 Ga0207678_10740149 3300026067 Bacteria 866
243 Ga0207708_10255697 3300026075 Bacteria 1413
244 Ga0207708_10620966 3300026075 Unclassified 917
245 Ga0207708_10722966 3300026075 Bacteria 853
246 Ga0207641_10019331 3300026088 Bacteria 5590
247 Ga0207641_10041766 3300026088 Bacteria 3845
248 Ga0207641_10150722 3300026088 Unclassified 2106
249 Ga0207641_10456853 3300026088 Unclassified 1235
250 Ga0207648_10078448 3300026089 Bacteria 2881
251 Ga0207648_10421498 3300026089 Bacteria 1212
252 Ga0207676_10043381 3300026095 Bacteria 3462
253 Ga0207676_10150352 3300026095 Bacteria 2004
254 Ga0207676_10160761 3300026095 Unclassified 1946
255 Ga0207676_10464653 3300026095 Bacteria 1195
256 Ga0207674_10015205 3300026116 Bacteria 8469
257 Ga0207674_10090766 3300026116 Bacteria 3046
258 Ga0207674_10146277 3300026116 Bacteria 2322
259 Ga0207674_10328616 3300026116 Bacteria 1479
260 Ga0207674_10631956 3300026116 Bacteria 1034
261 Ga0207675_100026932 3300026118 Bacteria 5352
262 Ga0207675_100612729 3300026118 Bacteria 1092
263 Ga0207675_100643536 3300026118 Bacteria 1066
264 Ga0207683_10049733 3300026121 Unclassified 3671
265 Ga0207683_10241884 3300026121 Unclassified 1646
266 Ga0207683_10376384 3300026121 Unclassified 1305
267 Ga0207698_10393122 3300026142 Unclassified 1323
268 Ga0207428_10722180 3300027907 Unclassified 711
269 Ga0268265_10027449 3300028380 Bacteria 4064
270 Ga0268265_10043949 3300028380 Unclassified 3324
271 Ga0268265_10647900 3300028380 Bacteria 1015
272 Ga0268265_11531865 3300028380 Unclassified 671
273 Ga0268264_10025325 3300028381 Bacteria 4847
274 Ga0268264_10920716 3300028381 Bacteria 878
275 Ga0307408_100050001 3300031548 Unclassified 3004
276 Ga0307408_100153576 3300031548 Bacteria 1820
277 Ga0307405_10057239 3300031731 Unclassified 2448
278 Ga0307405_10216526 3300031731 Bacteria 1402
279 Ga0307405_10663649 3300031731 Unclassified 859
280 Ga0307413_10000302 3300031824 Bacteria 15226
281 Ga0307413_10003089 3300031824 Bacteria 6922
282 Ga0307413_10038026 3300031824 Bacteria 2785
283 Ga0307413_10817984 3300031824 Bacteria 784
284 Ga0307410_10005643 3300031852 Bacteria 6654
285 Ga0307410_10021348 3300031852 Unclassified 3981
286 Ga0307410_10096985 3300031852 Bacteria 2105
287 Ga0307410_10098128 3300031852 Unclassified 2094
288 Ga0307410_10192926 3300031852 Bacteria 1550
289 Ga0307410_10194094 3300031852 Bacteria 1546
290 Ga0307410_10542146 3300031852 Bacteria 963
291 Ga0307410_10565189 3300031852 Bacteria 944
292 Ga0307406_10061488 3300031901 Unclassified 2425
293 Ga0307406_10468505 3300031901 Bacteria 1015
294 Ga0307406_11027253 3300031901 Bacteria 708
295 Ga0307407_10014381 3300031903 Unclassified 3873
296 Ga0307407_10033607 3300031903 Unclassified 2800
297 Ga0307407_10041079 3300031903 Bacteria 2584
298 Ga0307407_10739088 3300031903 Bacteria 744
299 Ga0307407_10988313 3300031903 Unclassified 650
300 Ga0307412_10019869 3300031911 Unclassified 4078
301 Ga0307412_10037068 3300031911 Unclassified 3130
302 Ga0307412_10135079 3300031911 Unclassified 1798
303 Ga0307412_10823903 3300031911 Bacteria 807
304 Ga0307409_100031610 3300031995 Unclassified 3824
305 Ga0307409_100052026 3300031995 Bacteria 3138
306 Ga0307409_100064889 3300031995 Bacteria 2870
307 Ga0307409_100087931 3300031995 Unclassified 2534
308 Ga0307409_100424175 3300031995 Unclassified 1277
309 Ga0307409_101090493 3300031995 Bacteria 819
310 Ga0307416_100049823 3300032002 Unclassified 3333
311 Ga0307416_100128171 3300032002 Unclassified 2277
312 Ga0307416_100174303 3300032002 Bacteria 2007
313 Ga0307416_100254692 3300032002 Bacteria 1711
314 Ga0307416_100517145 3300032002 Bacteria 1261
315 Ga0307414_10009043 3300032004 Bacteria 5699
316 Ga0307414_10443386 3300032004 Unclassified 1137
317 Ga0307411_10006828 3300032005 Bacteria 5750
318 Ga0307411_10007947 3300032005 Bacteria 5454
319 Ga0307411_10195716 3300032005 Bacteria 1548
320 Ga0307411_11347368 3300032005 Unclassified 651
321 Ga0307415_100035195 3300032126 Unclassified 3269
322 Ga0307415_100060439 3300032126 Unclassified 2619
323 Ga0307415_100119485 3300032126 Bacteria 1973
324 Ga0307415_100190956 3300032126 Bacteria 1616
325 Ga0307415_100349038 3300032126 Bacteria 1245
326 Ga0307415_100742610 3300032126 Bacteria 890
327 Ga0307415_101156133 3300032126 Bacteria 727
328 Ga0373923_0163390 3300035111 Unclassified 1017
329 Ga0373937_0054596 3300036401 Unclassified 3667
330 Ga0495668_0001177 3300046616 Bacteria 26638
331 Ga0496105_0186309 3300048908 Bacteria 1698
332 Ga0496109_0094131 3300048912 Bacteria 2773
333 Ga0496110_0672928 3300048913 Bacteria 936
334 Ga0501072_0009726 3300049588 Bacteria 7313
335 Ga0501201_014481 3300049651 Bacteria 796
336 Ga0501202_007727 3300049652 Unclassified 1948
337 Ga0501223_017543 3300049663 Bacteria 1412
338 Ga0501233_106501 3300049668 Bacteria 746
339 Ga0501235_014113 3300049669 Unclassified 1761
340 Ga0501247_001219 3300049677 Unclassified 2408
341 Ga0501248_001599 3300049678 Bacteria 1454
342 Ga0501249_001190 3300049679 Bacteria 5460
343 Ga0501258_005396 3300049687 Unclassified 1238
344 Ga0501259_058381 3300049688 Bacteria 800
345 Ga0501225_0026900 3300049705 Unclassified 1583
346 Ga0501225_0109976 3300049705 Bacteria 811
347 Ga0501267_001593 3300049764 Unclassified 1972
348 Ga0501268_003058 3300049765 Unclassified 2261
349 Ga0501272_005645 3300049769 Bacteria 1323
350 nmdc:mga05p37_1674762_c1 3300050507 Unclassified 622
351 nmdc:mga08y16_96170_c1 3300050511 Unclassified 3084
352 Ga0068864_100253446
353 LJQas_1000037
354 rootL2_10076214
355 Ga0065712_10114993
356 Ga0065712_10245555
357 Ga0065712_10325611
358 Ga0065707_10091392
359 Ga0070676_10177936
360 Ga0070683_100400373
361 Ga0070683_101233542
362 Ga0070683_101240194
363 Ga0070690_100048194
364 Ga0070670_100002753
365 Ga0070670_100141335
366 Ga0070670_100396732
367 Ga0070677_10003590
368 Ga0070677_10106624
369 Ga0068869_101031437
370 Ga0070666_10083102
371 Ga0070666_10413088
372 Ga0070680_101587141
373 Ga0070682_100200364
374 Ga0068868_100082765
375 Ga0070689_100023120
376 Ga0070689_100243565
377 Ga0070689_100772028
378 Ga0070687_100055980
379 Ga0070661_100067315
380 Ga0070675_100018113
381 Ga0070675_100134349
382 Ga0070675_100139842
383 Ga0070675_100156596
384 Ga0070675_100198414
385 Ga0070675_100544424
386 Ga0070671_100048090
387 Ga0070671_100180060
388 Ga0070671_100194758
389 Ga0070671_100736217
390 Ga0070674_100011211
391 Ga0070674_100698340
392 Ga0070673_100445899
393 Ga0070688_100203103
394 Ga0070688_100415052
395 Ga0070659_100005683
396 Ga0070667_100023762
397 Ga0070667_100786159
398 Ga0070700_100038593
399 Ga0070700_100097034
400 Ga0070694_100209866
401 Ga0070663_100073193
402 Ga0070678_100155501
403 Ga0070678_100805758
404 Ga0070662_100017270
405 Ga0070662_100467339
406 Ga0068867_101420789
407 Ga0070685_10066939
408 Ga0070685_10252933
409 Ga0070684_100503756
410 Ga0070684_100840037
411 Ga0070684_101042148
412 Ga0068853_100014507
413 Ga0068853_100016709
414 Ga0068853_100050810
415 Ga0068853_100342625
416 Ga0070672_100061126
417 Ga0070672_100391050
418 Ga0070686_100017182
419 Ga0070695_100177462
420 Ga0070665_100938065
421 Ga0068855_100052502
422 Ga0068855_100092979
423 Ga0068855_101077041
424 Ga0070664_100027952
425 Ga0070664_100063867
426 Ga0070664_100072277
427 Ga0070664_100514605
428 Ga0070664_100547145
429 Ga0068857_100021435
430 Ga0068857_100067479
431 Ga0068857_100085300
432 Ga0068857_100280251
433 Ga0068857_100513350
434 Ga0068854_100025919
435 Ga0068854_100119707
436 Ga0068854_100194166
437 Ga0068854_100209944
438 Ga0068852_100121254
439 Ga0068852_100282373
440 Ga0068852_101580505
441 Ga0068859_100007860
442 Ga0068859_100069578
443 Ga0068859_100127341
444 Ga0068864_100008232
445 Ga0068864_100107829
446 Ga0068864_100630812
447 Ga0068864_100733930
448 Ga0068866_10128653
449 Ga0068870_10059568
450 Ga0068870_10137705
451 Ga0068863_100125763
452 Ga0068863_100159347
453 Ga0068863_100651645
454 Ga0068858_100033105
455 Ga0068858_100047252
456 Ga0068858_100061408
457 Ga0068858_100121835
458 Ga0068860_100075045
459 Ga0068860_100113199
460 Ga0068860_100387000
461 Ga0068862_100041603
462 Ga0068862_100133313
463 Ga0068862_100160461
464 Ga0068862_100379372
465 Ga0097621_100128063
466 Ga0097621_101570275
467 Ga0068871_100082548
468 Ga0068871_100218326
469 Ga0097620_100007859
470 Ga0097620_100069577
471 Ga0097620_100127334
472 Ga0105240_10121961
473 Ga0111539_10105169
474 Ga0105245_10183870
475 Ga0105247_10030949
476 Ga0105247_10142138
477 Ga0114129_11888903
478 Ga0105243_11204027
479 Ga0105241_10447313
480 Ga0105248_10033426
481 Ga0105248_10919334
482 Ga0105237_10122802
483 Ga0105237_10272106
484 Ga0105249_10027612
485 Ga0105249_10102500
486 Ga0105249_10125309
487 Ga0105249_10131466
488 Ga0105249_10626207
489 Ga0105239_11117733
490 Ga0105239_11280406
491 Ga0157373_10019974
492 Ga0157373_10055071
493 Ga0157370_10232317
494 Ga0157370_10245907
495 Ga0157370_10254194
496 Ga0157369_10065279
497 Ga0157369_10121170
498 Ga0157369_11090949
499 Ga0157374_10224657
500 Ga0157374_11364726
501 Ga0157378_10139652
502 Ga0157378_10569385
503 Ga0163162_10024269
504 Ga0163162_10120212
505 Ga0163162_10179165
506 Ga0163162_10648666
507 Ga0163162_10690949
508 Ga0157372_10015098
509 Ga0157372_10062668
510 Ga0157372_10143317
511 Ga0157372_10377401
512 Ga0157372_11043297
513 Ga0157375_10019724
514 Ga0157375_10027137
515 Ga0157375_10132092
516 Ga0157375_10288455
517 Ga0157375_10712584
518 Ga0157375_12283897
519 Ga0163163_10417239
520 Ga0163163_10884641
521 Ga0157380_10024418
522 Ga0157380_10058751
523 Ga0157380_10274615
524 Ga0163161_10000575
525 Ga0163161_10034856
526 Ga0163161_10040616
527 Ga0207656_10228857
528 Ga0207682_10119645
529 Ga0207710_10081001
530 Ga0207680_10076510
531 Ga0207680_10844203
532 Ga0207645_10093315
533 Ga0207645_10190819
534 Ga0207643_10382445
535 Ga0207705_10053414
536 Ga0207707_10005245
537 Ga0207695_10091344
538 Ga0207695_11011108
539 Ga0207671_10651038
540 Ga0207660_11100224
541 Ga0207657_10163203
542 Ga0207652_10045882
543 Ga0207650_10135425
544 Ga0207650_10792316
545 Ga0207659_10054220
546 Ga0207659_10055144
547 Ga0207659_10256791
548 Ga0207644_10048074
549 Ga0207644_10516377
550 Ga0207644_10569247
551 Ga0207706_10022255
552 Ga0207706_10122122
553 Ga0207706_10387904
554 Ga0207670_10339565
555 Ga0207670_10902766
556 Ga0207669_10761959
557 Ga0207669_10861954
558 Ga0207691_10024852
559 Ga0207691_10036496
560 Ga0207691_10046001
561 Ga0207711_10179354
562 Ga0207711_10933589
563 Ga0207689_10064942
564 Ga0207689_10086668
565 Ga0207661_10468466
566 Ga0207661_10965399
567 Ga0207679_10010787
568 Ga0207679_10109768
569 Ga0207679_10167259
570 Ga0207679_11588154
571 Ga0207667_10059306
572 Ga0207667_10188012
573 Ga0207651_10309348
574 Ga0207651_10370894
575 Ga0207712_10016262
576 Ga0207712_10020049
577 Ga0207712_10549994
578 Ga0207712_10879236
579 Ga0207712_10893735
580 Ga0207668_10079929
581 Ga0207640_10160409
582 Ga0207640_10337982
583 Ga0207640_10776378
584 Ga0207658_10082089
585 Ga0207677_11014172
586 Ga0207703_10065175
587 Ga0207703_10110559
588 Ga0207703_10117299
589 Ga0207703_10148642
590 Ga0207639_10001302
591 Ga0207639_10039819
592 Ga0207678_10011896
593 Ga0207678_10740149
594 Ga0207708_10255697
595 Ga0207708_10620966
596 Ga0207708_10722966
597 Ga0207641_10019331
598 Ga0207641_10041766
599 Ga0207641_10150722
600 Ga0207641_10456853
601 Ga0207648_10078448
602 Ga0207648_10421498
603 Ga0207676_10043381
604 Ga0207676_10150352
605 Ga0207676_10160761
606 Ga0207676_10464653
607 Ga0207674_10015205
608 Ga0207674_10090766
609 Ga0207674_10146277
610 Ga0207674_10328616
611 Ga0207674_10631956
612 Ga0207675_100026932
613 Ga0207675_100612729
614 Ga0207675_100643536
615 Ga0207683_10049733
616 Ga0207683_10241884
617 Ga0207683_10376384
618 Ga0207698_10393122
619 Ga0207428_10722180
620 Ga0268265_10027449
621 Ga0268265_10043949
622 Ga0268265_10647900
623 Ga0268265_11531865
624 Ga0268264_10025325
625 Ga0268264_10920716
626 Ga0307408_100050001
627 Ga0307408_100153576
628 Ga0307405_10057239
629 Ga0307405_10216526
630 Ga0307405_10663649
631 Ga0307413_10000302
632 Ga0307413_10003089
633 Ga0307413_10038026
634 Ga0307413_10817984
635 Ga0307410_10005643
636 Ga0307410_10021348
637 Ga0307410_10096985
638 Ga0307410_10098128
639 Ga0307410_10192926
640 Ga0307410_10194094
641 Ga0307410_10542146
642 Ga0307410_10565189
643 Ga0307406_10061488
644 Ga0307406_10468505
645 Ga0307406_11027253
646 Ga0307407_10014381
647 Ga0307407_10033607
648 Ga0307407_10041079
649 Ga0307407_10739088
650 Ga0307407_10988313
651 Ga0307412_10019869
652 Ga0307412_10037068
653 Ga0307412_10135079
654 Ga0307412_10823903
655 Ga0307409_100031610
656 Ga0307409_100052026
657 Ga0307409_100064889
658 Ga0307409_100087931
659 Ga0307409_100424175
660 Ga0307409_101090493
661 Ga0307416_100049823
662 Ga0307416_100128171
663 Ga0307416_100174303
664 Ga0307416_100254692
665 Ga0307416_100517145
666 Ga0307414_10009043
667 Ga0307414_10443386
668 Ga0307411_10006828
669 Ga0307411_10007947
670 Ga0307411_10195716
671 Ga0307411_11347368
672 Ga0307415_100035195
673 Ga0307415_100060439
674 Ga0307415_100119485
675 Ga0307415_100190956
676 Ga0307415_100349038
677 Ga0307415_100742610
678 Ga0307415_101156133
679 Ga0373923_0163390
680 Ga0373937_0054596
681 Ga0495668_0001177
682 Ga0496105_0186309
683 Ga0496109_0094131
684 Ga0496110_0672928
685 Ga0501072_0009726
686 Ga0501201_014481
687 Ga0501202_007727
688 Ga0501223_017543
689 Ga0501233_106501
690 Ga0501235_014113
691 Ga0501247_001219
692 Ga0501248_001599
693 Ga0501249_001190
694 Ga0501258_005396
695 Ga0501259_058381
696 Ga0501225_0026900
697 Ga0501225_0109976
698 Ga0501267_001593
699 Ga0501268_003058
700 Ga0501272_005645
701 nmdc:mga05p37_1674762_c1
702 nmdc:mga08y16_96170_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pmk-assembly1.cif.gz_F s. cerevisiae replisome-scf(dia2) complex bound to double-stranded dna (conformation i) 0.4525 56 145
4j41-assembly2.cif.gz_C the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne 0.4139 90 158
4j41-assembly1.cif.gz_B the crystal structure of a secreted protein esxb (mutant p67a) from bacillus anthracis str. sterne 0.4129 90 158
4j10-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (semet-labeled) from bacillus anthracis str. sterne 0.4075 90 158
4j7k-assembly1.cif.gz_A the crystal structure of a secreted protein esxb (mutant e54q) from bacillus anthracis str. sterne 0.4054 90 158
ID Description Score Start End Superfamily
af_E1JHX0_2_82_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5311 59 146 1.20.58.80
af_E1JHX0_2_82_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.5012 59 146 1.20.58.80
af_Q21892_1_228_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.479 7 162 1.20.140.150
af_Q17875_1_199_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4599 11 163 1.20.140.150
af_I6Y4R2_239_388_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4147 6 156 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A2J0Q7E7-F1-model_v4 Uncharacterized protein 0.878 1 99 GO:0016020
AF-A0A2J0Q7E7-F1-model_v4 Uncharacterized protein 0.8455 1 99 GO:0016020
AF-A0A7V1BWD1-F1-model_v4 Zinc ribbon domain-containing protein 0.8419 6 106 GO:0016020
AF-A0A7X7T8D5-F1-model_v4 Zinc ribbon domain-containing protein 0.8238 9 106 GO:0016020
AF-A0A1F5V827-F1-model_v4 Zinc ribbon domain-containing protein 0.8089 5 166 GO:0016020

Map