F418565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 188 | 702 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100125722|Ga0068856_1001257221 |
| Length | 374 |
| Sequence | MKRVAKRANLDESLSSKADSAMTGPFAAAARILPGLALCCAVSAAGYLLQEIELRISGRAWIEALVLAILVGAAVRTAWTPSEKWKPGIGFSAKLLLEIAVVLLGASVSAATILAAGWQLLVCIILXXXXAIMLSFSIGRLLGLSKRLAILVACGNSICGNSAIVAVASVIGADGDEVASSIAFTAVLGVIVVLILPLIGALLHMSQLGYGAMAGLTVYAVPQVLAASAPVGAKAVQMGTLVKLCRVVMLGPVCLGLSLVSANLREERDEPAPHVTAGDRPRSGGPKFNQLVPWFIIGFLIMVALRSDGIIPAGALQPLAFAATVLTVISMAALGLGVDVRTVSRAGGPVTVTVILSLLALGVASFTTVRLLGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 66 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 70 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 112 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 117 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 118 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 119 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 120 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 121 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 122 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 123 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 137 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 138 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 139 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 140 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 143 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 144 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 145 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 146 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 147 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 148 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 149 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 150 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 151 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 152 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 153 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 154 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 157 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 164 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 167 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 168 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 169 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 170 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 171 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 172 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 173 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 174 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 175 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 176 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 177 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 178 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 179 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 180 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 181 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 182 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 183 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 184 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 185 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 186 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 187 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 188 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.3 |
| Metatranscriptomes | 0 |
| Isolates | 5.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 3.99 |
| Nodule | 0.85 |
| Rhizoplane | 6.55 |
| Rhizosphere | 82.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068856_100125722 | 3300005614 | Bacteria | 2567 |
| 2 | MBSR1b_contig_8040148 | 2162886012 | Bacteria | 1671 |
| 3 | JGI24737J22298_10000655 | 3300001990 | Bacteria | 12249 |
| 4 | JGI25159J45721_1006196 | 3300002987 | Bacteria | 3619 |
| 5 | JGI25151J46595_10055308 | 3300003187 | Bacteria | 1309 |
| 6 | Ga0055526_1001499 | 3300003771 | Bacteria | 16526 |
| 7 | Ga0055524_1000051 | 3300003775 | Bacteria | 146215 |
| 8 | Ga0065165_1000879 | 3300005262 | Bacteria | 38853 |
| 9 | Ga0065715_10212743 | 3300005293 | Bacteria | 1290 |
| 10 | Ga0070658_10077127 | 3300005327 | Bacteria | 2734 |
| 11 | Ga0070670_100000568 | 3300005331 | Bacteria | 29308 |
| 12 | Ga0070670_100007058 | 3300005331 | Bacteria | 9524 |
| 13 | Ga0070670_100011503 | 3300005331 | Bacteria | 7570 |
| 14 | Ga0070670_100192620 | 3300005331 | Bacteria | 1771 |
| 15 | Ga0068869_100092939 | 3300005334 | Bacteria | 2271 |
| 16 | Ga0068869_100124228 | 3300005334 | Bacteria | 1977 |
| 17 | Ga0070666_10003175 | 3300005335 | Bacteria | 9985 |
| 18 | Ga0070666_10014064 | 3300005335 | Bacteria | 5088 |
| 19 | Ga0070660_100100931 | 3300005339 | Bacteria | 2286 |
| 20 | Ga0070660_100175626 | 3300005339 | Bacteria | 1732 |
| 21 | Ga0070661_100013625 | 3300005344 | Bacteria | 5710 |
| 22 | Ga0070661_100019475 | 3300005344 | Bacteria | 4838 |
| 23 | Ga0070661_100200049 | 3300005344 | Bacteria | 1526 |
| 24 | Ga0070668_100030358 | 3300005347 | Bacteria | 4109 |
| 25 | Ga0070668_100208573 | 3300005347 | Bacteria | 1606 |
| 26 | Ga0070669_100056629 | 3300005353 | Bacteria | 2874 |
| 27 | Ga0070675_100010249 | 3300005354 | Bacteria | 7312 |
| 28 | Ga0070675_100014545 | 3300005354 | Bacteria | 6207 |
| 29 | Ga0070675_100049044 | 3300005354 | Unclassified | 3464 |
| 30 | Ga0070671_100000802 | 3300005355 | Bacteria | 22701 |
| 31 | Ga0070671_100014916 | 3300005355 | Bacteria | 6278 |
| 32 | Ga0070671_100030239 | 3300005355 | Bacteria | 4470 |
| 33 | Ga0070671_100033297 | 3300005355 | Bacteria | 4261 |
| 34 | Ga0070671_100045700 | 3300005355 | Bacteria | 3640 |
| 35 | Ga0070671_100112001 | 3300005355 | Bacteria | 2292 |
| 36 | Ga0070674_100004353 | 3300005356 | Bacteria | 8075 |
| 37 | Ga0070674_100007016 | 3300005356 | Bacteria | 6618 |
| 38 | Ga0070674_100029690 | 3300005356 | Bacteria | 3606 |
| 39 | Ga0070673_100000382 | 3300005364 | Bacteria | 23334 |
| 40 | Ga0070673_100001392 | 3300005364 | Bacteria | 14139 |
| 41 | Ga0070673_100157215 | 3300005364 | Bacteria | 1930 |
| 42 | Ga0070659_100060709 | 3300005366 | Bacteria | 2987 |
| 43 | Ga0070667_100006169 | 3300005367 | Bacteria | 9967 |
| 44 | Ga0070667_100018496 | 3300005367 | Bacteria | 5778 |
| 45 | Ga0070667_100054992 | 3300005367 | Bacteria | 3361 |
| 46 | Ga0070667_100102343 | 3300005367 | Bacteria | 2475 |
| 47 | Ga0070678_100060043 | 3300005456 | Bacteria | 2797 |
| 48 | Ga0070678_100097872 | 3300005456 | Bacteria | 2267 |
| 49 | Ga0070662_100020940 | 3300005457 | Bacteria | 4461 |
| 50 | Ga0070662_100043010 | 3300005457 | Bacteria | 3229 |
| 51 | Ga0070662_100073577 | 3300005457 | Unclassified | 2525 |
| 52 | Ga0070662_100107237 | 3300005457 | Bacteria | 2123 |
| 53 | Ga0070662_100111516 | 3300005457 | Bacteria | 2084 |
| 54 | Ga0070662_100111833 | 3300005457 | Bacteria | 2081 |
| 55 | Ga0068867_100022205 | 3300005459 | Bacteria | 4536 |
| 56 | Ga0068867_100097589 | 3300005459 | Bacteria | 2239 |
| 57 | Ga0068867_100118358 | 3300005459 | Bacteria | 2044 |
| 58 | Ga0070672_100000917 | 3300005543 | Bacteria | 17678 |
| 59 | Ga0070672_100005694 | 3300005543 | Bacteria | 8301 |
| 60 | Ga0070672_100090702 | 3300005543 | Bacteria | 2465 |
| 61 | Ga0070672_100111149 | 3300005543 | Bacteria | 2233 |
| 62 | Ga0070672_100111900 | 3300005543 | Bacteria | 2226 |
| 63 | Ga0070672_100222160 | 3300005543 | Bacteria | 1585 |
| 64 | Ga0070693_100000995 | 3300005547 | Bacteria | 12639 |
| 65 | Ga0070665_100018525 | 3300005548 | Bacteria | 6977 |
| 66 | Ga0068855_100354737 | 3300005563 | Bacteria | 1615 |
| 67 | Ga0070664_100001936 | 3300005564 | Bacteria | 16630 |
| 68 | Ga0070664_100003075 | 3300005564 | Bacteria | 13484 |
| 69 | Ga0070664_100003100 | 3300005564 | Bacteria | 13446 |
| 70 | Ga0068852_100074383 | 3300005616 | Bacteria | 2992 |
| 71 | Ga0068852_100085381 | 3300005616 | Bacteria | 2812 |
| 72 | Ga0068859_100002392 | 3300005617 | Bacteria | 19100 |
| 73 | Ga0068859_100026215 | 3300005617 | Bacteria | 5846 |
| 74 | Ga0068859_100365329 | 3300005617 | Bacteria | 1538 |
| 75 | Ga0068864_100001110 | 3300005618 | Bacteria | 22495 |
| 76 | Ga0068864_100098786 | 3300005618 | Bacteria | 2586 |
| 77 | Ga0068864_100159734 | 3300005618 | Bacteria | 2048 |
| 78 | Ga0068866_10041229 | 3300005718 | Unclassified | 2289 |
| 79 | Ga0068851_10070273 | 3300005834 | Bacteria | 1810 |
| 80 | Ga0068863_100001056 | 3300005841 | Bacteria | 27521 |
| 81 | Ga0068863_100010395 | 3300005841 | Bacteria | 9044 |
| 82 | Ga0068858_100001926 | 3300005842 | Bacteria | 21164 |
| 83 | Ga0068858_100003145 | 3300005842 | Bacteria | 16530 |
| 84 | Ga0068860_100002768 | 3300005843 | Bacteria | 18241 |
| 85 | Ga0068860_100003557 | 3300005843 | Bacteria | 16020 |
| 86 | Ga0068860_100070204 | 3300005843 | Bacteria | 3330 |
| 87 | Ga0068860_100485446 | 3300005843 | Bacteria | 1232 |
| 88 | Ga0068862_100033058 | 3300005844 | Bacteria | 4369 |
| 89 | Ga0070712_100011162 | 3300006175 | Bacteria | 5686 |
| 90 | Ga0075369_10005502 | 3300006186 | Bacteria | 4737 |
| 91 | Ga0097621_100067088 | 3300006237 | Bacteria | 2957 |
| 92 | Ga0068871_100059172 | 3300006358 | Bacteria | 3121 |
| 93 | Ga0068871_100174924 | 3300006358 | Bacteria | 1842 |
| 94 | Ga0075433_10106291 | 3300006852 | Bacteria | 2488 |
| 95 | Ga0097620_100002392 | 3300006931 | Bacteria | 19100 |
| 96 | Ga0097620_100026215 | 3300006931 | Bacteria | 5846 |
| 97 | Ga0097620_100365341 | 3300006931 | Bacteria | 1538 |
| 98 | Ga0105250_10019414 | 3300009092 | Bacteria | 2748 |
| 99 | Ga0105245_10295195 | 3300009098 | Unclassified | 1588 |
| 100 | Ga0105242_10246160 | 3300009176 | Bacteria | 1609 |
| 101 | Ga0105248_10001320 | 3300009177 | Bacteria | 27621 |
| 102 | Ga0105248_10001492 | 3300009177 | Bacteria | 26034 |
| 103 | Ga0105248_10012773 | 3300009177 | Bacteria | 9266 |
| 104 | Ga0105248_10014927 | 3300009177 | Bacteria | 8552 |
| 105 | Ga0105248_10030721 | 3300009177 | Bacteria | 6000 |
| 106 | Ga0105248_10092756 | 3300009177 | Bacteria | 3401 |
| 107 | Ga0105248_10107431 | 3300009177 | Bacteria | 3147 |
| 108 | Ga0105248_10211038 | 3300009177 | Bacteria | 2188 |
| 109 | Ga0105248_10596053 | 3300009177 | Bacteria | 1247 |
| 110 | Ga0105237_10011576 | 3300009545 | Bacteria | 9330 |
| 111 | Ga0105237_10310449 | 3300009545 | Bacteria | 1580 |
| 112 | Ga0105249_10026474 | 3300009553 | Bacteria | 5226 |
| 113 | Ga0105249_10074280 | 3300009553 | Bacteria | 3147 |
| 114 | Ga0105239_10042112 | 3300010375 | Bacteria | 5004 |
| 115 | Ga0157373_10006905 | 3300013100 | Bacteria | 8449 |
| 116 | Ga0157370_10142711 | 3300013104 | Bacteria | 2231 |
| 117 | Ga0157369_10220417 | 3300013105 | Bacteria | 1986 |
| 118 | Ga0157374_10021943 | 3300013296 | Bacteria | 5689 |
| 119 | Ga0157374_10165337 | 3300013296 | Bacteria | 2156 |
| 120 | Ga0157378_10038554 | 3300013297 | Bacteria | 4235 |
| 121 | Ga0163162_10003177 | 3300013306 | Bacteria | 15711 |
| 122 | Ga0163162_10046387 | 3300013306 | Bacteria | 4355 |
| 123 | Ga0163162_10067261 | 3300013306 | Bacteria | 3633 |
| 124 | Ga0163162_10308253 | 3300013306 | Bacteria | 1715 |
| 125 | Ga0157375_10005392 | 3300013308 | Bacteria | 11115 |
| 126 | Ga0157375_10029221 | 3300013308 | Bacteria | 5181 |
| 127 | Ga0163163_10006151 | 3300014325 | Bacteria | 10461 |
| 128 | Ga0163163_10031977 | 3300014325 | Bacteria | 5081 |
| 129 | Ga0157377_10031624 | 3300014745 | Bacteria | 2877 |
| 130 | Ga0157379_10202427 | 3300014968 | Bacteria | 1795 |
| 131 | Ga0163161_10078944 | 3300017792 | Bacteria | 2420 |
| 132 | Ga0213872_10000525 | 3300021361 | Bacteria | 29968 |
| 133 | Ga0213872_10001049 | 3300021361 | Bacteria | 19233 |
| 134 | Ga0213872_10002041 | 3300021361 | Bacteria | 12277 |
| 135 | Ga0213872_10006088 | 3300021361 | Bacteria | 6104 |
| 136 | Ga0213872_10006595 | 3300021361 | Bacteria | 5791 |
| 137 | Ga0213872_10022043 | 3300021361 | Bacteria | 2934 |
| 138 | Ga0209130_1000127 | 3300025284 | Bacteria | 123652 |
| 139 | Ga0209675_1000378 | 3300025291 | Bacteria | 37093 |
| 140 | Ga0209025_1001569 | 3300025294 | Bacteria | 28971 |
| 141 | Ga0209564_1000048 | 3300025295 | Bacteria | 364806 |
| 142 | Ga0209256_1000041 | 3300025299 | Bacteria | 364827 |
| 143 | Ga0209257_1015909 | 3300025304 | Bacteria | 3086 |
| 144 | Ga0207656_10095145 | 3300025321 | Bacteria | 1358 |
| 145 | Ga0207680_10010312 | 3300025903 | Bacteria | 4669 |
| 146 | Ga0207680_10098126 | 3300025903 | Bacteria | 1877 |
| 147 | Ga0207647_10007743 | 3300025904 | Bacteria | 7735 |
| 148 | Ga0207645_10047282 | 3300025907 | Bacteria | 2748 |
| 149 | Ga0207671_10077901 | 3300025914 | Bacteria | 2482 |
| 150 | Ga0207657_10022343 | 3300025919 | Bacteria | 5922 |
| 151 | Ga0207649_10003671 | 3300025920 | Bacteria | 8379 |
| 152 | Ga0207681_10033748 | 3300025923 | Bacteria | 3358 |
| 153 | Ga0207650_10001435 | 3300025925 | Bacteria | 17150 |
| 154 | Ga0207650_10014688 | 3300025925 | Bacteria | 5441 |
| 155 | Ga0207650_10038047 | 3300025925 | Bacteria | 3510 |
| 156 | Ga0207659_10004095 | 3300025926 | Bacteria | 8795 |
| 157 | Ga0207659_10018448 | 3300025926 | Bacteria | 4574 |
| 158 | Ga0207644_10001395 | 3300025931 | Bacteria | 15580 |
| 159 | Ga0207644_10002564 | 3300025931 | Bacteria | 11687 |
| 160 | Ga0207644_10048077 | 3300025931 | Bacteria | 3047 |
| 161 | Ga0207644_10072001 | 3300025931 | Bacteria | 2530 |
| 162 | Ga0207644_10102557 | 3300025931 | Unclassified | 2152 |
| 163 | Ga0207644_10114389 | 3300025931 | Bacteria | 2044 |
| 164 | Ga0207644_10163802 | 3300025931 | Bacteria | 1730 |
| 165 | Ga0207690_10010991 | 3300025932 | Bacteria | 5399 |
| 166 | Ga0207706_10004410 | 3300025933 | Bacteria | 13224 |
| 167 | Ga0207706_10009435 | 3300025933 | Bacteria | 8961 |
| 168 | Ga0207706_10021653 | 3300025933 | Bacteria | 5770 |
| 169 | Ga0207706_10037009 | 3300025933 | Bacteria | 4334 |
| 170 | Ga0207706_10046083 | 3300025933 | Bacteria | 3861 |
| 171 | Ga0207706_10070167 | 3300025933 | Unclassified | 3082 |
| 172 | Ga0207706_10128916 | 3300025933 | Bacteria | 2225 |
| 173 | Ga0207686_10111793 | 3300025934 | Bacteria | 1844 |
| 174 | Ga0207709_10088357 | 3300025935 | Bacteria | 2017 |
| 175 | Ga0207669_10014572 | 3300025937 | Bacteria | 3945 |
| 176 | Ga0207669_10060534 | 3300025937 | Bacteria | 2322 |
| 177 | Ga0207691_10002549 | 3300025940 | Bacteria | 17802 |
| 178 | Ga0207691_10002991 | 3300025940 | Bacteria | 16490 |
| 179 | Ga0207691_10023829 | 3300025940 | Bacteria | 5760 |
| 180 | Ga0207691_10036769 | 3300025940 | Bacteria | 4537 |
| 181 | Ga0207691_10049083 | 3300025940 | Bacteria | 3867 |
| 182 | Ga0207711_10000869 | 3300025941 | Bacteria | 29230 |
| 183 | Ga0207711_10007242 | 3300025941 | Bacteria | 9298 |
| 184 | Ga0207711_10009584 | 3300025941 | Bacteria | 8071 |
| 185 | Ga0207711_10030326 | 3300025941 | Bacteria | 4561 |
| 186 | Ga0207711_10095130 | 3300025941 | Bacteria | 2627 |
| 187 | Ga0207711_10189490 | 3300025941 | Bacteria | 1874 |
| 188 | Ga0207689_10003432 | 3300025942 | Bacteria | 14472 |
| 189 | Ga0207689_10061723 | 3300025942 | Bacteria | 3083 |
| 190 | Ga0207679_10001219 | 3300025945 | Bacteria | 16351 |
| 191 | Ga0207679_10008141 | 3300025945 | Bacteria | 6670 |
| 192 | Ga0207679_10026710 | 3300025945 | Bacteria | 3984 |
| 193 | Ga0207679_10104740 | 3300025945 | Bacteria | 2220 |
| 194 | Ga0207651_10005320 | 3300025960 | Bacteria | 6596 |
| 195 | Ga0207651_10074073 | 3300025960 | Bacteria | 2424 |
| 196 | Ga0207712_10003235 | 3300025961 | Bacteria | 10349 |
| 197 | Ga0207712_10018385 | 3300025961 | Bacteria | 4551 |
| 198 | Ga0207668_10312884 | 3300025972 | Bacteria | 1300 |
| 199 | Ga0207640_10027315 | 3300025981 | Bacteria | 3476 |
| 200 | Ga0207640_10059084 | 3300025981 | Bacteria | 2529 |
| 201 | Ga0207658_10009089 | 3300025986 | Bacteria | 6738 |
| 202 | Ga0207658_10250719 | 3300025986 | Bacteria | 1504 |
| 203 | Ga0207677_10043017 | 3300026023 | Bacteria | 3000 |
| 204 | Ga0207703_10004152 | 3300026035 | Bacteria | 11945 |
| 205 | Ga0207703_10009185 | 3300026035 | Bacteria | 7779 |
| 206 | Ga0207703_10010752 | 3300026035 | Bacteria | 7143 |
| 207 | Ga0207639_10118044 | 3300026041 | Bacteria | 2175 |
| 208 | Ga0207678_10169514 | 3300026067 | Bacteria | 1864 |
| 209 | Ga0207702_10387912 | 3300026078 | Bacteria | 1344 |
| 210 | Ga0207641_10001513 | 3300026088 | Bacteria | 22775 |
| 211 | Ga0207641_10062952 | 3300026088 | Bacteria | 3167 |
| 212 | Ga0207648_10134232 | 3300026089 | Bacteria | 2179 |
| 213 | Ga0207648_10290904 | 3300026089 | Bacteria | 1463 |
| 214 | Ga0207676_10004215 | 3300026095 | Bacteria | 10156 |
| 215 | Ga0207676_10006150 | 3300026095 | Bacteria | 8475 |
| 216 | Ga0207676_10047530 | 3300026095 | Bacteria | 3326 |
| 217 | Ga0207676_10143920 | 3300026095 | Bacteria | 2044 |
| 218 | Ga0207674_10002082 | 3300026116 | Bacteria | 25342 |
| 219 | Ga0207674_10102531 | 3300026116 | Bacteria | 2841 |
| 220 | Ga0207674_10153689 | 3300026116 | Bacteria | 2257 |
| 221 | Ga0207683_10003139 | 3300026121 | Bacteria | 14435 |
| 222 | Ga0207683_10051639 | 3300026121 | Bacteria | 3603 |
| 223 | Ga0207698_10097008 | 3300026142 | Bacteria | 2431 |
| 224 | Ga0207698_10168667 | 3300026142 | Bacteria | 1925 |
| 225 | Ga0268266_10164108 | 3300028379 | Bacteria | 2011 |
| 226 | Ga0268265_10454134 | 3300028380 | Bacteria | 1197 |
| 227 | Ga0268264_10005184 | 3300028381 | Bacteria | 11037 |
| 228 | Ga0268264_10005781 | 3300028381 | Bacteria | 10486 |
| 229 | Ga0268264_10371762 | 3300028381 | Bacteria | 1366 |
| 230 | Ga0316583_10012001 | 3300032133 | Bacteria | 3126 |
| 231 | Ga0373943_0048188 | 3300035170 | Bacteria | 2086 |
| 232 | Ga0316582_0012465 | 3300036647 | Bacteria | 4747 |
| 233 | Ga0395899_0061450 | 3300037312 | Bacteria | 2767 |
| 234 | Ga0395899_0082991 | 3300037312 | Bacteria | 2330 |
| 235 | Ga0395900_0056395 | 3300037418 | Bacteria | 4044 |
| 236 | Ga0395900_0556226 | 3300037418 | Bacteria | 1091 |
| 237 | Ga0395898_0086867 | 3300037466 | Bacteria | 3013 |
| 238 | Ga0395905_0000086 | 3300037471 | Bacteria | 153641 |
| 239 | Ga0395905_0000204 | 3300037471 | Bacteria | 92152 |
| 240 | Ga0395905_0063186 | 3300037471 | Bacteria | 3463 |
| 241 | Ga0395905_0169762 | 3300037471 | Bacteria | 2049 |
| 242 | Ga0395905_0206883 | 3300037471 | Bacteria | 1839 |
| 243 | Ga0395901_0091101 | 3300038443 | Bacteria | 3191 |
| 244 | Ga0436361_0001464 | 3300039447 | Bacteria | 13289 |
| 245 | Ga0436361_0028109 | 3300039447 | Bacteria | 9820 |
| 246 | Ga0436361_0088276 | 3300039447 | Bacteria | 12442 |
| 247 | Ga0436361_0267555 | 3300039447 | Bacteria | 1952 |
| 248 | Ga0436361_0270082 | 3300039447 | Bacteria | 7438 |
| 249 | Ga0436361_0614937 | 3300039447 | Bacteria | 8160 |
| 250 | Ga0436361_0621527 | 3300039447 | Bacteria | 17412 |
| 251 | Ga0436361_0835244 | 3300039447 | Bacteria | 4639 |
| 252 | Ga0436361_0852293 | 3300039447 | Bacteria | 2397 |
| 253 | Ga0436361_1102324 | 3300039447 | Bacteria | 6273 |
| 254 | Ga0439448_0023553 | 3300042005 | Bacteria | 1922 |
| 255 | Ga0466961_0095067 | 3300044693 | Bacteria | 1880 |
| 256 | Ga0466963_0000903 | 3300044694 | Bacteria | 15076 |
| 257 | Ga0466957_0001245 | 3300044842 | Bacteria | 13286 |
| 258 | Ga0466957_0038907 | 3300044842 | Bacteria | 2868 |
| 259 | Ga0466967_0000096 | 3300045976 | Bacteria | 31385 |
| 260 | Ga0466967_0077077 | 3300045976 | Bacteria | 3000 |
| 261 | Ga0466967_0369837 | 3300045976 | Bacteria | 1390 |
| 262 | Ga0495592_0098075 | 3300046454 | Bacteria | 2092 |
| 263 | Ga0495585_0056607 | 3300046492 | Unclassified | 2165 |
| 264 | Ga0495663_0015801 | 3300046525 | Unclassified | 2130 |
| 265 | Ga0495663_0040723 | 3300046525 | Unclassified | 1411 |
| 266 | Ga0495587_0088507 | 3300046536 | Bacteria | 1791 |
| 267 | Ga0495598_0001777 | 3300046537 | Bacteria | 4336 |
| 268 | Ga0495645_0096103 | 3300046543 | Bacteria | 2111 |
| 269 | Ga0495661_0115203 | 3300046665 | Unclassified | 1493 |
| 270 | Ga0495669_0002202 | 3300046684 | Bacteria | 8004 |
| 271 | Ga0495669_0004377 | 3300046684 | Bacteria | 5829 |
| 272 | Ga0495669_0013921 | 3300046684 | Unclassified | 3434 |
| 273 | Ga0495670_0094702 | 3300046691 | Unclassified | 1531 |
| 274 | Ga0495677_0018176 | 3300047445 | Unclassified | 2548 |
| 275 | Ga0495677_0018940 | 3300047445 | Unclassified | 2496 |
| 276 | Ga0495602_0024702 | 3300048088 | Bacteria | 5828 |
| 277 | Ga0496101_0137214 | 3300048904 | Bacteria | 1862 |
| 278 | Ga0496102_0122773 | 3300048905 | Bacteria | 2427 |
| 279 | Ga0496105_0097233 | 3300048908 | Bacteria | 2432 |
| 280 | Ga0496106_0576496 | 3300048909 | Bacteria | 902 |
| 281 | Ga0496107_0016843 | 3300048910 | Bacteria | 5138 |
| 282 | Ga0496107_0224946 | 3300048910 | Bacteria | 1396 |
| 283 | Ga0496109_0007760 | 3300048912 | Bacteria | 9085 |
| 284 | Ga0496109_0040609 | 3300048912 | Bacteria | 4213 |
| 285 | Ga0496109_0201891 | 3300048912 | Bacteria | 1869 |
| 286 | Ga0496110_0009164 | 3300048913 | Bacteria | 7995 |
| 287 | Ga0496110_0047492 | 3300048913 | Bacteria | 3760 |
| 288 | Ga0496110_0177736 | 3300048913 | Bacteria | 1932 |
| 289 | Ga0496111_0001927 | 3300048914 | Bacteria | 12272 |
| 290 | Ga0496111_0003199 | 3300048914 | Bacteria | 10105 |
| 291 | Ga0496111_0006450 | 3300048914 | Bacteria | 7620 |
| 292 | Ga0496111_0220544 | 3300048914 | Bacteria | 1409 |
| 293 | Ga0496112_0037126 | 3300048915 | Bacteria | 4756 |
| 294 | Ga0496112_0060902 | 3300048915 | Bacteria | 3719 |
| 295 | Ga0496113_0002904 | 3300048916 | Bacteria | 10101 |
| 296 | Ga0496113_0070296 | 3300048916 | Bacteria | 2660 |
| 297 | Ga0496114_0013182 | 3300048917 | Bacteria | 6626 |
| 298 | Ga0496114_0057809 | 3300048917 | Bacteria | 3238 |
| 299 | Ga0496119_0079453 | 3300048922 | Bacteria | 1895 |
| 300 | Ga0496120_0082154 | 3300048923 | Bacteria | 1742 |
| 301 | Ga0496122_0073853 | 3300048925 | Bacteria | 2415 |
| 302 | Ga0496123_0004066 | 3300048926 | Bacteria | 15753 |
| 303 | Ga0496123_0048131 | 3300048926 | Bacteria | 2871 |
| 304 | Ga0496123_0085546 | 3300048926 | Bacteria | 1896 |
| 305 | Ga0496124_0000306 | 3300048927 | Bacteria | 90641 |
| 306 | Ga0496124_0000858 | 3300048927 | Bacteria | 49650 |
| 307 | Ga0496124_0005697 | 3300048927 | Bacteria | 13878 |
| 308 | Ga0496124_0017385 | 3300048927 | Bacteria | 6778 |
| 309 | Ga0496124_0067158 | 3300048927 | Bacteria | 2984 |
| 310 | Ga0496125_0005624 | 3300048928 | Bacteria | 13842 |
| 311 | Ga0496126_0000849 | 3300048929 | Bacteria | 54058 |
| 312 | Ga0496126_0036512 | 3300048929 | Bacteria | 4595 |
| 313 | Ga0501031_0078769 | 3300049568 | Bacteria | 2147 |
| 314 | Ga0501032_0038598 | 3300049569 | Bacteria | 3251 |
| 315 | Ga0501033_0069075 | 3300049570 | Bacteria | 2597 |
| 316 | Ga0501034_0073456 | 3300049571 | Bacteria | 3429 |
| 317 | Ga0501034_0132767 | 3300049571 | Bacteria | 2472 |
| 318 | Ga0501034_0439550 | 3300049571 | Bacteria | 1223 |
| 319 | Ga0501036_0214115 | 3300049572 | Bacteria | 1618 |
| 320 | Ga0501037_0100566 | 3300049573 | Bacteria | 2087 |
| 321 | Ga0501037_0188082 | 3300049573 | Bacteria | 1463 |
| 322 | Ga0501038_0047015 | 3300049574 | Bacteria | 3739 |
| 323 | Ga0501043_0011153 | 3300049579 | Bacteria | 7038 |
| 324 | Ga0501047_0060365 | 3300049581 | Bacteria | 3660 |
| 325 | Ga0501083_0131380 | 3300049744 | Bacteria | 1642 |
| 326 | Ga0501035_0051206 | 3300049822 | Bacteria | 3698 |
| 327 | Ga0501044_0062276 | 3300049823 | Bacteria | 3813 |
| 328 | Ga0501044_0286447 | 3300049823 | Bacteria | 1580 |
| 329 | nmdc:mga0a205_1208_c1 | 3300050515 | Bacteria | 21612 |
| 330 | nmdc:mga0sz30_106371_c1 | 3300050516 | Bacteria | 1227 |
| 331 | Ga0500618_000705 | 3300053125 | Bacteria | 19616 |
| 332 | 2512037334 | 2511231221 | Bacteria | 6846400 |
| 333 | 2545679221 | 2545555834 | Bacteria | 8130841 |
| 334 | 2600225009 | 2599185359 | Bacteria | 4772316 |
| 335 | 2644733186 | 2643221734 | Bacteria | 5365412 |
| 336 | 2644744132 | 2643221736 | Bacteria | 6608466 |
| 337 | 2753358368 | 2751185800 | Bacteria | 5467370 |
| 338 | 2758640593 | 2758568016 | Bacteria | 5645291 |
| 339 | 2819713859 | 2818991466 | Bacteria | 4748179 |
| 340 | 2819720412 | 2818991467 | Bacteria | 5893227 |
| 341 | 2879164130 | 2879163058 | Bacteria | 4223965 |
| 342 | 2884964799 | 2884960567 | Bacteria | 5437054 |
| 343 | 2885432950 | 2885429604 | Bacteria | 3642894 |
| 344 | 2909044709 | 2909042592 | Bacteria | 6499737 |
| 345 | 2928528414 | 2928526807 | Bacteria | 4760224 |
| 346 | 2928969963 | 2928968154 | Bacteria | 4633371 |
| 347 | 2984568851 | 2984564862 | Bacteria | 4339992 |
| 348 | 2989354973 | 2989349275 | Bacteria | 6349068 |
| 349 | 3000866422 | 3000865235 | Bacteria | 3106258 |
| 350 | 641644689 | 641522639 | Bacteria | 7737025 |
| 351 | 8054005294 | 8054002106 | Bacteria | 7987183 |
| 352 | Ga0068856_100125722 | |||
| 353 | MBSR1b_contig_8040148 | |||
| 354 | JGI24737J22298_10000655 | |||
| 355 | JGI25159J45721_1006196 | |||
| 356 | JGI25151J46595_10055308 | |||
| 357 | Ga0055526_1001499 | |||
| 358 | Ga0055524_1000051 | |||
| 359 | Ga0065165_1000879 | |||
| 360 | Ga0065715_10212743 | |||
| 361 | Ga0070658_10077127 | |||
| 362 | Ga0070670_100000568 | |||
| 363 | Ga0070670_100007058 | |||
| 364 | Ga0070670_100011503 | |||
| 365 | Ga0070670_100192620 | |||
| 366 | Ga0068869_100092939 | |||
| 367 | Ga0068869_100124228 | |||
| 368 | Ga0070666_10003175 | |||
| 369 | Ga0070666_10014064 | |||
| 370 | Ga0070660_100100931 | |||
| 371 | Ga0070660_100175626 | |||
| 372 | Ga0070661_100013625 | |||
| 373 | Ga0070661_100019475 | |||
| 374 | Ga0070661_100200049 | |||
| 375 | Ga0070668_100030358 | |||
| 376 | Ga0070668_100208573 | |||
| 377 | Ga0070669_100056629 | |||
| 378 | Ga0070675_100010249 | |||
| 379 | Ga0070675_100014545 | |||
| 380 | Ga0070675_100049044 | |||
| 381 | Ga0070671_100000802 | |||
| 382 | Ga0070671_100014916 | |||
| 383 | Ga0070671_100030239 | |||
| 384 | Ga0070671_100033297 | |||
| 385 | Ga0070671_100045700 | |||
| 386 | Ga0070671_100112001 | |||
| 387 | Ga0070674_100004353 | |||
| 388 | Ga0070674_100007016 | |||
| 389 | Ga0070674_100029690 | |||
| 390 | Ga0070673_100000382 | |||
| 391 | Ga0070673_100001392 | |||
| 392 | Ga0070673_100157215 | |||
| 393 | Ga0070659_100060709 | |||
| 394 | Ga0070667_100006169 | |||
| 395 | Ga0070667_100018496 | |||
| 396 | Ga0070667_100054992 | |||
| 397 | Ga0070667_100102343 | |||
| 398 | Ga0070678_100060043 | |||
| 399 | Ga0070678_100097872 | |||
| 400 | Ga0070662_100020940 | |||
| 401 | Ga0070662_100043010 | |||
| 402 | Ga0070662_100073577 | |||
| 403 | Ga0070662_100107237 | |||
| 404 | Ga0070662_100111516 | |||
| 405 | Ga0070662_100111833 | |||
| 406 | Ga0068867_100022205 | |||
| 407 | Ga0068867_100097589 | |||
| 408 | Ga0068867_100118358 | |||
| 409 | Ga0070672_100000917 | |||
| 410 | Ga0070672_100005694 | |||
| 411 | Ga0070672_100090702 | |||
| 412 | Ga0070672_100111149 | |||
| 413 | Ga0070672_100111900 | |||
| 414 | Ga0070672_100222160 | |||
| 415 | Ga0070693_100000995 | |||
| 416 | Ga0070665_100018525 | |||
| 417 | Ga0068855_100354737 | |||
| 418 | Ga0070664_100001936 | |||
| 419 | Ga0070664_100003075 | |||
| 420 | Ga0070664_100003100 | |||
| 421 | Ga0068852_100074383 | |||
| 422 | Ga0068852_100085381 | |||
| 423 | Ga0068859_100002392 | |||
| 424 | Ga0068859_100026215 | |||
| 425 | Ga0068859_100365329 | |||
| 426 | Ga0068864_100001110 | |||
| 427 | Ga0068864_100098786 | |||
| 428 | Ga0068864_100159734 | |||
| 429 | Ga0068866_10041229 | |||
| 430 | Ga0068851_10070273 | |||
| 431 | Ga0068863_100001056 | |||
| 432 | Ga0068863_100010395 | |||
| 433 | Ga0068858_100001926 | |||
| 434 | Ga0068858_100003145 | |||
| 435 | Ga0068860_100002768 | |||
| 436 | Ga0068860_100003557 | |||
| 437 | Ga0068860_100070204 | |||
| 438 | Ga0068860_100485446 | |||
| 439 | Ga0068862_100033058 | |||
| 440 | Ga0070712_100011162 | |||
| 441 | Ga0075369_10005502 | |||
| 442 | Ga0097621_100067088 | |||
| 443 | Ga0068871_100059172 | |||
| 444 | Ga0068871_100174924 | |||
| 445 | Ga0075433_10106291 | |||
| 446 | Ga0097620_100002392 | |||
| 447 | Ga0097620_100026215 | |||
| 448 | Ga0097620_100365341 | |||
| 449 | Ga0105250_10019414 | |||
| 450 | Ga0105245_10295195 | |||
| 451 | Ga0105242_10246160 | |||
| 452 | Ga0105248_10001320 | |||
| 453 | Ga0105248_10001492 | |||
| 454 | Ga0105248_10012773 | |||
| 455 | Ga0105248_10014927 | |||
| 456 | Ga0105248_10030721 | |||
| 457 | Ga0105248_10092756 | |||
| 458 | Ga0105248_10107431 | |||
| 459 | Ga0105248_10211038 | |||
| 460 | Ga0105248_10596053 | |||
| 461 | Ga0105237_10011576 | |||
| 462 | Ga0105237_10310449 | |||
| 463 | Ga0105249_10026474 | |||
| 464 | Ga0105249_10074280 | |||
| 465 | Ga0105239_10042112 | |||
| 466 | Ga0157373_10006905 | |||
| 467 | Ga0157370_10142711 | |||
| 468 | Ga0157369_10220417 | |||
| 469 | Ga0157374_10021943 | |||
| 470 | Ga0157374_10165337 | |||
| 471 | Ga0157378_10038554 | |||
| 472 | Ga0163162_10003177 | |||
| 473 | Ga0163162_10046387 | |||
| 474 | Ga0163162_10067261 | |||
| 475 | Ga0163162_10308253 | |||
| 476 | Ga0157375_10005392 | |||
| 477 | Ga0157375_10029221 | |||
| 478 | Ga0163163_10006151 | |||
| 479 | Ga0163163_10031977 | |||
| 480 | Ga0157377_10031624 | |||
| 481 | Ga0157379_10202427 | |||
| 482 | Ga0163161_10078944 | |||
| 483 | Ga0213872_10000525 | |||
| 484 | Ga0213872_10001049 | |||
| 485 | Ga0213872_10002041 | |||
| 486 | Ga0213872_10006088 | |||
| 487 | Ga0213872_10006595 | |||
| 488 | Ga0213872_10022043 | |||
| 489 | Ga0209130_1000127 | |||
| 490 | Ga0209675_1000378 | |||
| 491 | Ga0209025_1001569 | |||
| 492 | Ga0209564_1000048 | |||
| 493 | Ga0209256_1000041 | |||
| 494 | Ga0209257_1015909 | |||
| 495 | Ga0207656_10095145 | |||
| 496 | Ga0207680_10010312 | |||
| 497 | Ga0207680_10098126 | |||
| 498 | Ga0207647_10007743 | |||
| 499 | Ga0207645_10047282 | |||
| 500 | Ga0207671_10077901 | |||
| 501 | Ga0207657_10022343 | |||
| 502 | Ga0207649_10003671 | |||
| 503 | Ga0207681_10033748 | |||
| 504 | Ga0207650_10001435 | |||
| 505 | Ga0207650_10014688 | |||
| 506 | Ga0207650_10038047 | |||
| 507 | Ga0207659_10004095 | |||
| 508 | Ga0207659_10018448 | |||
| 509 | Ga0207644_10001395 | |||
| 510 | Ga0207644_10002564 | |||
| 511 | Ga0207644_10048077 | |||
| 512 | Ga0207644_10072001 | |||
| 513 | Ga0207644_10102557 | |||
| 514 | Ga0207644_10114389 | |||
| 515 | Ga0207644_10163802 | |||
| 516 | Ga0207690_10010991 | |||
| 517 | Ga0207706_10004410 | |||
| 518 | Ga0207706_10009435 | |||
| 519 | Ga0207706_10021653 | |||
| 520 | Ga0207706_10037009 | |||
| 521 | Ga0207706_10046083 | |||
| 522 | Ga0207706_10070167 | |||
| 523 | Ga0207706_10128916 | |||
| 524 | Ga0207686_10111793 | |||
| 525 | Ga0207709_10088357 | |||
| 526 | Ga0207669_10014572 | |||
| 527 | Ga0207669_10060534 | |||
| 528 | Ga0207691_10002549 | |||
| 529 | Ga0207691_10002991 | |||
| 530 | Ga0207691_10023829 | |||
| 531 | Ga0207691_10036769 | |||
| 532 | Ga0207691_10049083 | |||
| 533 | Ga0207711_10000869 | |||
| 534 | Ga0207711_10007242 | |||
| 535 | Ga0207711_10009584 | |||
| 536 | Ga0207711_10030326 | |||
| 537 | Ga0207711_10095130 | |||
| 538 | Ga0207711_10189490 | |||
| 539 | Ga0207689_10003432 | |||
| 540 | Ga0207689_10061723 | |||
| 541 | Ga0207679_10001219 | |||
| 542 | Ga0207679_10008141 | |||
| 543 | Ga0207679_10026710 | |||
| 544 | Ga0207679_10104740 | |||
| 545 | Ga0207651_10005320 | |||
| 546 | Ga0207651_10074073 | |||
| 547 | Ga0207712_10003235 | |||
| 548 | Ga0207712_10018385 | |||
| 549 | Ga0207668_10312884 | |||
| 550 | Ga0207640_10027315 | |||
| 551 | Ga0207640_10059084 | |||
| 552 | Ga0207658_10009089 | |||
| 553 | Ga0207658_10250719 | |||
| 554 | Ga0207677_10043017 | |||
| 555 | Ga0207703_10004152 | |||
| 556 | Ga0207703_10009185 | |||
| 557 | Ga0207703_10010752 | |||
| 558 | Ga0207639_10118044 | |||
| 559 | Ga0207678_10169514 | |||
| 560 | Ga0207702_10387912 | |||
| 561 | Ga0207641_10001513 | |||
| 562 | Ga0207641_10062952 | |||
| 563 | Ga0207648_10134232 | |||
| 564 | Ga0207648_10290904 | |||
| 565 | Ga0207676_10004215 | |||
| 566 | Ga0207676_10006150 | |||
| 567 | Ga0207676_10047530 | |||
| 568 | Ga0207676_10143920 | |||
| 569 | Ga0207674_10002082 | |||
| 570 | Ga0207674_10102531 | |||
| 571 | Ga0207674_10153689 | |||
| 572 | Ga0207683_10003139 | |||
| 573 | Ga0207683_10051639 | |||
| 574 | Ga0207698_10097008 | |||
| 575 | Ga0207698_10168667 | |||
| 576 | Ga0268266_10164108 | |||
| 577 | Ga0268265_10454134 | |||
| 578 | Ga0268264_10005184 | |||
| 579 | Ga0268264_10005781 | |||
| 580 | Ga0268264_10371762 | |||
| 581 | Ga0316583_10012001 | |||
| 582 | Ga0373943_0048188 | |||
| 583 | Ga0316582_0012465 | |||
| 584 | Ga0395899_0061450 | |||
| 585 | Ga0395899_0082991 | |||
| 586 | Ga0395900_0056395 | |||
| 587 | Ga0395900_0556226 | |||
| 588 | Ga0395898_0086867 | |||
| 589 | Ga0395905_0000086 | |||
| 590 | Ga0395905_0000204 | |||
| 591 | Ga0395905_0063186 | |||
| 592 | Ga0395905_0169762 | |||
| 593 | Ga0395905_0206883 | |||
| 594 | Ga0395901_0091101 | |||
| 595 | Ga0436361_0001464 | |||
| 596 | Ga0436361_0028109 | |||
| 597 | Ga0436361_0088276 | |||
| 598 | Ga0436361_0267555 | |||
| 599 | Ga0436361_0270082 | |||
| 600 | Ga0436361_0614937 | |||
| 601 | Ga0436361_0621527 | |||
| 602 | Ga0436361_0835244 | |||
| 603 | Ga0436361_0852293 | |||
| 604 | Ga0436361_1102324 | |||
| 605 | Ga0439448_0023553 | |||
| 606 | Ga0466961_0095067 | |||
| 607 | Ga0466963_0000903 | |||
| 608 | Ga0466957_0001245 | |||
| 609 | Ga0466957_0038907 | |||
| 610 | Ga0466967_0000096 | |||
| 611 | Ga0466967_0077077 | |||
| 612 | Ga0466967_0369837 | |||
| 613 | Ga0495592_0098075 | |||
| 614 | Ga0495585_0056607 | |||
| 615 | Ga0495663_0015801 | |||
| 616 | Ga0495663_0040723 | |||
| 617 | Ga0495587_0088507 | |||
| 618 | Ga0495598_0001777 | |||
| 619 | Ga0495645_0096103 | |||
| 620 | Ga0495661_0115203 | |||
| 621 | Ga0495669_0002202 | |||
| 622 | Ga0495669_0004377 | |||
| 623 | Ga0495669_0013921 | |||
| 624 | Ga0495670_0094702 | |||
| 625 | Ga0495677_0018176 | |||
| 626 | Ga0495677_0018940 | |||
| 627 | Ga0495602_0024702 | |||
| 628 | Ga0496101_0137214 | |||
| 629 | Ga0496102_0122773 | |||
| 630 | Ga0496105_0097233 | |||
| 631 | Ga0496106_0576496 | |||
| 632 | Ga0496107_0016843 | |||
| 633 | Ga0496107_0224946 | |||
| 634 | Ga0496109_0007760 | |||
| 635 | Ga0496109_0040609 | |||
| 636 | Ga0496109_0201891 | |||
| 637 | Ga0496110_0009164 | |||
| 638 | Ga0496110_0047492 | |||
| 639 | Ga0496110_0177736 | |||
| 640 | Ga0496111_0001927 | |||
| 641 | Ga0496111_0003199 | |||
| 642 | Ga0496111_0006450 | |||
| 643 | Ga0496111_0220544 | |||
| 644 | Ga0496112_0037126 | |||
| 645 | Ga0496112_0060902 | |||
| 646 | Ga0496113_0002904 | |||
| 647 | Ga0496113_0070296 | |||
| 648 | Ga0496114_0013182 | |||
| 649 | Ga0496114_0057809 | |||
| 650 | Ga0496119_0079453 | |||
| 651 | Ga0496120_0082154 | |||
| 652 | Ga0496122_0073853 | |||
| 653 | Ga0496123_0004066 | |||
| 654 | Ga0496123_0048131 | |||
| 655 | Ga0496123_0085546 | |||
| 656 | Ga0496124_0000306 | |||
| 657 | Ga0496124_0000858 | |||
| 658 | Ga0496124_0005697 | |||
| 659 | Ga0496124_0017385 | |||
| 660 | Ga0496124_0067158 | |||
| 661 | Ga0496125_0005624 | |||
| 662 | Ga0496126_0000849 | |||
| 663 | Ga0496126_0036512 | |||
| 664 | Ga0501031_0078769 | |||
| 665 | Ga0501032_0038598 | |||
| 666 | Ga0501033_0069075 | |||
| 667 | Ga0501034_0073456 | |||
| 668 | Ga0501034_0132767 | |||
| 669 | Ga0501034_0439550 | |||
| 670 | Ga0501036_0214115 | |||
| 671 | Ga0501037_0100566 | |||
| 672 | Ga0501037_0188082 | |||
| 673 | Ga0501038_0047015 | |||
| 674 | Ga0501043_0011153 | |||
| 675 | Ga0501047_0060365 | |||
| 676 | Ga0501083_0131380 | |||
| 677 | Ga0501035_0051206 | |||
| 678 | Ga0501044_0062276 | |||
| 679 | Ga0501044_0286447 | |||
| 680 | nmdc:mga0a205_1208_c1 | |||
| 681 | nmdc:mga0sz30_106371_c1 | |||
| 682 | Ga0500618_000705 | |||
| 683 | 2512037334 | |||
| 684 | 2545679221 | |||
| 685 | 2600225009 | |||
| 686 | 2644733186 | |||
| 687 | 2644744132 | |||
| 688 | 2753358368 | |||
| 689 | 2758640593 | |||
| 690 | 2819713859 | |||
| 691 | 2819720412 | |||
| 692 | 2879164130 | |||
| 693 | 2884964799 | |||
| 694 | 2885432950 | |||
| 695 | 2909044709 | |||
| 696 | 2928528414 | |||
| 697 | 2928969963 | |||
| 698 | 2984568851 | |||
| 699 | 2989354973 | |||
| 700 | 3000866422 | |||
| 701 | 641644689 | |||
| 702 | 8054005294 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xar-assembly2.cif.gz_D | structural insights into the elevator-like mechanism of the sodium/citrate symporter cits | 0.5482 | 16 | 346 |
| 5a1s-assembly2.cif.gz_B | crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. | 0.5172 | 16 | 346 |
| 5bz2-assembly1.cif.gz_A-2 | crystal structure of the sodium proton antiporter napa in inward-facing conformation | 0.5079 | 15 | 334 |
| 5xar-assembly2.cif.gz_D | structural insights into the elevator-like mechanism of the sodium/citrate symporter cits | 0.497 | 16 | 346 |
| 5a1s-assembly2.cif.gz_B | crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. | 0.4885 | 16 | 346 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G134_11_311_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8595 | 19 | 330 | 1.20.1530.20 |
| af_Q2G134_11_311_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.8518 | 19 | 330 | 1.20.1530.20 |
| af_P62723_18_326_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.7826 | 18 | 330 | 1.20.1530.20 |
| af_P62723_18_326_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.7783 | 18 | 330 | 1.20.1530.20 |
| af_A0A1D6MVG0_125_298_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.6218 | 7 | 248 | 1.20.1530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A381I5V7-F1-model_v4 | Membrane protein | 0.9455 | 58 | 247 |
GO:0005886
|
| AF-A0A7K3LYL8-F1-model_v4 | Putative sulfate exporter family transporter | 0.9392 | 16 | 348 |
GO:0005886
|
| AF-A0A806H8Q8-F1-model_v4 | deleted | 0.9391 | 63 | 349 |
|
| AF-A0A7V8KL73-F1-model_v4 | deleted | 0.9379 | 77 | 351 |
|
| AF-A0A5C5UQK9-F1-model_v4 | Putative sulfate exporter family transporter | 0.9377 | 15 | 347 |
GO:0005886
|