F418563

General Info

Members Datasets Scaffolds Average Seq Length
351 231 702 77

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100304032|Ga0070664_1003040321
Length 84
Sequence MITIRLRENGPIVIEGDEATVIDWNGVQYEIARRPIALCRCGGSSKKPFCDGTHKSNGFCGSQAAQPQPSTAPLPPASGNDEQR

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
193 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
194 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
215 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.84
Nodule 0
Rhizoplane 8.83
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 21.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100304032 3300005564 Bacteria 1442
2 Ga0065712_10010644 3300005290 Bacteria 3004
3 Ga0065715_10256364 3300005293 Unclassified 1151
4 Ga0070658_10035404 3300005327 Bacteria 4021
5 Ga0070676_10235551 3300005328 Unclassified 1215
6 Ga0070683_100330144 3300005329 Unclassified 1452
7 Ga0070690_100400211 3300005330 Bacteria 1008
8 Ga0070670_100053797 3300005331 Bacteria 3456
9 Ga0070670_100181835 3300005331 Bacteria 1826
10 Ga0070670_100471097 3300005331 Bacteria 1114
11 Ga0070677_10059236 3300005333 Bacteria 1574
12 Ga0068869_101114881 3300005334 Bacteria 691
13 Ga0070666_10150197 3300005335 Unclassified 1625
14 Ga0070666_11246792 3300005335 Unclassified 554
15 Ga0070680_100057703 3300005336 Bacteria 3174
16 Ga0070682_100017233 3300005337 Bacteria 4210
17 Ga0070660_100010027 3300005339 Bacteria 6682
18 Ga0070660_101927062 3300005339 Bacteria 504
19 Ga0070661_100017482 3300005344 Bacteria 5088
20 Ga0070661_101013064 3300005344 Bacteria 689
21 Ga0070692_10412503 3300005345 Bacteria 855
22 Ga0070668_100944873 3300005347 Bacteria 772
23 Ga0070671_100120329 3300005355 Unclassified 2209
24 Ga0070671_100727886 3300005355 Bacteria 861
25 Ga0070674_100113442 3300005356 Unclassified 1994
26 Ga0070674_100532800 3300005356 Bacteria 983
27 Ga0070674_102108351 3300005356 Bacteria 514
28 Ga0070659_100068010 3300005366 Plasmid 2825
29 Ga0070667_100232679 3300005367 Bacteria 1644
30 Ga0070667_100801330 3300005367 Bacteria 874
31 Ga0070667_100872018 3300005367 Unclassified 837
32 Ga0070709_10064490 3300005434 Unclassified 2343
33 Ga0070709_10123671 3300005434 Unclassified 1757
34 Ga0070709_10125653 3300005434 Bacteria 1745
35 Ga0070709_10319676 3300005434 Unclassified 1139
36 Ga0070709_11088431 3300005434 Bacteria 639
37 Ga0070714_100114393 3300005435 Bacteria 2393
38 Ga0070714_100782054 3300005435 Bacteria 924
39 Ga0070713_100092706 3300005436 Bacteria 2601
40 Ga0070713_100149972 3300005436 Bacteria 2073
41 Ga0070713_100231584 3300005436 Unclassified 1679
42 Ga0070713_101844434 3300005436 Unclassified 587
43 Ga0070713_101957303 3300005436 Unclassified 569
44 Ga0070710_10240412 3300005437 Unclassified 1160
45 Ga0070710_11272909 3300005437 Unclassified 546
46 Ga0070711_100000382 3300005439 Bacteria 22849
47 Ga0070711_100411684 3300005439 Unclassified 1100
48 Ga0070711_101821212 3300005439 Unclassified 534
49 Ga0070700_100586936 3300005441 Bacteria 871
50 Ga0070708_101655025 3300005445 Bacteria 595
51 Ga0070663_100099083 3300005455 Bacteria 2172
52 Ga0070663_100271006 3300005455 Bacteria 1349
53 Ga0070663_100823769 3300005455 Bacteria 797
54 Ga0070678_100232529 3300005456 Bacteria 1537
55 Ga0070662_100036705 3300005457 Bacteria 3469
56 Ga0070681_10183787 3300005458 Bacteria 2011
57 Ga0070706_100913316 3300005467 Bacteria 811
58 Ga0070706_100914001 3300005467 Bacteria 811
59 Ga0070707_101655959 3300005468 Unclassified 607
60 Ga0070699_101058609 3300005518 Bacteria 744
61 Ga0070679_100011388 3300005530 Bacteria 8475
62 Ga0070684_101511867 3300005535 Bacteria 633
63 Ga0068853_100273904 3300005539 Unclassified 1555
64 Ga0070672_100370681 3300005543 Bacteria 1223
65 Ga0070672_101028930 3300005543 Bacteria 730
66 Ga0070672_101833148 3300005543 Bacteria 545
67 Ga0070672_102088319 3300005543 Bacteria 510
68 Ga0070686_100537312 3300005544 Bacteria 913
69 Ga0070693_100155604 3300005547 Unclassified 1451
70 Ga0070665_100160897 3300005548 Bacteria 2247
71 Ga0068855_100151641 3300005563 Bacteria 2635
72 Ga0070664_100012501 3300005564 Bacteria 6904
73 Ga0070664_100022605 3300005564 Bacteria 5185
74 Ga0068857_100096686 3300005577 Bacteria 2646
75 Ga0068854_100090067 3300005578 Unclassified 2281
76 Ga0068856_100086658 3300005614 Plasmid 3112
77 Ga0068856_102023733 3300005614 Bacteria 586
78 Ga0070702_100220196 3300005615 Bacteria 1268
79 Ga0068852_100551083 3300005616 Bacteria 1153
80 Ga0068859_101248455 3300005617 Bacteria 819
81 Ga0068864_100032492 3300005618 Bacteria 4434
82 Ga0068861_101024575 3300005719 Bacteria 789
83 Ga0068861_101475739 3300005719 Bacteria 666
84 Ga0068851_10012501 3300005834 Bacteria 4003
85 Ga0068870_10332135 3300005840 Bacteria 969
86 Ga0068863_100489313 3300005841 Bacteria 1210
87 Ga0068860_100826193 3300005843 Bacteria 941
88 Ga0070717_10069964 3300006028 Bacteria 2924
89 Ga0070717_10077393 3300006028 Unclassified 2785
90 Ga0070717_10081473 3300006028 Bacteria 2717
91 Ga0070717_10636993 3300006028 Bacteria 968
92 Ga0075365_10246833 3300006038 Bacteria 1254
93 Ga0075368_10246630 3300006042 Bacteria 762
94 Ga0075364_10908318 3300006051 Bacteria 599
95 Ga0070715_10151311 3300006163 Bacteria 1137
96 Ga0070715_10188368 3300006163 Bacteria 1040
97 Ga0070716_100061424 3300006173 Bacteria 2174
98 Ga0070716_100206244 3300006173 Unclassified 1310
99 Ga0070712_100001264 3300006175 Bacteria 15261
100 Ga0070712_100002992 3300006175 Bacteria 10460
101 Ga0070712_100169957 3300006175 Bacteria 1691
102 Ga0070712_100265113 3300006175 Bacteria 1378
103 Ga0070712_101195312 3300006175 Unclassified 661
104 Ga0075362_10237233 3300006177 Bacteria 894
105 Ga0097621_100021320 3300006237 Bacteria 5010
106 Ga0097621_101064561 3300006237 Bacteria 758
107 Ga0075370_10749598 3300006353 Bacteria 594
108 Ga0075370_10779417 3300006353 Bacteria 583
109 Ga0075370_10850783 3300006353 Bacteria 557
110 Ga0075370_11039007 3300006353 Bacteria 503
111 Ga0068871_100022299 3300006358 Bacteria 4881
112 Ga0075428_100059179 3300006844 Bacteria 4195
113 Ga0075430_100007045 3300006846 Bacteria 9480
114 Ga0075431_100173438 3300006847 Bacteria 2215
115 Ga0075431_100743425 3300006847 Bacteria 956
116 Ga0075429_100063175 3300006880 Bacteria 3226
117 Ga0075429_100613851 3300006880 Bacteria 953
118 Ga0075436_101076846 3300006914 Bacteria 605
119 Ga0097620_100900774 3300006931 Bacteria 969
120 Ga0097620_101248431 3300006931 Bacteria 819
121 Ga0105240_10044902 3300009093 Bacteria 5610
122 Ga0111539_10000510 3300009094 Bacteria 49338
123 Ga0111539_10003652 3300009094 Bacteria 20266
124 Ga0105247_10217200 3300009101 Bacteria 1292
125 Ga0105247_10663225 3300009101 Bacteria 781
126 Ga0114129_10131935 3300009147 Bacteria 3430
127 Ga0114129_11837954 3300009147 Bacteria 736
128 Ga0105241_10093642 3300009174 Bacteria 2374
129 Ga0105242_10811191 3300009176 Bacteria 927
130 Ga0105242_10890980 3300009176 Bacteria 889
131 Ga0105248_10131611 3300009177 Bacteria 2822
132 Ga0105248_11178076 3300009177 Bacteria 866
133 Ga0105237_10119345 3300009545 Plasmid 2631
134 Ga0105238_10072729 3300009551 Plasmid 3433
135 Ga0105239_10051526 3300010375 Bacteria 4512
136 Ga0157371_10123503 3300013102 Unclassified 1841
137 Ga0157369_10111208 3300013105 Unclassified 2911
138 Ga0157374_10531212 3300013296 Unclassified 1183
139 Ga0157378_10255337 3300013297 Bacteria 1680
140 Ga0163162_10020423 3300013306 Bacteria 6509
141 Ga0163162_12591641 3300013306 Bacteria 583
142 Ga0157372_10133677 3300013307 Plasmid 2856
143 Ga0157375_10532966 3300013308 Unclassified 1337
144 Ga0163163_10156909 3300014325 Bacteria 2320
145 Ga0163163_12446061 3300014325 Unclassified 580
146 Ga0157380_10911517 3300014326 Bacteria 906
147 Ga0182008_10011439 3300014497 Bacteria 4720
148 Ga0157377_10599119 3300014745 Bacteria 786
149 Ga0157379_10938505 3300014968 Bacteria 822
150 Ga0157379_11535640 3300014968 Bacteria 649
151 Ga0157376_10473423 3300014969 Bacteria 1226
152 Ga0182006_1007243 3300015261 Bacteria 5090
153 Ga0182007_10003124 3300015262 Bacteria 7962
154 Ga0182005_1027191 3300015265 Unclassified 1560
155 Ga0163161_10339108 3300017792 Bacteria 1192
156 Ga0163161_10663731 3300017792 Bacteria 865
157 Ga0206355_1370509 3300020076 Unclassified 1094
158 Ga0207656_10139697 3300025321 Unclassified 1141
159 Ga0207682_10034410 3300025893 Bacteria 2042
160 Ga0207692_10183256 3300025898 Unclassified 1221
161 Ga0207685_10324993 3300025905 Bacteria 768
162 Ga0207685_10813209 3300025905 Unclassified 515
163 Ga0207699_10127490 3300025906 Unclassified 1655
164 Ga0207699_10229287 3300025906 Bacteria 1271
165 Ga0207699_10250067 3300025906 Unclassified 1221
166 Ga0207699_10304483 3300025906 Bacteria 1114
167 Ga0207699_10791566 3300025906 Bacteria 697
168 Ga0207645_10224199 3300025907 Unclassified 1240
169 Ga0207643_10932487 3300025908 Bacteria 562
170 Ga0207684_11267710 3300025910 Bacteria 608
171 Ga0207695_10050096 3300025913 Bacteria 4396
172 Ga0207671_10087140 3300025914 Bacteria 2348
173 Ga0207693_10000137 3300025915 Bacteria 66587
174 Ga0207693_10004623 3300025915 Bacteria 11614
175 Ga0207693_10255599 3300025915 Bacteria 1374
176 Ga0207693_10706043 3300025915 Bacteria 781
177 Ga0207663_10003456 3300025916 Bacteria 7734
178 Ga0207657_10035394 3300025919 Bacteria 4478
179 Ga0207649_10152266 3300025920 Unclassified 1594
180 Ga0207649_10344041 3300025920 Bacteria 1102
181 Ga0207694_10079537 3300025924 Plasmid 2571
182 Ga0207650_10146619 3300025925 Bacteria 1859
183 Ga0207650_11058321 3300025925 Bacteria 690
184 Ga0207659_10501484 3300025926 Unclassified 1028
185 Ga0207700_10001985 3300025928 Bacteria 11650
186 Ga0207700_10049454 3300025928 Bacteria 3127
187 Ga0207700_10117946 3300025928 Bacteria 2147
188 Ga0207700_10199597 3300025928 Bacteria 1685
189 Ga0207664_10047530 3300025929 Bacteria 3372
190 Ga0207664_11676504 3300025929 Unclassified 558
191 Ga0207644_10113855 3300025931 Unclassified 2049
192 Ga0207690_10021636 3300025932 Bacteria 3990
193 Ga0207706_10007627 3300025933 Bacteria 10002
194 Ga0207669_10278915 3300025937 Bacteria 1259
195 Ga0207669_10480392 3300025937 Bacteria 990
196 Ga0207665_10079577 3300025939 Bacteria 2253
197 Ga0207665_10103440 3300025939 Bacteria 1992
198 Ga0207665_10150501 3300025939 Bacteria 1666
199 Ga0207691_10404387 3300025940 Bacteria 1164
200 Ga0207691_10470208 3300025940 Bacteria 1069
201 Ga0207691_11186101 3300025940 Bacteria 633
202 Ga0207711_10360023 3300025941 Unclassified 1348
203 Ga0207711_11190808 3300025941 Bacteria 703
204 Ga0207689_10514385 3300025942 Bacteria 1004
205 Ga0207689_10793064 3300025942 Bacteria 800
206 Ga0207661_10232576 3300025944 Unclassified 1633
207 Ga0207661_10345910 3300025944 Bacteria 1341
208 Ga0207679_10207932 3300025945 Bacteria 1639
209 Ga0207679_10262704 3300025945 Unclassified 1473
210 Ga0207667_10111597 3300025949 Plasmid 2820
211 Ga0207668_10909701 3300025972 Bacteria 783
212 Ga0207640_10347784 3300025981 Unclassified 1190
213 Ga0207658_10421664 3300025986 Bacteria 1177
214 Ga0207658_11655211 3300025986 Bacteria 585
215 Ga0207639_10140776 3300026041 Bacteria 2009
216 Ga0207678_10210593 3300026067 Bacteria 1663
217 Ga0207678_10701406 3300026067 Bacteria 891
218 Ga0207702_10058113 3300026078 Plasmid 3291
219 Ga0207641_11550167 3300026088 Bacteria 664
220 Ga0207641_11554770 3300026088 Bacteria 663
221 Ga0207676_10351594 3300026095 Bacteria 1363
222 Ga0207676_10944160 3300026095 Unclassified 848
223 Ga0207676_11538899 3300026095 Bacteria 662
224 Ga0207674_10125105 3300026116 Bacteria 2537
225 Ga0207675_101067282 3300026118 Bacteria 827
226 Ga0207675_101496480 3300026118 Bacteria 696
227 Ga0207683_10133429 3300026121 Bacteria 2234
228 Ga0207698_10251210 3300026142 Unclassified 1618
229 Ga0207698_11392290 3300026142 Bacteria 716
230 Ga0209813_10142196 3300027866 Bacteria 853
231 Ga0207428_10000654 3300027907 Bacteria 40562
232 Ga0207428_10034406 3300027907 Bacteria 4152
233 Ga0268266_10823270 3300028379 Bacteria 897
234 Ga0268264_12063398 3300028381 Bacteria 579
235 Ga0265338_10096539 3300028800 Unclassified 2424
236 Ga0265338_10096964 3300028800 Bacteria 2417
237 Ga0265328_10208404 3300031239 Bacteria 743
238 Ga0265325_10059415 3300031241 Bacteria 1944
239 Ga0265340_10026531 3300031247 Bacteria 2928
240 Ga0265339_10073182 3300031249 Bacteria 1822
241 Ga0265331_10196921 3300031250 Bacteria 908
242 Ga0265316_10041244 3300031344 Bacteria 3695
243 Ga0307408_100429025 3300031548 Unclassified 1142
244 Ga0307408_101896936 3300031548 Bacteria 571
245 Ga0265314_10042020 3300031711 Bacteria 3265
246 Ga0307413_11150384 3300031824 Unclassified 672
247 Ga0307410_10361896 3300031852 Bacteria 1162
248 Ga0307407_10016897 3300031903 Bacteria 3645
249 Ga0307409_100262177 3300031995 Bacteria 1587
250 Ga0307409_101406175 3300031995 Bacteria 724
251 Ga0307415_101805928 3300032126 Bacteria 592
252 Ga0373934_0023980 3300035086 Unclassified 2359
253 Ga0373923_0218723 3300035111 Unclassified 885
254 Ga0373936_0225064 3300035113 Unclassified 833
255 Ga0373956_0278455 3300035119 Bacteria 796
256 Ga0373956_0454443 3300035119 Unclassified 611
257 Ga0373943_0170251 3300035170 Bacteria 1191
258 Ga0373955_0029615 3300035172 Unclassified 2849
259 Ga0373955_0308982 3300035172 Bacteria 954
260 Ga0373927_0124630 3300035695 Bacteria 1682
261 Ga0373933_0045710 3300035724 Unclassified 2597
262 Ga0373947_0055715 3300035725 Bacteria 2388
263 Ga0373947_0587662 3300035725 Bacteria 759
264 Ga0373937_0017078 3300036401 Bacteria 6454
265 Ga0373937_0056102 3300036401 Unclassified 3617
266 Ga0373937_0615845 3300036401 Bacteria 1030
267 Ga0373925_0122521 3300037068 Bacteria 2019
268 Ga0373925_0306533 3300037068 Unclassified 1283
269 Ga0395898_0575458 3300037466 Unclassified 1069
270 Ga0395905_1029279 3300037471 Bacteria 727
271 Ga0436364_0190894 3300037853 Bacteria 5852
272 Ga0436364_1235212 3300037853 Unclassified 1067
273 Ga0395901_0359044 3300038443 Bacteria 1503
274 Ga0436363_1325007 3300039450 Unclassified 957
275 Ga0451802_0534781 3300041460 Bacteria 795
276 Ga0451853_2604221 3300041512 Bacteria 610
277 Ga0453684_0939336 3300044712 Unclassified 924
278 Ga0466958_0207909 3300045836 Unclassified 1246
279 Ga0495603_0047517 3300046455 Bacteria 2556
280 Ga0495629_0018508 3300046459 Bacteria 4984
281 Ga0495629_0060966 3300046459 Bacteria 2636
282 Ga0495580_0002458 3300046472 Bacteria 16192
283 Ga0495582_0003044 3300046473 Bacteria 9388
284 Ga0495639_0123078 3300046475 Bacteria 1238
285 Ga0495594_0021018 3300046499 Bacteria 3482
286 Ga0495621_0223138 3300046539 Bacteria 763
287 Ga0495622_0129606 3300046557 Bacteria 1149
288 Ga0495635_0721056 3300046663 Bacteria 646
289 Ga0495588_0562508 3300046674 Unclassified 597
290 Ga0495657_0370085 3300046675 Bacteria 846
291 Ga0495623_0344283 3300046679 Unclassified 814
292 Ga0495658_0274539 3300046683 Bacteria 1063
293 Ga0495658_0275242 3300046683 Bacteria 1061
294 Ga0495613_0082575 3300046689 Bacteria 2334
295 Ga0495674_1072663 3300047319 Unclassified 614
296 Ga0495676_0019267 3300047321 Bacteria 6004
297 Ga0495602_0076531 3300048088 Bacteria 2835
298 Ga0496100_0038994 3300048903 Bacteria 3014
299 Ga0496100_0052434 3300048903 Bacteria 2652
300 Ga0496101_0001821 3300048904 Bacteria 12844
301 Ga0496101_0107364 3300048904 Unclassified 2097
302 Ga0496102_0033217 3300048905 Bacteria 4636
303 Ga0496102_0102985 3300048905 Plasmid 2654
304 Ga0496103_0033376 3300048906 Plasmid 3144
305 Ga0496104_0022066 3300048907 Bacteria 5851
306 Ga0496104_0035235 3300048907 Bacteria 4673
307 Ga0496104_0275976 3300048907 Bacteria 1594
308 Ga0496104_0291584 3300048907 Bacteria 1544
309 Ga0496105_0496858 3300048908 Unclassified 958
310 Ga0496106_0019118 3300048909 Bacteria 5078
311 Ga0496107_0013203 3300048910 Bacteria 5772
312 Ga0496107_0204871 3300048910 Bacteria 1466
313 Ga0496108_0041176 3300048911 Bacteria 3855
314 Ga0496108_0950584 3300048911 Bacteria 736
315 Ga0496109_0148465 3300048912 Unclassified 2194
316 Ga0496109_0683119 3300048912 Bacteria 964
317 Ga0496109_1455943 3300048912 Unclassified 620
318 Ga0496110_0103203 3300048913 Bacteria 2557
319 Ga0496110_0222275 3300048913 Bacteria 1717
320 Ga0496112_0084327 3300048915 Bacteria 3143
321 Ga0496112_0261889 3300048915 Bacteria 1678
322 Ga0496112_0282954 3300048915 Unclassified 1605
323 Ga0496113_0214052 3300048916 Bacteria 1534
324 Ga0496113_1271203 3300048916 Unclassified 573
325 Ga0496114_0113053 3300048917 Bacteria 2327
326 Ga0496115_0008519 3300048918 Bacteria 7587
327 Ga0496115_0097056 3300048918 Bacteria 2414
328 Ga0495682_0313539 3300049460 Bacteria 553
329 Ga0501233_264302 3300049668 Bacteria 521
330 Ga0501259_102606 3300049688 Bacteria 658
331 Ga0501079_0671234 3300049741 Bacteria 816
332 nmdc:mga03n38_762920_c1 3300050490 Bacteria 561
333 nmdc:mga00v17_561623_c1 3300050491 Bacteria 738
334 nmdc:mga0yw44_249378_c1 3300050492 Bacteria 1181
335 nmdc:mga06z11_151796_c1 3300050494 Bacteria 1318
336 nmdc:mga06z11_29983_c2 3300050494 Bacteria 998
337 nmdc:mga06z11_316297_c1 3300050494 Bacteria 931
338 nmdc:mga06z11_925478_c1 3300050494 Bacteria 531
339 nmdc:mga07m45_93077_c1 3300050496 Bacteria 1728
340 nmdc:mga05p37_624702_c1 3300050507 Bacteria 1212
341 nmdc:mga09592_177215_c1 3300050508 Bacteria 1844
342 nmdc:mga0qj67_420397_c1 3300050509 Bacteria 1078
343 nmdc:mga06r32_313770_c1 3300050510 Bacteria 1554
344 nmdc:mga08y16_37160_c1 3300050511 Bacteria 5115
345 nmdc:mga08y16_565_c1 3300050511 Bacteria 34380
346 nmdc:mga08y16_7453_c1 3300050511 Bacteria 11461
347 nmdc:mga08x19_590218_c1 3300050514 Unclassified 787
348 nmdc:mga0a205_900826_c1 3300050515 Bacteria 731
349 Ga0495595_0070177 3300053084 Bacteria 1655
350 Ga0590075_153331 3300059424 Bacteria 607
351 Ga0501082_1242400 3300060353 Bacteria 651
352 Ga0070664_100304032
353 Ga0065712_10010644
354 Ga0065715_10256364
355 Ga0070658_10035404
356 Ga0070676_10235551
357 Ga0070683_100330144
358 Ga0070690_100400211
359 Ga0070670_100053797
360 Ga0070670_100181835
361 Ga0070670_100471097
362 Ga0070677_10059236
363 Ga0068869_101114881
364 Ga0070666_10150197
365 Ga0070666_11246792
366 Ga0070680_100057703
367 Ga0070682_100017233
368 Ga0070660_100010027
369 Ga0070660_101927062
370 Ga0070661_100017482
371 Ga0070661_101013064
372 Ga0070692_10412503
373 Ga0070668_100944873
374 Ga0070671_100120329
375 Ga0070671_100727886
376 Ga0070674_100113442
377 Ga0070674_100532800
378 Ga0070674_102108351
379 Ga0070659_100068010
380 Ga0070667_100232679
381 Ga0070667_100801330
382 Ga0070667_100872018
383 Ga0070709_10064490
384 Ga0070709_10123671
385 Ga0070709_10125653
386 Ga0070709_10319676
387 Ga0070709_11088431
388 Ga0070714_100114393
389 Ga0070714_100782054
390 Ga0070713_100092706
391 Ga0070713_100149972
392 Ga0070713_100231584
393 Ga0070713_101844434
394 Ga0070713_101957303
395 Ga0070710_10240412
396 Ga0070710_11272909
397 Ga0070711_100000382
398 Ga0070711_100411684
399 Ga0070711_101821212
400 Ga0070700_100586936
401 Ga0070708_101655025
402 Ga0070663_100099083
403 Ga0070663_100271006
404 Ga0070663_100823769
405 Ga0070678_100232529
406 Ga0070662_100036705
407 Ga0070681_10183787
408 Ga0070706_100913316
409 Ga0070706_100914001
410 Ga0070707_101655959
411 Ga0070699_101058609
412 Ga0070679_100011388
413 Ga0070684_101511867
414 Ga0068853_100273904
415 Ga0070672_100370681
416 Ga0070672_101028930
417 Ga0070672_101833148
418 Ga0070672_102088319
419 Ga0070686_100537312
420 Ga0070693_100155604
421 Ga0070665_100160897
422 Ga0068855_100151641
423 Ga0070664_100012501
424 Ga0070664_100022605
425 Ga0068857_100096686
426 Ga0068854_100090067
427 Ga0068856_100086658
428 Ga0068856_102023733
429 Ga0070702_100220196
430 Ga0068852_100551083
431 Ga0068859_101248455
432 Ga0068864_100032492
433 Ga0068861_101024575
434 Ga0068861_101475739
435 Ga0068851_10012501
436 Ga0068870_10332135
437 Ga0068863_100489313
438 Ga0068860_100826193
439 Ga0070717_10069964
440 Ga0070717_10077393
441 Ga0070717_10081473
442 Ga0070717_10636993
443 Ga0075365_10246833
444 Ga0075368_10246630
445 Ga0075364_10908318
446 Ga0070715_10151311
447 Ga0070715_10188368
448 Ga0070716_100061424
449 Ga0070716_100206244
450 Ga0070712_100001264
451 Ga0070712_100002992
452 Ga0070712_100169957
453 Ga0070712_100265113
454 Ga0070712_101195312
455 Ga0075362_10237233
456 Ga0097621_100021320
457 Ga0097621_101064561
458 Ga0075370_10749598
459 Ga0075370_10779417
460 Ga0075370_10850783
461 Ga0075370_11039007
462 Ga0068871_100022299
463 Ga0075428_100059179
464 Ga0075430_100007045
465 Ga0075431_100173438
466 Ga0075431_100743425
467 Ga0075429_100063175
468 Ga0075429_100613851
469 Ga0075436_101076846
470 Ga0097620_100900774
471 Ga0097620_101248431
472 Ga0105240_10044902
473 Ga0111539_10000510
474 Ga0111539_10003652
475 Ga0105247_10217200
476 Ga0105247_10663225
477 Ga0114129_10131935
478 Ga0114129_11837954
479 Ga0105241_10093642
480 Ga0105242_10811191
481 Ga0105242_10890980
482 Ga0105248_10131611
483 Ga0105248_11178076
484 Ga0105237_10119345
485 Ga0105238_10072729
486 Ga0105239_10051526
487 Ga0157371_10123503
488 Ga0157369_10111208
489 Ga0157374_10531212
490 Ga0157378_10255337
491 Ga0163162_10020423
492 Ga0163162_12591641
493 Ga0157372_10133677
494 Ga0157375_10532966
495 Ga0163163_10156909
496 Ga0163163_12446061
497 Ga0157380_10911517
498 Ga0182008_10011439
499 Ga0157377_10599119
500 Ga0157379_10938505
501 Ga0157379_11535640
502 Ga0157376_10473423
503 Ga0182006_1007243
504 Ga0182007_10003124
505 Ga0182005_1027191
506 Ga0163161_10339108
507 Ga0163161_10663731
508 Ga0206355_1370509
509 Ga0207656_10139697
510 Ga0207682_10034410
511 Ga0207692_10183256
512 Ga0207685_10324993
513 Ga0207685_10813209
514 Ga0207699_10127490
515 Ga0207699_10229287
516 Ga0207699_10250067
517 Ga0207699_10304483
518 Ga0207699_10791566
519 Ga0207645_10224199
520 Ga0207643_10932487
521 Ga0207684_11267710
522 Ga0207695_10050096
523 Ga0207671_10087140
524 Ga0207693_10000137
525 Ga0207693_10004623
526 Ga0207693_10255599
527 Ga0207693_10706043
528 Ga0207663_10003456
529 Ga0207657_10035394
530 Ga0207649_10152266
531 Ga0207649_10344041
532 Ga0207694_10079537
533 Ga0207650_10146619
534 Ga0207650_11058321
535 Ga0207659_10501484
536 Ga0207700_10001985
537 Ga0207700_10049454
538 Ga0207700_10117946
539 Ga0207700_10199597
540 Ga0207664_10047530
541 Ga0207664_11676504
542 Ga0207644_10113855
543 Ga0207690_10021636
544 Ga0207706_10007627
545 Ga0207669_10278915
546 Ga0207669_10480392
547 Ga0207665_10079577
548 Ga0207665_10103440
549 Ga0207665_10150501
550 Ga0207691_10404387
551 Ga0207691_10470208
552 Ga0207691_11186101
553 Ga0207711_10360023
554 Ga0207711_11190808
555 Ga0207689_10514385
556 Ga0207689_10793064
557 Ga0207661_10232576
558 Ga0207661_10345910
559 Ga0207679_10207932
560 Ga0207679_10262704
561 Ga0207667_10111597
562 Ga0207668_10909701
563 Ga0207640_10347784
564 Ga0207658_10421664
565 Ga0207658_11655211
566 Ga0207639_10140776
567 Ga0207678_10210593
568 Ga0207678_10701406
569 Ga0207702_10058113
570 Ga0207641_11550167
571 Ga0207641_11554770
572 Ga0207676_10351594
573 Ga0207676_10944160
574 Ga0207676_11538899
575 Ga0207674_10125105
576 Ga0207675_101067282
577 Ga0207675_101496480
578 Ga0207683_10133429
579 Ga0207698_10251210
580 Ga0207698_11392290
581 Ga0209813_10142196
582 Ga0207428_10000654
583 Ga0207428_10034406
584 Ga0268266_10823270
585 Ga0268264_12063398
586 Ga0265338_10096539
587 Ga0265338_10096964
588 Ga0265328_10208404
589 Ga0265325_10059415
590 Ga0265340_10026531
591 Ga0265339_10073182
592 Ga0265331_10196921
593 Ga0265316_10041244
594 Ga0307408_100429025
595 Ga0307408_101896936
596 Ga0265314_10042020
597 Ga0307413_11150384
598 Ga0307410_10361896
599 Ga0307407_10016897
600 Ga0307409_100262177
601 Ga0307409_101406175
602 Ga0307415_101805928
603 Ga0373934_0023980
604 Ga0373923_0218723
605 Ga0373936_0225064
606 Ga0373956_0278455
607 Ga0373956_0454443
608 Ga0373943_0170251
609 Ga0373955_0029615
610 Ga0373955_0308982
611 Ga0373927_0124630
612 Ga0373933_0045710
613 Ga0373947_0055715
614 Ga0373947_0587662
615 Ga0373937_0017078
616 Ga0373937_0056102
617 Ga0373937_0615845
618 Ga0373925_0122521
619 Ga0373925_0306533
620 Ga0395898_0575458
621 Ga0395905_1029279
622 Ga0436364_0190894
623 Ga0436364_1235212
624 Ga0395901_0359044
625 Ga0436363_1325007
626 Ga0451802_0534781
627 Ga0451853_2604221
628 Ga0453684_0939336
629 Ga0466958_0207909
630 Ga0495603_0047517
631 Ga0495629_0018508
632 Ga0495629_0060966
633 Ga0495580_0002458
634 Ga0495582_0003044
635 Ga0495639_0123078
636 Ga0495594_0021018
637 Ga0495621_0223138
638 Ga0495622_0129606
639 Ga0495635_0721056
640 Ga0495588_0562508
641 Ga0495657_0370085
642 Ga0495623_0344283
643 Ga0495658_0274539
644 Ga0495658_0275242
645 Ga0495613_0082575
646 Ga0495674_1072663
647 Ga0495676_0019267
648 Ga0495602_0076531
649 Ga0496100_0038994
650 Ga0496100_0052434
651 Ga0496101_0001821
652 Ga0496101_0107364
653 Ga0496102_0033217
654 Ga0496102_0102985
655 Ga0496103_0033376
656 Ga0496104_0022066
657 Ga0496104_0035235
658 Ga0496104_0275976
659 Ga0496104_0291584
660 Ga0496105_0496858
661 Ga0496106_0019118
662 Ga0496107_0013203
663 Ga0496107_0204871
664 Ga0496108_0041176
665 Ga0496108_0950584
666 Ga0496109_0148465
667 Ga0496109_0683119
668 Ga0496109_1455943
669 Ga0496110_0103203
670 Ga0496110_0222275
671 Ga0496112_0084327
672 Ga0496112_0261889
673 Ga0496112_0282954
674 Ga0496113_0214052
675 Ga0496113_1271203
676 Ga0496114_0113053
677 Ga0496115_0008519
678 Ga0496115_0097056
679 Ga0495682_0313539
680 Ga0501233_264302
681 Ga0501259_102606
682 Ga0501079_0671234
683 nmdc:mga03n38_762920_c1
684 nmdc:mga00v17_561623_c1
685 nmdc:mga0yw44_249378_c1
686 nmdc:mga06z11_151796_c1
687 nmdc:mga06z11_29983_c2
688 nmdc:mga06z11_316297_c1
689 nmdc:mga06z11_925478_c1
690 nmdc:mga07m45_93077_c1
691 nmdc:mga05p37_624702_c1
692 nmdc:mga09592_177215_c1
693 nmdc:mga0qj67_420397_c1
694 nmdc:mga06r32_313770_c1
695 nmdc:mga08y16_37160_c1
696 nmdc:mga08y16_565_c1
697 nmdc:mga08y16_7453_c1
698 nmdc:mga08x19_590218_c1
699 nmdc:mga0a205_900826_c1
700 Ga0495595_0070177
701 Ga0590075_153331
702 Ga0501082_1242400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09360

zf-CDGSH

Iron-binding zinc finger CDGSH type

9

55

0.92

Map