F418565

General Info

Members Datasets Scaffolds Average Seq Length
351 188 702 338

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100125722|Ga0068856_1001257221
Length 374
Sequence MKRVAKRANLDESLSSKADSAMTGPFAAAARILPGLALCCAVSAAGYLLQEIELRISGRAWIEALVLAILVGAAVRTAWTPSEKWKPGIGFSAKLLLEIAVVLLGASVSAATILAAGWQLLVCIILXXXXAIMLSFSIGRLLGLSKRLAILVACGNSICGNSAIVAVASVIGADGDEVASSIAFTAVLGVIVVLILPLIGALLHMSQLGYGAMAGLTVYAVPQVLAASAPVGAKAVQMGTLVKLCRVVMLGPVCLGLSLVSANLREERDEPAPHVTAGDRPRSGGPKFNQLVPWFIIGFLIMVALRSDGIIPAGALQPLAFAATVLTVISMAALGLGVDVRTVSRAGGPVTVTVILSLLALGVASFTTVRLLGL

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
143 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
148 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
170 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
171 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
172 2643221734 Bosea sp. Root670 Isolate Unclassified
173 2643221736 Bosea sp. Root483D1 Isolate Unclassified
174 2751185800 Brucella pituitosa AA2 Isolate Unclassified
175 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
176 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
177 2818991467 Bosea vestrisii 3192 Isolate Unclassified
178 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
179 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
180 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
181 2909042592 Labrys sp. LIt4 Isolate Nodule
182 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
183 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
184 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
185 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
186 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
187 641522639 Methylobacterium sp. 4-46 Isolate Nodule
188 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.3
Metatranscriptomes 0
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 3.99
Nodule 0.85
Rhizoplane 6.55
Rhizosphere 82.05
Stem 0
Stem Tuber 0
Unclassified 3.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100125722 3300005614 Bacteria 2567
2 MBSR1b_contig_8040148 2162886012 Bacteria 1671
3 JGI24737J22298_10000655 3300001990 Bacteria 12249
4 JGI25159J45721_1006196 3300002987 Bacteria 3619
5 JGI25151J46595_10055308 3300003187 Bacteria 1309
6 Ga0055526_1001499 3300003771 Bacteria 16526
7 Ga0055524_1000051 3300003775 Bacteria 146215
8 Ga0065165_1000879 3300005262 Bacteria 38853
9 Ga0065715_10212743 3300005293 Bacteria 1290
10 Ga0070658_10077127 3300005327 Bacteria 2734
11 Ga0070670_100000568 3300005331 Bacteria 29308
12 Ga0070670_100007058 3300005331 Bacteria 9524
13 Ga0070670_100011503 3300005331 Bacteria 7570
14 Ga0070670_100192620 3300005331 Bacteria 1771
15 Ga0068869_100092939 3300005334 Bacteria 2271
16 Ga0068869_100124228 3300005334 Bacteria 1977
17 Ga0070666_10003175 3300005335 Bacteria 9985
18 Ga0070666_10014064 3300005335 Bacteria 5088
19 Ga0070660_100100931 3300005339 Bacteria 2286
20 Ga0070660_100175626 3300005339 Bacteria 1732
21 Ga0070661_100013625 3300005344 Bacteria 5710
22 Ga0070661_100019475 3300005344 Bacteria 4838
23 Ga0070661_100200049 3300005344 Bacteria 1526
24 Ga0070668_100030358 3300005347 Bacteria 4109
25 Ga0070668_100208573 3300005347 Bacteria 1606
26 Ga0070669_100056629 3300005353 Bacteria 2874
27 Ga0070675_100010249 3300005354 Bacteria 7312
28 Ga0070675_100014545 3300005354 Bacteria 6207
29 Ga0070675_100049044 3300005354 Unclassified 3464
30 Ga0070671_100000802 3300005355 Bacteria 22701
31 Ga0070671_100014916 3300005355 Bacteria 6278
32 Ga0070671_100030239 3300005355 Bacteria 4470
33 Ga0070671_100033297 3300005355 Bacteria 4261
34 Ga0070671_100045700 3300005355 Bacteria 3640
35 Ga0070671_100112001 3300005355 Bacteria 2292
36 Ga0070674_100004353 3300005356 Bacteria 8075
37 Ga0070674_100007016 3300005356 Bacteria 6618
38 Ga0070674_100029690 3300005356 Bacteria 3606
39 Ga0070673_100000382 3300005364 Bacteria 23334
40 Ga0070673_100001392 3300005364 Bacteria 14139
41 Ga0070673_100157215 3300005364 Bacteria 1930
42 Ga0070659_100060709 3300005366 Bacteria 2987
43 Ga0070667_100006169 3300005367 Bacteria 9967
44 Ga0070667_100018496 3300005367 Bacteria 5778
45 Ga0070667_100054992 3300005367 Bacteria 3361
46 Ga0070667_100102343 3300005367 Bacteria 2475
47 Ga0070678_100060043 3300005456 Bacteria 2797
48 Ga0070678_100097872 3300005456 Bacteria 2267
49 Ga0070662_100020940 3300005457 Bacteria 4461
50 Ga0070662_100043010 3300005457 Bacteria 3229
51 Ga0070662_100073577 3300005457 Unclassified 2525
52 Ga0070662_100107237 3300005457 Bacteria 2123
53 Ga0070662_100111516 3300005457 Bacteria 2084
54 Ga0070662_100111833 3300005457 Bacteria 2081
55 Ga0068867_100022205 3300005459 Bacteria 4536
56 Ga0068867_100097589 3300005459 Bacteria 2239
57 Ga0068867_100118358 3300005459 Bacteria 2044
58 Ga0070672_100000917 3300005543 Bacteria 17678
59 Ga0070672_100005694 3300005543 Bacteria 8301
60 Ga0070672_100090702 3300005543 Bacteria 2465
61 Ga0070672_100111149 3300005543 Bacteria 2233
62 Ga0070672_100111900 3300005543 Bacteria 2226
63 Ga0070672_100222160 3300005543 Bacteria 1585
64 Ga0070693_100000995 3300005547 Bacteria 12639
65 Ga0070665_100018525 3300005548 Bacteria 6977
66 Ga0068855_100354737 3300005563 Bacteria 1615
67 Ga0070664_100001936 3300005564 Bacteria 16630
68 Ga0070664_100003075 3300005564 Bacteria 13484
69 Ga0070664_100003100 3300005564 Bacteria 13446
70 Ga0068852_100074383 3300005616 Bacteria 2992
71 Ga0068852_100085381 3300005616 Bacteria 2812
72 Ga0068859_100002392 3300005617 Bacteria 19100
73 Ga0068859_100026215 3300005617 Bacteria 5846
74 Ga0068859_100365329 3300005617 Bacteria 1538
75 Ga0068864_100001110 3300005618 Bacteria 22495
76 Ga0068864_100098786 3300005618 Bacteria 2586
77 Ga0068864_100159734 3300005618 Bacteria 2048
78 Ga0068866_10041229 3300005718 Unclassified 2289
79 Ga0068851_10070273 3300005834 Bacteria 1810
80 Ga0068863_100001056 3300005841 Bacteria 27521
81 Ga0068863_100010395 3300005841 Bacteria 9044
82 Ga0068858_100001926 3300005842 Bacteria 21164
83 Ga0068858_100003145 3300005842 Bacteria 16530
84 Ga0068860_100002768 3300005843 Bacteria 18241
85 Ga0068860_100003557 3300005843 Bacteria 16020
86 Ga0068860_100070204 3300005843 Bacteria 3330
87 Ga0068860_100485446 3300005843 Bacteria 1232
88 Ga0068862_100033058 3300005844 Bacteria 4369
89 Ga0070712_100011162 3300006175 Bacteria 5686
90 Ga0075369_10005502 3300006186 Bacteria 4737
91 Ga0097621_100067088 3300006237 Bacteria 2957
92 Ga0068871_100059172 3300006358 Bacteria 3121
93 Ga0068871_100174924 3300006358 Bacteria 1842
94 Ga0075433_10106291 3300006852 Bacteria 2488
95 Ga0097620_100002392 3300006931 Bacteria 19100
96 Ga0097620_100026215 3300006931 Bacteria 5846
97 Ga0097620_100365341 3300006931 Bacteria 1538
98 Ga0105250_10019414 3300009092 Bacteria 2748
99 Ga0105245_10295195 3300009098 Unclassified 1588
100 Ga0105242_10246160 3300009176 Bacteria 1609
101 Ga0105248_10001320 3300009177 Bacteria 27621
102 Ga0105248_10001492 3300009177 Bacteria 26034
103 Ga0105248_10012773 3300009177 Bacteria 9266
104 Ga0105248_10014927 3300009177 Bacteria 8552
105 Ga0105248_10030721 3300009177 Bacteria 6000
106 Ga0105248_10092756 3300009177 Bacteria 3401
107 Ga0105248_10107431 3300009177 Bacteria 3147
108 Ga0105248_10211038 3300009177 Bacteria 2188
109 Ga0105248_10596053 3300009177 Bacteria 1247
110 Ga0105237_10011576 3300009545 Bacteria 9330
111 Ga0105237_10310449 3300009545 Bacteria 1580
112 Ga0105249_10026474 3300009553 Bacteria 5226
113 Ga0105249_10074280 3300009553 Bacteria 3147
114 Ga0105239_10042112 3300010375 Bacteria 5004
115 Ga0157373_10006905 3300013100 Bacteria 8449
116 Ga0157370_10142711 3300013104 Bacteria 2231
117 Ga0157369_10220417 3300013105 Bacteria 1986
118 Ga0157374_10021943 3300013296 Bacteria 5689
119 Ga0157374_10165337 3300013296 Bacteria 2156
120 Ga0157378_10038554 3300013297 Bacteria 4235
121 Ga0163162_10003177 3300013306 Bacteria 15711
122 Ga0163162_10046387 3300013306 Bacteria 4355
123 Ga0163162_10067261 3300013306 Bacteria 3633
124 Ga0163162_10308253 3300013306 Bacteria 1715
125 Ga0157375_10005392 3300013308 Bacteria 11115
126 Ga0157375_10029221 3300013308 Bacteria 5181
127 Ga0163163_10006151 3300014325 Bacteria 10461
128 Ga0163163_10031977 3300014325 Bacteria 5081
129 Ga0157377_10031624 3300014745 Bacteria 2877
130 Ga0157379_10202427 3300014968 Bacteria 1795
131 Ga0163161_10078944 3300017792 Bacteria 2420
132 Ga0213872_10000525 3300021361 Bacteria 29968
133 Ga0213872_10001049 3300021361 Bacteria 19233
134 Ga0213872_10002041 3300021361 Bacteria 12277
135 Ga0213872_10006088 3300021361 Bacteria 6104
136 Ga0213872_10006595 3300021361 Bacteria 5791
137 Ga0213872_10022043 3300021361 Bacteria 2934
138 Ga0209130_1000127 3300025284 Bacteria 123652
139 Ga0209675_1000378 3300025291 Bacteria 37093
140 Ga0209025_1001569 3300025294 Bacteria 28971
141 Ga0209564_1000048 3300025295 Bacteria 364806
142 Ga0209256_1000041 3300025299 Bacteria 364827
143 Ga0209257_1015909 3300025304 Bacteria 3086
144 Ga0207656_10095145 3300025321 Bacteria 1358
145 Ga0207680_10010312 3300025903 Bacteria 4669
146 Ga0207680_10098126 3300025903 Bacteria 1877
147 Ga0207647_10007743 3300025904 Bacteria 7735
148 Ga0207645_10047282 3300025907 Bacteria 2748
149 Ga0207671_10077901 3300025914 Bacteria 2482
150 Ga0207657_10022343 3300025919 Bacteria 5922
151 Ga0207649_10003671 3300025920 Bacteria 8379
152 Ga0207681_10033748 3300025923 Bacteria 3358
153 Ga0207650_10001435 3300025925 Bacteria 17150
154 Ga0207650_10014688 3300025925 Bacteria 5441
155 Ga0207650_10038047 3300025925 Bacteria 3510
156 Ga0207659_10004095 3300025926 Bacteria 8795
157 Ga0207659_10018448 3300025926 Bacteria 4574
158 Ga0207644_10001395 3300025931 Bacteria 15580
159 Ga0207644_10002564 3300025931 Bacteria 11687
160 Ga0207644_10048077 3300025931 Bacteria 3047
161 Ga0207644_10072001 3300025931 Bacteria 2530
162 Ga0207644_10102557 3300025931 Unclassified 2152
163 Ga0207644_10114389 3300025931 Bacteria 2044
164 Ga0207644_10163802 3300025931 Bacteria 1730
165 Ga0207690_10010991 3300025932 Bacteria 5399
166 Ga0207706_10004410 3300025933 Bacteria 13224
167 Ga0207706_10009435 3300025933 Bacteria 8961
168 Ga0207706_10021653 3300025933 Bacteria 5770
169 Ga0207706_10037009 3300025933 Bacteria 4334
170 Ga0207706_10046083 3300025933 Bacteria 3861
171 Ga0207706_10070167 3300025933 Unclassified 3082
172 Ga0207706_10128916 3300025933 Bacteria 2225
173 Ga0207686_10111793 3300025934 Bacteria 1844
174 Ga0207709_10088357 3300025935 Bacteria 2017
175 Ga0207669_10014572 3300025937 Bacteria 3945
176 Ga0207669_10060534 3300025937 Bacteria 2322
177 Ga0207691_10002549 3300025940 Bacteria 17802
178 Ga0207691_10002991 3300025940 Bacteria 16490
179 Ga0207691_10023829 3300025940 Bacteria 5760
180 Ga0207691_10036769 3300025940 Bacteria 4537
181 Ga0207691_10049083 3300025940 Bacteria 3867
182 Ga0207711_10000869 3300025941 Bacteria 29230
183 Ga0207711_10007242 3300025941 Bacteria 9298
184 Ga0207711_10009584 3300025941 Bacteria 8071
185 Ga0207711_10030326 3300025941 Bacteria 4561
186 Ga0207711_10095130 3300025941 Bacteria 2627
187 Ga0207711_10189490 3300025941 Bacteria 1874
188 Ga0207689_10003432 3300025942 Bacteria 14472
189 Ga0207689_10061723 3300025942 Bacteria 3083
190 Ga0207679_10001219 3300025945 Bacteria 16351
191 Ga0207679_10008141 3300025945 Bacteria 6670
192 Ga0207679_10026710 3300025945 Bacteria 3984
193 Ga0207679_10104740 3300025945 Bacteria 2220
194 Ga0207651_10005320 3300025960 Bacteria 6596
195 Ga0207651_10074073 3300025960 Bacteria 2424
196 Ga0207712_10003235 3300025961 Bacteria 10349
197 Ga0207712_10018385 3300025961 Bacteria 4551
198 Ga0207668_10312884 3300025972 Bacteria 1300
199 Ga0207640_10027315 3300025981 Bacteria 3476
200 Ga0207640_10059084 3300025981 Bacteria 2529
201 Ga0207658_10009089 3300025986 Bacteria 6738
202 Ga0207658_10250719 3300025986 Bacteria 1504
203 Ga0207677_10043017 3300026023 Bacteria 3000
204 Ga0207703_10004152 3300026035 Bacteria 11945
205 Ga0207703_10009185 3300026035 Bacteria 7779
206 Ga0207703_10010752 3300026035 Bacteria 7143
207 Ga0207639_10118044 3300026041 Bacteria 2175
208 Ga0207678_10169514 3300026067 Bacteria 1864
209 Ga0207702_10387912 3300026078 Bacteria 1344
210 Ga0207641_10001513 3300026088 Bacteria 22775
211 Ga0207641_10062952 3300026088 Bacteria 3167
212 Ga0207648_10134232 3300026089 Bacteria 2179
213 Ga0207648_10290904 3300026089 Bacteria 1463
214 Ga0207676_10004215 3300026095 Bacteria 10156
215 Ga0207676_10006150 3300026095 Bacteria 8475
216 Ga0207676_10047530 3300026095 Bacteria 3326
217 Ga0207676_10143920 3300026095 Bacteria 2044
218 Ga0207674_10002082 3300026116 Bacteria 25342
219 Ga0207674_10102531 3300026116 Bacteria 2841
220 Ga0207674_10153689 3300026116 Bacteria 2257
221 Ga0207683_10003139 3300026121 Bacteria 14435
222 Ga0207683_10051639 3300026121 Bacteria 3603
223 Ga0207698_10097008 3300026142 Bacteria 2431
224 Ga0207698_10168667 3300026142 Bacteria 1925
225 Ga0268266_10164108 3300028379 Bacteria 2011
226 Ga0268265_10454134 3300028380 Bacteria 1197
227 Ga0268264_10005184 3300028381 Bacteria 11037
228 Ga0268264_10005781 3300028381 Bacteria 10486
229 Ga0268264_10371762 3300028381 Bacteria 1366
230 Ga0316583_10012001 3300032133 Bacteria 3126
231 Ga0373943_0048188 3300035170 Bacteria 2086
232 Ga0316582_0012465 3300036647 Bacteria 4747
233 Ga0395899_0061450 3300037312 Bacteria 2767
234 Ga0395899_0082991 3300037312 Bacteria 2330
235 Ga0395900_0056395 3300037418 Bacteria 4044
236 Ga0395900_0556226 3300037418 Bacteria 1091
237 Ga0395898_0086867 3300037466 Bacteria 3013
238 Ga0395905_0000086 3300037471 Bacteria 153641
239 Ga0395905_0000204 3300037471 Bacteria 92152
240 Ga0395905_0063186 3300037471 Bacteria 3463
241 Ga0395905_0169762 3300037471 Bacteria 2049
242 Ga0395905_0206883 3300037471 Bacteria 1839
243 Ga0395901_0091101 3300038443 Bacteria 3191
244 Ga0436361_0001464 3300039447 Bacteria 13289
245 Ga0436361_0028109 3300039447 Bacteria 9820
246 Ga0436361_0088276 3300039447 Bacteria 12442
247 Ga0436361_0267555 3300039447 Bacteria 1952
248 Ga0436361_0270082 3300039447 Bacteria 7438
249 Ga0436361_0614937 3300039447 Bacteria 8160
250 Ga0436361_0621527 3300039447 Bacteria 17412
251 Ga0436361_0835244 3300039447 Bacteria 4639
252 Ga0436361_0852293 3300039447 Bacteria 2397
253 Ga0436361_1102324 3300039447 Bacteria 6273
254 Ga0439448_0023553 3300042005 Bacteria 1922
255 Ga0466961_0095067 3300044693 Bacteria 1880
256 Ga0466963_0000903 3300044694 Bacteria 15076
257 Ga0466957_0001245 3300044842 Bacteria 13286
258 Ga0466957_0038907 3300044842 Bacteria 2868
259 Ga0466967_0000096 3300045976 Bacteria 31385
260 Ga0466967_0077077 3300045976 Bacteria 3000
261 Ga0466967_0369837 3300045976 Bacteria 1390
262 Ga0495592_0098075 3300046454 Bacteria 2092
263 Ga0495585_0056607 3300046492 Unclassified 2165
264 Ga0495663_0015801 3300046525 Unclassified 2130
265 Ga0495663_0040723 3300046525 Unclassified 1411
266 Ga0495587_0088507 3300046536 Bacteria 1791
267 Ga0495598_0001777 3300046537 Bacteria 4336
268 Ga0495645_0096103 3300046543 Bacteria 2111
269 Ga0495661_0115203 3300046665 Unclassified 1493
270 Ga0495669_0002202 3300046684 Bacteria 8004
271 Ga0495669_0004377 3300046684 Bacteria 5829
272 Ga0495669_0013921 3300046684 Unclassified 3434
273 Ga0495670_0094702 3300046691 Unclassified 1531
274 Ga0495677_0018176 3300047445 Unclassified 2548
275 Ga0495677_0018940 3300047445 Unclassified 2496
276 Ga0495602_0024702 3300048088 Bacteria 5828
277 Ga0496101_0137214 3300048904 Bacteria 1862
278 Ga0496102_0122773 3300048905 Bacteria 2427
279 Ga0496105_0097233 3300048908 Bacteria 2432
280 Ga0496106_0576496 3300048909 Bacteria 902
281 Ga0496107_0016843 3300048910 Bacteria 5138
282 Ga0496107_0224946 3300048910 Bacteria 1396
283 Ga0496109_0007760 3300048912 Bacteria 9085
284 Ga0496109_0040609 3300048912 Bacteria 4213
285 Ga0496109_0201891 3300048912 Bacteria 1869
286 Ga0496110_0009164 3300048913 Bacteria 7995
287 Ga0496110_0047492 3300048913 Bacteria 3760
288 Ga0496110_0177736 3300048913 Bacteria 1932
289 Ga0496111_0001927 3300048914 Bacteria 12272
290 Ga0496111_0003199 3300048914 Bacteria 10105
291 Ga0496111_0006450 3300048914 Bacteria 7620
292 Ga0496111_0220544 3300048914 Bacteria 1409
293 Ga0496112_0037126 3300048915 Bacteria 4756
294 Ga0496112_0060902 3300048915 Bacteria 3719
295 Ga0496113_0002904 3300048916 Bacteria 10101
296 Ga0496113_0070296 3300048916 Bacteria 2660
297 Ga0496114_0013182 3300048917 Bacteria 6626
298 Ga0496114_0057809 3300048917 Bacteria 3238
299 Ga0496119_0079453 3300048922 Bacteria 1895
300 Ga0496120_0082154 3300048923 Bacteria 1742
301 Ga0496122_0073853 3300048925 Bacteria 2415
302 Ga0496123_0004066 3300048926 Bacteria 15753
303 Ga0496123_0048131 3300048926 Bacteria 2871
304 Ga0496123_0085546 3300048926 Bacteria 1896
305 Ga0496124_0000306 3300048927 Bacteria 90641
306 Ga0496124_0000858 3300048927 Bacteria 49650
307 Ga0496124_0005697 3300048927 Bacteria 13878
308 Ga0496124_0017385 3300048927 Bacteria 6778
309 Ga0496124_0067158 3300048927 Bacteria 2984
310 Ga0496125_0005624 3300048928 Bacteria 13842
311 Ga0496126_0000849 3300048929 Bacteria 54058
312 Ga0496126_0036512 3300048929 Bacteria 4595
313 Ga0501031_0078769 3300049568 Bacteria 2147
314 Ga0501032_0038598 3300049569 Bacteria 3251
315 Ga0501033_0069075 3300049570 Bacteria 2597
316 Ga0501034_0073456 3300049571 Bacteria 3429
317 Ga0501034_0132767 3300049571 Bacteria 2472
318 Ga0501034_0439550 3300049571 Bacteria 1223
319 Ga0501036_0214115 3300049572 Bacteria 1618
320 Ga0501037_0100566 3300049573 Bacteria 2087
321 Ga0501037_0188082 3300049573 Bacteria 1463
322 Ga0501038_0047015 3300049574 Bacteria 3739
323 Ga0501043_0011153 3300049579 Bacteria 7038
324 Ga0501047_0060365 3300049581 Bacteria 3660
325 Ga0501083_0131380 3300049744 Bacteria 1642
326 Ga0501035_0051206 3300049822 Bacteria 3698
327 Ga0501044_0062276 3300049823 Bacteria 3813
328 Ga0501044_0286447 3300049823 Bacteria 1580
329 nmdc:mga0a205_1208_c1 3300050515 Bacteria 21612
330 nmdc:mga0sz30_106371_c1 3300050516 Bacteria 1227
331 Ga0500618_000705 3300053125 Bacteria 19616
332 2512037334 2511231221 Bacteria 6846400
333 2545679221 2545555834 Bacteria 8130841
334 2600225009 2599185359 Bacteria 4772316
335 2644733186 2643221734 Bacteria 5365412
336 2644744132 2643221736 Bacteria 6608466
337 2753358368 2751185800 Bacteria 5467370
338 2758640593 2758568016 Bacteria 5645291
339 2819713859 2818991466 Bacteria 4748179
340 2819720412 2818991467 Bacteria 5893227
341 2879164130 2879163058 Bacteria 4223965
342 2884964799 2884960567 Bacteria 5437054
343 2885432950 2885429604 Bacteria 3642894
344 2909044709 2909042592 Bacteria 6499737
345 2928528414 2928526807 Bacteria 4760224
346 2928969963 2928968154 Bacteria 4633371
347 2984568851 2984564862 Bacteria 4339992
348 2989354973 2989349275 Bacteria 6349068
349 3000866422 3000865235 Bacteria 3106258
350 641644689 641522639 Bacteria 7737025
351 8054005294 8054002106 Bacteria 7987183
352 Ga0068856_100125722
353 MBSR1b_contig_8040148
354 JGI24737J22298_10000655
355 JGI25159J45721_1006196
356 JGI25151J46595_10055308
357 Ga0055526_1001499
358 Ga0055524_1000051
359 Ga0065165_1000879
360 Ga0065715_10212743
361 Ga0070658_10077127
362 Ga0070670_100000568
363 Ga0070670_100007058
364 Ga0070670_100011503
365 Ga0070670_100192620
366 Ga0068869_100092939
367 Ga0068869_100124228
368 Ga0070666_10003175
369 Ga0070666_10014064
370 Ga0070660_100100931
371 Ga0070660_100175626
372 Ga0070661_100013625
373 Ga0070661_100019475
374 Ga0070661_100200049
375 Ga0070668_100030358
376 Ga0070668_100208573
377 Ga0070669_100056629
378 Ga0070675_100010249
379 Ga0070675_100014545
380 Ga0070675_100049044
381 Ga0070671_100000802
382 Ga0070671_100014916
383 Ga0070671_100030239
384 Ga0070671_100033297
385 Ga0070671_100045700
386 Ga0070671_100112001
387 Ga0070674_100004353
388 Ga0070674_100007016
389 Ga0070674_100029690
390 Ga0070673_100000382
391 Ga0070673_100001392
392 Ga0070673_100157215
393 Ga0070659_100060709
394 Ga0070667_100006169
395 Ga0070667_100018496
396 Ga0070667_100054992
397 Ga0070667_100102343
398 Ga0070678_100060043
399 Ga0070678_100097872
400 Ga0070662_100020940
401 Ga0070662_100043010
402 Ga0070662_100073577
403 Ga0070662_100107237
404 Ga0070662_100111516
405 Ga0070662_100111833
406 Ga0068867_100022205
407 Ga0068867_100097589
408 Ga0068867_100118358
409 Ga0070672_100000917
410 Ga0070672_100005694
411 Ga0070672_100090702
412 Ga0070672_100111149
413 Ga0070672_100111900
414 Ga0070672_100222160
415 Ga0070693_100000995
416 Ga0070665_100018525
417 Ga0068855_100354737
418 Ga0070664_100001936
419 Ga0070664_100003075
420 Ga0070664_100003100
421 Ga0068852_100074383
422 Ga0068852_100085381
423 Ga0068859_100002392
424 Ga0068859_100026215
425 Ga0068859_100365329
426 Ga0068864_100001110
427 Ga0068864_100098786
428 Ga0068864_100159734
429 Ga0068866_10041229
430 Ga0068851_10070273
431 Ga0068863_100001056
432 Ga0068863_100010395
433 Ga0068858_100001926
434 Ga0068858_100003145
435 Ga0068860_100002768
436 Ga0068860_100003557
437 Ga0068860_100070204
438 Ga0068860_100485446
439 Ga0068862_100033058
440 Ga0070712_100011162
441 Ga0075369_10005502
442 Ga0097621_100067088
443 Ga0068871_100059172
444 Ga0068871_100174924
445 Ga0075433_10106291
446 Ga0097620_100002392
447 Ga0097620_100026215
448 Ga0097620_100365341
449 Ga0105250_10019414
450 Ga0105245_10295195
451 Ga0105242_10246160
452 Ga0105248_10001320
453 Ga0105248_10001492
454 Ga0105248_10012773
455 Ga0105248_10014927
456 Ga0105248_10030721
457 Ga0105248_10092756
458 Ga0105248_10107431
459 Ga0105248_10211038
460 Ga0105248_10596053
461 Ga0105237_10011576
462 Ga0105237_10310449
463 Ga0105249_10026474
464 Ga0105249_10074280
465 Ga0105239_10042112
466 Ga0157373_10006905
467 Ga0157370_10142711
468 Ga0157369_10220417
469 Ga0157374_10021943
470 Ga0157374_10165337
471 Ga0157378_10038554
472 Ga0163162_10003177
473 Ga0163162_10046387
474 Ga0163162_10067261
475 Ga0163162_10308253
476 Ga0157375_10005392
477 Ga0157375_10029221
478 Ga0163163_10006151
479 Ga0163163_10031977
480 Ga0157377_10031624
481 Ga0157379_10202427
482 Ga0163161_10078944
483 Ga0213872_10000525
484 Ga0213872_10001049
485 Ga0213872_10002041
486 Ga0213872_10006088
487 Ga0213872_10006595
488 Ga0213872_10022043
489 Ga0209130_1000127
490 Ga0209675_1000378
491 Ga0209025_1001569
492 Ga0209564_1000048
493 Ga0209256_1000041
494 Ga0209257_1015909
495 Ga0207656_10095145
496 Ga0207680_10010312
497 Ga0207680_10098126
498 Ga0207647_10007743
499 Ga0207645_10047282
500 Ga0207671_10077901
501 Ga0207657_10022343
502 Ga0207649_10003671
503 Ga0207681_10033748
504 Ga0207650_10001435
505 Ga0207650_10014688
506 Ga0207650_10038047
507 Ga0207659_10004095
508 Ga0207659_10018448
509 Ga0207644_10001395
510 Ga0207644_10002564
511 Ga0207644_10048077
512 Ga0207644_10072001
513 Ga0207644_10102557
514 Ga0207644_10114389
515 Ga0207644_10163802
516 Ga0207690_10010991
517 Ga0207706_10004410
518 Ga0207706_10009435
519 Ga0207706_10021653
520 Ga0207706_10037009
521 Ga0207706_10046083
522 Ga0207706_10070167
523 Ga0207706_10128916
524 Ga0207686_10111793
525 Ga0207709_10088357
526 Ga0207669_10014572
527 Ga0207669_10060534
528 Ga0207691_10002549
529 Ga0207691_10002991
530 Ga0207691_10023829
531 Ga0207691_10036769
532 Ga0207691_10049083
533 Ga0207711_10000869
534 Ga0207711_10007242
535 Ga0207711_10009584
536 Ga0207711_10030326
537 Ga0207711_10095130
538 Ga0207711_10189490
539 Ga0207689_10003432
540 Ga0207689_10061723
541 Ga0207679_10001219
542 Ga0207679_10008141
543 Ga0207679_10026710
544 Ga0207679_10104740
545 Ga0207651_10005320
546 Ga0207651_10074073
547 Ga0207712_10003235
548 Ga0207712_10018385
549 Ga0207668_10312884
550 Ga0207640_10027315
551 Ga0207640_10059084
552 Ga0207658_10009089
553 Ga0207658_10250719
554 Ga0207677_10043017
555 Ga0207703_10004152
556 Ga0207703_10009185
557 Ga0207703_10010752
558 Ga0207639_10118044
559 Ga0207678_10169514
560 Ga0207702_10387912
561 Ga0207641_10001513
562 Ga0207641_10062952
563 Ga0207648_10134232
564 Ga0207648_10290904
565 Ga0207676_10004215
566 Ga0207676_10006150
567 Ga0207676_10047530
568 Ga0207676_10143920
569 Ga0207674_10002082
570 Ga0207674_10102531
571 Ga0207674_10153689
572 Ga0207683_10003139
573 Ga0207683_10051639
574 Ga0207698_10097008
575 Ga0207698_10168667
576 Ga0268266_10164108
577 Ga0268265_10454134
578 Ga0268264_10005184
579 Ga0268264_10005781
580 Ga0268264_10371762
581 Ga0316583_10012001
582 Ga0373943_0048188
583 Ga0316582_0012465
584 Ga0395899_0061450
585 Ga0395899_0082991
586 Ga0395900_0056395
587 Ga0395900_0556226
588 Ga0395898_0086867
589 Ga0395905_0000086
590 Ga0395905_0000204
591 Ga0395905_0063186
592 Ga0395905_0169762
593 Ga0395905_0206883
594 Ga0395901_0091101
595 Ga0436361_0001464
596 Ga0436361_0028109
597 Ga0436361_0088276
598 Ga0436361_0267555
599 Ga0436361_0270082
600 Ga0436361_0614937
601 Ga0436361_0621527
602 Ga0436361_0835244
603 Ga0436361_0852293
604 Ga0436361_1102324
605 Ga0439448_0023553
606 Ga0466961_0095067
607 Ga0466963_0000903
608 Ga0466957_0001245
609 Ga0466957_0038907
610 Ga0466967_0000096
611 Ga0466967_0077077
612 Ga0466967_0369837
613 Ga0495592_0098075
614 Ga0495585_0056607
615 Ga0495663_0015801
616 Ga0495663_0040723
617 Ga0495587_0088507
618 Ga0495598_0001777
619 Ga0495645_0096103
620 Ga0495661_0115203
621 Ga0495669_0002202
622 Ga0495669_0004377
623 Ga0495669_0013921
624 Ga0495670_0094702
625 Ga0495677_0018176
626 Ga0495677_0018940
627 Ga0495602_0024702
628 Ga0496101_0137214
629 Ga0496102_0122773
630 Ga0496105_0097233
631 Ga0496106_0576496
632 Ga0496107_0016843
633 Ga0496107_0224946
634 Ga0496109_0007760
635 Ga0496109_0040609
636 Ga0496109_0201891
637 Ga0496110_0009164
638 Ga0496110_0047492
639 Ga0496110_0177736
640 Ga0496111_0001927
641 Ga0496111_0003199
642 Ga0496111_0006450
643 Ga0496111_0220544
644 Ga0496112_0037126
645 Ga0496112_0060902
646 Ga0496113_0002904
647 Ga0496113_0070296
648 Ga0496114_0013182
649 Ga0496114_0057809
650 Ga0496119_0079453
651 Ga0496120_0082154
652 Ga0496122_0073853
653 Ga0496123_0004066
654 Ga0496123_0048131
655 Ga0496123_0085546
656 Ga0496124_0000306
657 Ga0496124_0000858
658 Ga0496124_0005697
659 Ga0496124_0017385
660 Ga0496124_0067158
661 Ga0496125_0005624
662 Ga0496126_0000849
663 Ga0496126_0036512
664 Ga0501031_0078769
665 Ga0501032_0038598
666 Ga0501033_0069075
667 Ga0501034_0073456
668 Ga0501034_0132767
669 Ga0501034_0439550
670 Ga0501036_0214115
671 Ga0501037_0100566
672 Ga0501037_0188082
673 Ga0501038_0047015
674 Ga0501043_0011153
675 Ga0501047_0060365
676 Ga0501083_0131380
677 Ga0501035_0051206
678 Ga0501044_0062276
679 Ga0501044_0286447
680 nmdc:mga0a205_1208_c1
681 nmdc:mga0sz30_106371_c1
682 Ga0500618_000705
683 2512037334
684 2545679221
685 2600225009
686 2644733186
687 2644744132
688 2753358368
689 2758640593
690 2819713859
691 2819720412
692 2879164130
693 2884964799
694 2885432950
695 2909044709
696 2928528414
697 2928969963
698 2984568851
699 2989354973
700 3000866422
701 641644689
702 8054005294

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03601

Cons_hypoth698

Conserved hypothetical protein 698

34

354

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xar-assembly2.cif.gz_D structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.5482 16 346
5a1s-assembly2.cif.gz_B crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. 0.5172 16 346
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.5079 15 334
5xar-assembly2.cif.gz_D structural insights into the elevator-like mechanism of the sodium/citrate symporter cits 0.497 16 346
5a1s-assembly2.cif.gz_B crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. 0.4885 16 346
ID Description Score Start End Superfamily
af_Q2G134_11_311_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8595 19 330 1.20.1530.20
af_Q2G134_11_311_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8518 19 330 1.20.1530.20
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7826 18 330 1.20.1530.20
af_P62723_18_326_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.7783 18 330 1.20.1530.20
af_A0A1D6MVG0_125_298_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6218 7 248 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A381I5V7-F1-model_v4 Membrane protein 0.9455 58 247 GO:0005886
AF-A0A7K3LYL8-F1-model_v4 Putative sulfate exporter family transporter 0.9392 16 348 GO:0005886
AF-A0A806H8Q8-F1-model_v4 deleted 0.9391 63 349
AF-A0A7V8KL73-F1-model_v4 deleted 0.9379 77 351
AF-A0A5C5UQK9-F1-model_v4 Putative sulfate exporter family transporter 0.9377 15 347 GO:0005886

Map