F418559
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 351 | 183 | 351 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100000001|Ga0068855_100000001783 |
| Length | 409 |
| Sequence | MAKEPKDTKKKTAPAADAQPLDLETIKKDLLAKAKKDGAIDQRDITAAIADTPENADILDALYTDLADAGVQVSSDVNALPGEDLPPIAGDDEWTAEDGEEVITEDQNYLDDIADDSVRLYLREIGKIPLLSAEEEFDLAQRIKRGDAAVKDLAAFQESGSKDKKKLEEIAXDKMAEANMRLVVSIAKRYVGRGLDLLDLIQEGNTGLLRAVEKFDPDKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLLRTQRRLTQELNREPTNEEIAAAMEIEVDKVEHIMKIKQDISSLDASIRDDEEDSVLSDFIEDEDTISPEDSATNQLLKEQVKGMLGALTEREQKILKLRFGLEDGKQHTLEEVGQEFSVTRERIRQIEAKALAKLRKHKDAKKLHDYIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 36 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 37 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 38 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 47 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 104 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 105 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 106 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 108 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 110 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 112 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 115 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 122 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 123 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 131 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 132 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 134 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 149 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 150 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 151 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 152 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 153 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 154 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 155 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 157 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 158 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 159 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 161 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 162 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 163 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 164 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 165 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 166 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 167 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 168 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 169 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 170 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 171 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 172 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 173 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 174 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 175 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 176 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 177 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 178 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 179 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 180 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 181 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 182 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.15 |
| Metatranscriptomes | 0.85 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.5 |
| Nodule | 0 |
| Rhizoplane | 0.57 |
| Rhizosphere | 74.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000398 | 3300001915 | Bacteria | 13132 |
| 2 | JGI24740J21852_10003576 | 3300001979 | Bacteria | 6791 |
| 3 | JGI24737J22298_10000068 | 3300001990 | Bacteria | 30563 |
| 4 | JGI24735J21928_10000055 | 3300002067 | Bacteria | 48760 |
| 5 | JGI24742J22300_10000070 | 3300002244 | Bacteria | 14887 |
| 6 | rootH2_10000311 | 3300003320 | Bacteria | 277677 |
| 7 | Ga0058862_10121158 | 3300004803 | Bacteria | 2701 |
| 8 | Ga0065704_10085049 | 3300005289 | Bacteria | 3204 |
| 9 | Ga0070658_10000097 | 3300005327 | Bacteria | 77127 |
| 10 | Ga0070658_10000228 | 3300005327 | Bacteria | 49676 |
| 11 | Ga0070658_10000484 | 3300005327 | Bacteria | 34597 |
| 12 | Ga0070658_10010498 | 3300005327 | Bacteria | 7424 |
| 13 | Ga0070658_10061391 | 3300005327 | Bacteria | 3062 |
| 14 | Ga0070676_10011578 | 3300005328 | Bacteria | 4797 |
| 15 | Ga0070690_100014032 | 3300005330 | Bacteria | 4749 |
| 16 | Ga0070670_100033162 | 3300005331 | Bacteria | 4448 |
| 17 | Ga0070680_100000241 | 3300005336 | Bacteria | 36226 |
| 18 | Ga0070680_100313075 | 3300005336 | Bacteria | 1332 |
| 19 | Ga0070682_100202611 | 3300005337 | Bacteria | 1401 |
| 20 | Ga0070660_100000158 | 3300005339 | Bacteria | 44096 |
| 21 | Ga0070660_100000169 | 3300005339 | Bacteria | 42786 |
| 22 | Ga0070660_100000226 | 3300005339 | Bacteria | 37370 |
| 23 | Ga0070660_100046449 | 3300005339 | Bacteria | 3328 |
| 24 | Ga0070691_10012204 | 3300005341 | Bacteria | 3935 |
| 25 | Ga0070661_100082495 | 3300005344 | Bacteria | 2374 |
| 26 | Ga0070669_100134610 | 3300005353 | Bacteria | 1900 |
| 27 | Ga0070673_100000196 | 3300005364 | Bacteria | 29915 |
| 28 | Ga0070688_100068278 | 3300005365 | Bacteria | 2266 |
| 29 | Ga0070659_100000131 | 3300005366 | Bacteria | 57281 |
| 30 | Ga0070659_100082638 | 3300005366 | Bacteria | 2566 |
| 31 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 32 | Ga0070681_10156801 | 3300005458 | Bacteria | 2201 |
| 33 | Ga0070685_10001076 | 3300005466 | Bacteria | 14635 |
| 34 | Ga0070685_10003561 | 3300005466 | Bacteria | 7904 |
| 35 | Ga0070679_100000332 | 3300005530 | Bacteria | 40130 |
| 36 | Ga0070679_100000499 | 3300005530 | Bacteria | 33449 |
| 37 | Ga0070679_100031712 | 3300005530 | Bacteria | 5224 |
| 38 | Ga0070679_100051299 | 3300005530 | Bacteria | 4109 |
| 39 | Ga0070679_100136461 | 3300005530 | Bacteria | 2434 |
| 40 | Ga0070672_100009953 | 3300005543 | Bacteria | 6576 |
| 41 | Ga0070693_100020562 | 3300005547 | Bacteria | 3483 |
| 42 | Ga0070665_100083305 | 3300005548 | Bacteria | 3203 |
| 43 | Ga0068855_100000001 | 3300005563 | Bacteria | 818777 |
| 44 | Ga0068855_100000324 | 3300005563 | Bacteria | 59520 |
| 45 | Ga0068855_100005245 | 3300005563 | Bacteria | 15810 |
| 46 | Ga0068855_100011636 | 3300005563 | Bacteria | 10632 |
| 47 | Ga0068855_100015134 | 3300005563 | Bacteria | 9289 |
| 48 | Ga0068855_100015189 | 3300005563 | Bacteria | 9273 |
| 49 | Ga0068857_100000001 | 3300005577 | Bacteria | 254081 |
| 50 | Ga0068857_100022116 | 3300005577 | Bacteria | 5593 |
| 51 | Ga0068857_100250908 | 3300005577 | Bacteria | 1622 |
| 52 | Ga0068854_100035485 | 3300005578 | Bacteria | 3490 |
| 53 | Ga0068854_100177702 | 3300005578 | Bacteria | 1661 |
| 54 | Ga0068856_100000002 | 3300005614 | Bacteria | 372816 |
| 55 | Ga0068856_100012876 | 3300005614 | Bacteria | 8096 |
| 56 | Ga0068852_100005458 | 3300005616 | Bacteria | 9096 |
| 57 | Ga0068863_100104064 | 3300005841 | Bacteria | 2700 |
| 58 | Ga0068858_100010008 | 3300005842 | Bacteria | 9008 |
| 59 | Ga0068860_100012430 | 3300005843 | Bacteria | 8385 |
| 60 | Ga0068862_100160879 | 3300005844 | Bacteria | 2004 |
| 61 | Ga0081455_10000020 | 3300005937 | Bacteria | 172997 |
| 62 | Ga0081539_10051450 | 3300005985 | Bacteria | 2321 |
| 63 | Ga0070717_10202487 | 3300006028 | Bacteria | 1739 |
| 64 | Ga0075365_10058932 | 3300006038 | Bacteria | 2557 |
| 65 | Ga0075365_10105726 | 3300006038 | Bacteria | 1931 |
| 66 | Ga0075365_10156337 | 3300006038 | Bacteria | 1587 |
| 67 | Ga0075368_10000088 | 3300006042 | Bacteria | 22805 |
| 68 | Ga0075368_10024814 | 3300006042 | Bacteria | 2298 |
| 69 | Ga0075363_100000029 | 3300006048 | Bacteria | 27762 |
| 70 | Ga0075364_10000161 | 3300006051 | Bacteria | 29761 |
| 71 | Ga0075364_10007538 | 3300006051 | Bacteria | 6469 |
| 72 | Ga0075364_10124966 | 3300006051 | Bacteria | 1724 |
| 73 | Ga0075367_10000007 | 3300006178 | Bacteria | 45077 |
| 74 | Ga0075367_10000242 | 3300006178 | Bacteria | 18517 |
| 75 | Ga0075369_10000004 | 3300006186 | Bacteria | 154675 |
| 76 | Ga0075369_10000048 | 3300006186 | Bacteria | 30990 |
| 77 | Ga0075369_10013369 | 3300006186 | Bacteria | 3258 |
| 78 | Ga0075366_10000003 | 3300006195 | Bacteria | 114017 |
| 79 | Ga0075366_10000015 | 3300006195 | Bacteria | 66498 |
| 80 | Ga0075366_10000030 | 3300006195 | Bacteria | 49629 |
| 81 | Ga0075366_10000064 | 3300006195 | Bacteria | 39771 |
| 82 | Ga0097621_100000001 | 3300006237 | Bacteria | 632268 |
| 83 | Ga0097621_100000130 | 3300006237 | Bacteria | 44188 |
| 84 | Ga0075370_10000063 | 3300006353 | Bacteria | 32195 |
| 85 | Ga0075370_10035936 | 3300006353 | Bacteria | 2782 |
| 86 | Ga0068871_100000001 | 3300006358 | Bacteria | 215987 |
| 87 | Ga0068871_100000006 | 3300006358 | Bacteria | 116822 |
| 88 | Ga0105240_10235987 | 3300009093 | Bacteria | 2122 |
| 89 | Ga0111539_10010609 | 3300009094 | Bacteria | 11600 |
| 90 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 91 | Ga0105245_10409303 | 3300009098 | Bacteria | 1357 |
| 92 | Ga0105243_10181526 | 3300009148 | Bacteria | 1831 |
| 93 | Ga0105241_10000009 | 3300009174 | Bacteria | 258876 |
| 94 | Ga0105241_10001004 | 3300009174 | Bacteria | 21417 |
| 95 | Ga0105241_10024490 | 3300009174 | Bacteria | 4482 |
| 96 | Ga0105242_10001258 | 3300009176 | Bacteria | 19993 |
| 97 | Ga0105248_10188865 | 3300009177 | Bacteria | 2321 |
| 98 | Ga0105238_10000151 | 3300009551 | Bacteria | 76390 |
| 99 | Ga0105238_10081063 | 3300009551 | Bacteria | 3234 |
| 100 | Ga0105238_10125772 | 3300009551 | Bacteria | 2542 |
| 101 | Ga0105249_10000744 | 3300009553 | Bacteria | 29317 |
| 102 | Ga0105249_10029942 | 3300009553 | Bacteria | 4917 |
| 103 | Ga0105033_100189 | 3300009986 | Bacteria | 4740 |
| 104 | Ga0105239_10002455 | 3300010375 | Bacteria | 23626 |
| 105 | Ga0105239_10009666 | 3300010375 | Bacteria | 10845 |
| 106 | Ga0105239_10173060 | 3300010375 | Bacteria | 2415 |
| 107 | Ga0157371_10002482 | 3300013102 | Bacteria | 17534 |
| 108 | Ga0157369_10000273 | 3300013105 | Bacteria | 69535 |
| 109 | Ga0157369_10016734 | 3300013105 | Bacteria | 8242 |
| 110 | Ga0157369_10018169 | 3300013105 | Bacteria | 7887 |
| 111 | Ga0157369_10159571 | 3300013105 | Bacteria | 2380 |
| 112 | Ga0157374_10000014 | 3300013296 | Bacteria | 396846 |
| 113 | Ga0157374_10002318 | 3300013296 | Bacteria | 16050 |
| 114 | Ga0157374_10003583 | 3300013296 | Bacteria | 13073 |
| 115 | Ga0157374_10033473 | 3300013296 | Bacteria | 4689 |
| 116 | Ga0157374_10099058 | 3300013296 | Bacteria | 2791 |
| 117 | Ga0157378_10203670 | 3300013297 | Bacteria | 1873 |
| 118 | Ga0157372_10000774 | 3300013307 | Bacteria | 34598 |
| 119 | Ga0157372_10012683 | 3300013307 | Bacteria | 8979 |
| 120 | Ga0157372_10015808 | 3300013307 | Bacteria | 8097 |
| 121 | Ga0157372_10173195 | 3300013307 | Bacteria | 2497 |
| 122 | Ga0163163_10008260 | 3300014325 | Bacteria | 9241 |
| 123 | Ga0163163_10019410 | 3300014325 | Bacteria | 6386 |
| 124 | Ga0163163_10235020 | 3300014325 | Bacteria | 1882 |
| 125 | Ga0157377_10053574 | 3300014745 | Bacteria | 2281 |
| 126 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 127 | Ga0206356_10657575 | 3300020070 | Bacteria | 1853 |
| 128 | Ga0207645_10014628 | 3300025907 | Bacteria | 5243 |
| 129 | Ga0207705_10000019 | 3300025909 | Bacteria | 317770 |
| 130 | Ga0207705_10000057 | 3300025909 | Bacteria | 157369 |
| 131 | Ga0207705_10000231 | 3300025909 | Bacteria | 55679 |
| 132 | Ga0207705_10002131 | 3300025909 | Bacteria | 15361 |
| 133 | Ga0207705_10083937 | 3300025909 | Bacteria | 2325 |
| 134 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 135 | Ga0207654_10055160 | 3300025911 | Bacteria | 2299 |
| 136 | Ga0207654_10067861 | 3300025911 | Bacteria | 2108 |
| 137 | Ga0207654_10102374 | 3300025911 | Bacteria | 1767 |
| 138 | Ga0207707_10010266 | 3300025912 | Bacteria | 8126 |
| 139 | Ga0207707_10013359 | 3300025912 | Bacteria | 7158 |
| 140 | Ga0207695_10056979 | 3300025913 | Bacteria | 4063 |
| 141 | Ga0207695_10206607 | 3300025913 | Bacteria | 1876 |
| 142 | Ga0207660_10000180 | 3300025917 | Bacteria | 40305 |
| 143 | Ga0207657_10000502 | 3300025919 | Bacteria | 41290 |
| 144 | Ga0207657_10003173 | 3300025919 | Bacteria | 17584 |
| 145 | Ga0207657_10023455 | 3300025919 | Bacteria | 5745 |
| 146 | Ga0207652_10003400 | 3300025921 | Bacteria | 13140 |
| 147 | Ga0207652_10037375 | 3300025921 | Bacteria | 4110 |
| 148 | Ga0207652_10249630 | 3300025921 | Bacteria | 1600 |
| 149 | Ga0207652_10310781 | 3300025921 | Bacteria | 1423 |
| 150 | Ga0207694_10001155 | 3300025924 | Bacteria | 22934 |
| 151 | Ga0207694_10181483 | 3300025924 | Bacteria | 1707 |
| 152 | Ga0207694_10182152 | 3300025924 | Bacteria | 1704 |
| 153 | Ga0207650_10006693 | 3300025925 | Bacteria | 7858 |
| 154 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 155 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 156 | Ga0207687_10000008 | 3300025927 | Bacteria | 497738 |
| 157 | Ga0207687_10023727 | 3300025927 | Bacteria | 4091 |
| 158 | Ga0207664_10000161 | 3300025929 | Bacteria | 53847 |
| 159 | Ga0207644_10036256 | 3300025931 | Bacteria | 3461 |
| 160 | Ga0207690_10001822 | 3300025932 | Bacteria | 13077 |
| 161 | Ga0207690_10204590 | 3300025932 | Bacteria | 1501 |
| 162 | Ga0207686_10002162 | 3300025934 | Bacteria | 10824 |
| 163 | Ga0207709_10108585 | 3300025935 | Bacteria | 1850 |
| 164 | Ga0207691_10048127 | 3300025940 | Bacteria | 3910 |
| 165 | Ga0207667_10000003 | 3300025949 | Bacteria | 822935 |
| 166 | Ga0207667_10000577 | 3300025949 | Bacteria | 47784 |
| 167 | Ga0207667_10004707 | 3300025949 | Bacteria | 16698 |
| 168 | Ga0207667_10010449 | 3300025949 | Bacteria | 10850 |
| 169 | Ga0207667_10023342 | 3300025949 | Bacteria | 6812 |
| 170 | Ga0207667_10023585 | 3300025949 | Bacteria | 6774 |
| 171 | Ga0207667_10034628 | 3300025949 | Bacteria | 5421 |
| 172 | Ga0207651_10001595 | 3300025960 | Bacteria | 10386 |
| 173 | Ga0207712_10072962 | 3300025961 | Bacteria | 2474 |
| 174 | Ga0207712_10258704 | 3300025961 | Bacteria | 1410 |
| 175 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 176 | Ga0207703_10029719 | 3300026035 | Bacteria | 4314 |
| 177 | Ga0207702_10000001 | 3300026078 | Bacteria | 895738 |
| 178 | Ga0207702_10038776 | 3300026078 | Bacteria | 3990 |
| 179 | Ga0207641_10091066 | 3300026088 | Bacteria | 2668 |
| 180 | Ga0207641_10110193 | 3300026088 | Bacteria | 2439 |
| 181 | Ga0207674_10000021 | 3300026116 | Bacteria | 161986 |
| 182 | Ga0207674_10016071 | 3300026116 | Bacteria | 8199 |
| 183 | Ga0207674_10125112 | 3300026116 | Bacteria | 2537 |
| 184 | Ga0207674_10367570 | 3300026116 | Bacteria | 1390 |
| 185 | Ga0207698_10010288 | 3300026142 | Bacteria | 6000 |
| 186 | Ga0207698_10014281 | 3300026142 | Bacteria | 5274 |
| 187 | Ga0210002_1004533 | 3300027617 | Bacteria | 2072 |
| 188 | Ga0209813_10000003 | 3300027866 | Bacteria | 207060 |
| 189 | Ga0209813_10012369 | 3300027866 | Bacteria | 2254 |
| 190 | Ga0209974_10004134 | 3300027876 | Bacteria | 5187 |
| 191 | Ga0268266_10002107 | 3300028379 | Bacteria | 21977 |
| 192 | Ga0268266_10062784 | 3300028379 | Bacteria | 3207 |
| 193 | Ga0268265_10234813 | 3300028380 | Bacteria | 1614 |
| 194 | Ga0268264_10002081 | 3300028381 | Bacteria | 17870 |
| 195 | Ga0268264_10040640 | 3300028381 | Bacteria | 3843 |
| 196 | Ga0265337_1000048 | 3300028556 | Bacteria | 53749 |
| 197 | Ga0265337_1000791 | 3300028556 | Bacteria | 16642 |
| 198 | Ga0265337_1003484 | 3300028556 | Bacteria | 6799 |
| 199 | Ga0265326_10000208 | 3300028558 | Bacteria | 29214 |
| 200 | Ga0265326_10000917 | 3300028558 | Bacteria | 10679 |
| 201 | Ga0265326_10002637 | 3300028558 | Bacteria | 6007 |
| 202 | Ga0265326_10022498 | 3300028558 | Bacteria | 1805 |
| 203 | Ga0265326_10045778 | 3300028558 | Bacteria | 1240 |
| 204 | Ga0265319_1044591 | 3300028563 | Bacteria | 1486 |
| 205 | Ga0265334_10000004 | 3300028573 | Bacteria | 243436 |
| 206 | Ga0265334_10000041 | 3300028573 | Bacteria | 98258 |
| 207 | Ga0265334_10001327 | 3300028573 | Bacteria | 11930 |
| 208 | Ga0265334_10010386 | 3300028573 | Bacteria | 3934 |
| 209 | Ga0265322_10002738 | 3300028654 | Bacteria | 5404 |
| 210 | Ga0265322_10008048 | 3300028654 | Bacteria | 3074 |
| 211 | Ga0265336_10000020 | 3300028666 | Bacteria | 213480 |
| 212 | Ga0265336_10023535 | 3300028666 | Bacteria | 1952 |
| 213 | Ga0265338_10000003 | 3300028800 | Bacteria | 733923 |
| 214 | Ga0265338_10000093 | 3300028800 | Bacteria | 168444 |
| 215 | Ga0265338_10001060 | 3300028800 | Bacteria | 45733 |
| 216 | Ga0265338_10001799 | 3300028800 | Bacteria | 33714 |
| 217 | Ga0265338_10002189 | 3300028800 | Bacteria | 29934 |
| 218 | Ga0265338_10002656 | 3300028800 | Bacteria | 26294 |
| 219 | Ga0265338_10003103 | 3300028800 | Bacteria | 23792 |
| 220 | Ga0265338_10003205 | 3300028800 | Bacteria | 23342 |
| 221 | Ga0265338_10004463 | 3300028800 | Bacteria | 18876 |
| 222 | Ga0265338_10025470 | 3300028800 | Bacteria | 6000 |
| 223 | Ga0265338_10056817 | 3300028800 | Bacteria | 3466 |
| 224 | Ga0265338_10065073 | 3300028800 | Bacteria | 3166 |
| 225 | Ga0265338_10102261 | 3300028800 | Bacteria | 2330 |
| 226 | Ga0265338_10215779 | 3300028800 | Bacteria | 1437 |
| 227 | Ga0265324_10002301 | 3300029957 | Bacteria | 9933 |
| 228 | Ga0265324_10008000 | 3300029957 | Bacteria | 4236 |
| 229 | Ga0265340_10001423 | 3300031247 | Bacteria | 13734 |
| 230 | Ga0265339_10044765 | 3300031249 | Bacteria | 2439 |
| 231 | Ga0265339_10049672 | 3300031249 | Bacteria | 2296 |
| 232 | Ga0265327_10000025 | 3300031251 | Bacteria | 380054 |
| 233 | Ga0265327_10001879 | 3300031251 | Bacteria | 24298 |
| 234 | Ga0265327_10019705 | 3300031251 | Bacteria | 4136 |
| 235 | Ga0265316_10022626 | 3300031344 | Bacteria | 5293 |
| 236 | Ga0265313_10037105 | 3300031595 | Bacteria | 2440 |
| 237 | Ga0265314_10101193 | 3300031711 | Bacteria | 1852 |
| 238 | Ga0307516_10124102 | 3300031730 | Bacteria | 2369 |
| 239 | Ga0395900_0000434 | 3300037418 | Bacteria | 60035 |
| 240 | Ga0395900_0013775 | 3300037418 | Bacteria | 8254 |
| 241 | Ga0395900_0024306 | 3300037418 | Bacteria | 6204 |
| 242 | Ga0395898_0004623 | 3300037466 | Bacteria | 15027 |
| 243 | Ga0395898_0016917 | 3300037466 | Bacteria | 7445 |
| 244 | Ga0395905_0002998 | 3300037471 | Bacteria | 18308 |
| 245 | Ga0395905_0061933 | 3300037471 | Bacteria | 3500 |
| 246 | Ga0395905_0148677 | 3300037471 | Bacteria | 2204 |
| 247 | Ga0395901_0004862 | 3300038443 | Bacteria | 13561 |
| 248 | Ga0395901_0012573 | 3300038443 | Bacteria | 8590 |
| 249 | Ga0395901_0057984 | 3300038443 | Bacteria | 4028 |
| 250 | Ga0395901_0277491 | 3300038443 | Bacteria | 1742 |
| 251 | Ga0451807_2078009 | 3300041486 | Bacteria | 2262 |
| 252 | Ga0495629_0008743 | 3300046459 | Bacteria | 7446 |
| 253 | Ga0495622_0000008 | 3300046557 | Bacteria | 232461 |
| 254 | Ga0495588_0000322 | 3300046674 | Bacteria | 31828 |
| 255 | Ga0495658_0002196 | 3300046683 | Bacteria | 9875 |
| 256 | Ga0495649_0000025 | 3300046694 | Bacteria | 175449 |
| 257 | Ga0495672_0000323 | 3300047320 | Bacteria | 63547 |
| 258 | Ga0495602_0068077 | 3300048088 | Bacteria | 3060 |
| 259 | Ga0496100_0011756 | 3300048903 | Bacteria | 4993 |
| 260 | Ga0496126_0262858 | 3300048929 | Bacteria | 1434 |
| 261 | Ga0501031_0000789 | 3300049568 | Bacteria | 19049 |
| 262 | Ga0501032_0001140 | 3300049569 | Bacteria | 21269 |
| 263 | Ga0501034_0008367 | 3300049571 | Bacteria | 10937 |
| 264 | Ga0501034_0056811 | 3300049571 | Bacteria | 3936 |
| 265 | Ga0501036_0001992 | 3300049572 | Bacteria | 15858 |
| 266 | Ga0501037_0000146 | 3300049573 | Bacteria | 65527 |
| 267 | Ga0501037_0092212 | 3300049573 | Bacteria | 2191 |
| 268 | Ga0501037_0183439 | 3300049573 | Bacteria | 1484 |
| 269 | Ga0501038_0005119 | 3300049574 | Bacteria | 12181 |
| 270 | Ga0501043_0002239 | 3300049579 | Bacteria | 16470 |
| 271 | Ga0501046_0000061 | 3300049580 | Bacteria | 120487 |
| 272 | Ga0501047_0000024 | 3300049581 | Bacteria | 230397 |
| 273 | Ga0501047_0000637 | 3300049581 | Bacteria | 36844 |
| 274 | Ga0501048_0000002 | 3300049582 | Bacteria | 108048 |
| 275 | Ga0501048_0054868 | 3300049582 | Bacteria | 2831 |
| 276 | Ga0501070_0014554 | 3300049586 | Bacteria | 6620 |
| 277 | Ga0501070_0017559 | 3300049586 | Bacteria | 6006 |
| 278 | Ga0501073_0058441 | 3300049589 | Bacteria | 2695 |
| 279 | Ga0501080_0000007 | 3300049742 | Bacteria | 135749 |
| 280 | Ga0501083_0042106 | 3300049744 | Bacteria | 3097 |
| 281 | Ga0501083_0136157 | 3300049744 | Bacteria | 1609 |
| 282 | Ga0501035_0000005 | 3300049822 | Bacteria | 392980 |
| 283 | Ga0501035_0004999 | 3300049822 | Bacteria | 12560 |
| 284 | Ga0501044_0003400 | 3300049823 | Bacteria | 17928 |
| 285 | nmdc:mga03n38_23556_c1 | 3300050490 | Bacteria | 2506 |
| 286 | nmdc:mga03n38_53_c1 | 3300050490 | Bacteria | 18217 |
| 287 | nmdc:mga00v17_12456_c2 | 3300050491 | Bacteria | 2336 |
| 288 | nmdc:mga00v17_13380_c1 | 3300050491 | Bacteria | 4554 |
| 289 | nmdc:mga00v17_171242_c1 | 3300050491 | Bacteria | 1400 |
| 290 | nmdc:mga00v17_50469_c1 | 3300050491 | Bacteria | 2528 |
| 291 | nmdc:mga00v17_69000_c1 | 3300050491 | Bacteria | 2186 |
| 292 | nmdc:mga0yw44_137228_c1 | 3300050492 | Bacteria | 1587 |
| 293 | nmdc:mga0yw44_26128_c1 | 3300050492 | Bacteria | 3331 |
| 294 | nmdc:mga0yw44_37839_c1 | 3300050492 | Bacteria | 2395 |
| 295 | nmdc:mga0yw44_74714_c1 | 3300050492 | Bacteria | 2112 |
| 296 | nmdc:mga0yw44_7_c1 | 3300050492 | Bacteria | 260877 |
| 297 | nmdc:mga0k408_15_c1 | 3300050493 | Bacteria | 124193 |
| 298 | nmdc:mga0k408_181_c1 | 3300050493 | Bacteria | 33119 |
| 299 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 300 | nmdc:mga0k408_56_c1 | 3300050493 | Bacteria | 57024 |
| 301 | nmdc:mga0k408_59_c1 | 3300050493 | Bacteria | 39640 |
| 302 | nmdc:mga06z11_144_c1 | 3300050494 | Bacteria | 28448 |
| 303 | nmdc:mga06z11_2_c1 | 3300050494 | Bacteria | 169056 |
| 304 | nmdc:mga04h51_10661_c1 | 3300050495 | Bacteria | 2529 |
| 305 | nmdc:mga04h51_3_c1 | 3300050495 | Bacteria | 207078 |
| 306 | nmdc:mga07m45_19726_c1 | 3300050496 | Bacteria | 3654 |
| 307 | nmdc:mga07m45_885_c1 | 3300050496 | Bacteria | 13073 |
| 308 | nmdc:mga08y16_6406_c1 | 3300050511 | Bacteria | 12340 |
| 309 | nmdc:mga0sz30_10_c3 | 3300050516 | Bacteria | 40799 |
| 310 | nmdc:mga0sz30_11774_c1 | 3300050516 | Bacteria | 2624 |
| 311 | nmdc:mga0sz30_2_c1 | 3300050516 | Bacteria | 626403 |
| 312 | Ga0500610_0000011 | 3300053079 | Bacteria | 91172 |
| 313 | Ga0500610_0004071 | 3300053079 | Bacteria | 5733 |
| 314 | Ga0500643_000009 | 3300053087 | Bacteria | 444150 |
| 315 | Ga0500644_0000436 | 3300053088 | Bacteria | 19303 |
| 316 | Ga0500644_0000704 | 3300053088 | Bacteria | 11847 |
| 317 | Ga0500644_0027551 | 3300053088 | Bacteria | 1769 |
| 318 | Ga0500646_0000253 | 3300053090 | Bacteria | 16386 |
| 319 | Ga0500583_0000085 | 3300053092 | Bacteria | 52578 |
| 320 | Ga0500583_0001791 | 3300053092 | Bacteria | 6289 |
| 321 | Ga0500583_0002012 | 3300053092 | Bacteria | 5989 |
| 322 | Ga0500651_0000011 | 3300053093 | Bacteria | 246573 |
| 323 | Ga0500651_0022760 | 3300053093 | Bacteria | 3917 |
| 324 | Ga0500651_0086810 | 3300053093 | Bacteria | 1932 |
| 325 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 326 | Ga0500650_0000040 | 3300053098 | Bacteria | 48637 |
| 327 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 328 | Ga0500555_000002 | 3300053103 | Bacteria | 1314346 |
| 329 | Ga0500556_0000419 | 3300053104 | Bacteria | 30563 |
| 330 | Ga0500562_000001 | 3300053108 | Bacteria | 1178987 |
| 331 | Ga0500562_000002 | 3300053108 | Bacteria | 977234 |
| 332 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 333 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 334 | Ga0500614_001870 | 3300053123 | Bacteria | 4865 |
| 335 | Ga0500614_005800 | 3300053123 | Bacteria | 2594 |
| 336 | Ga0500642_0002412 | 3300053130 | Bacteria | 5483 |
| 337 | Ga0500652_000012 | 3300053131 | Bacteria | 155076 |
| 338 | Ga0500655_000798 | 3300053133 | Bacteria | 6192 |
| 339 | Ga0500655_004856 | 3300053133 | Bacteria | 2416 |
| 340 | Ga0500561_0000002 | 3300053137 | Bacteria | 394147 |
| 341 | Ga0500568_0015748 | 3300053139 | Bacteria | 3378 |
| 342 | Ga0500577_0001073 | 3300053142 | Bacteria | 7051 |
| 343 | Ga0500577_0001601 | 3300053142 | Bacteria | 5799 |
| 344 | Ga0500589_000003 | 3300053147 | Bacteria | 220717 |
| 345 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 346 | Ga0500633_0007245 | 3300053160 | Bacteria | 2781 |
| 347 | Ga0500649_000006 | 3300053722 | Bacteria | 116211 |
| 348 | Ga0500570_000001 | 3300053724 | Bacteria | 243552 |
| 349 | Ga0500611_000391 | 3300053727 | Bacteria | 4460 |
| 350 | Ga0587083_0009177 | 3300059505 | Bacteria | 1570 |
| 351 | Ga0501082_0016454 | 3300060353 | Bacteria | 6366 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0000323 | Ga0495672_0000323_16167_17384 | 288 |
| 2 | 3300005327 | Ga0070658_10000097 | Ga0070658_1000009746 | 298 |
| 3 | 3300025909 | Ga0207705_10000057 | Ga0207705_1000005732 | 298 |
| 4 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001878 | 299 |
| 5 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001439 | 299 |
| 6 | 3300025927 | Ga0207687_10000004 | Ga0207687_10000004393 | 299 |
| 7 | 3300006042 | Ga0075368_10000088 | Ga0075368_1000008822 | 301 |
| 8 | 3300006048 | Ga0075363_100000029 | Ga0075363_10000002933 | 301 |
| 9 | 3300006178 | Ga0075367_10000242 | Ga0075367_1000024222 | 301 |
| 10 | 3300006353 | Ga0075370_10000063 | Ga0075370_1000006319 | 301 |
| 11 | 3300027866 | Ga0209813_10000003 | Ga0209813_10000003167 | 301 |
| 12 | 3300028573 | Ga0265334_10000041 | Ga0265334_1000004170 | 301 |
| 13 | 3300028800 | Ga0265338_10003205 | Ga0265338_1000320512 | 301 |
| 14 | 3300031247 | Ga0265340_10001423 | Ga0265340_100014233 | 301 |
| 15 | 3300037471 | Ga0395905_0148677 | Ga0395905_0148677_141_1262 | 301 |
| 16 | 3300050490 | nmdc:mga03n38_23556_c1 | nmdc:mga03n38_23556_c1_709_1851 | 301 |
| 17 | 3300050490 | nmdc:mga03n38_53_c1 | nmdc:mga03n38_53_c1_9820_10980 | 301 |
| 18 | 3300050494 | nmdc:mga06z11_2_c1 | nmdc:mga06z11_2_c1_16124_17284 | 301 |
| 19 | 3300050495 | nmdc:mga04h51_3_c1 | nmdc:mga04h51_3_c1_54144_55304 | 301 |
| 20 | 3300050496 | nmdc:mga07m45_885_c1 | nmdc:mga07m45_885_c1_8758_9918 | 301 |
| 21 | 3300009174 | Ga0105241_10001004 | Ga0105241_1000100415 | 302 |
| 22 | 3300025911 | Ga0207654_10055160 | Ga0207654_100551603 | 302 |
| 23 | 3300005844 | Ga0068862_100160879 | Ga0068862_1001608792 | 305 |
| 24 | 3300013296 | Ga0157374_10003583 | Ga0157374_1000358312 | 305 |
| 25 | 3300025961 | Ga0207712_10258704 | Ga0207712_102587042 | 305 |
| 26 | 3300028380 | Ga0268265_10234813 | Ga0268265_102348131 | 305 |
| 27 | 3300005331 | Ga0070670_100033162 | Ga0070670_1000331622 | 306 |
| 28 | 3300005367 | Ga0070667_100000001 | Ga0070667_100000001105 | 306 |
| 29 | 3300005843 | Ga0068860_100012430 | Ga0068860_10001243010 | 306 |
| 30 | 3300025925 | Ga0207650_10006693 | Ga0207650_100066936 | 306 |
| 31 | 3300025986 | Ga0207658_10000003 | Ga0207658_1000000357 | 306 |
| 32 | 3300028381 | Ga0268264_10002081 | Ga0268264_1000208119 | 306 |
| 33 | 3300053092 | Ga0500583_0001791 | Ga0500583_0001791_1982_3229 | 306 |
| 34 | 3300049568 | Ga0501031_0000789 | Ga0501031_0000789_5538_6698 | 307 |
| 35 | 3300049569 | Ga0501032_0001140 | Ga0501032_0001140_12319_13479 | 307 |
| 36 | 3300049571 | Ga0501034_0056811 | Ga0501034_0056811_2058_3218 | 307 |
| 37 | 3300049572 | Ga0501036_0001992 | Ga0501036_0001992_3454_4614 | 307 |
| 38 | 3300049573 | Ga0501037_0000146 | Ga0501037_0000146_11113_12273 | 307 |
| 39 | 3300049574 | Ga0501038_0005119 | Ga0501038_0005119_492_1652 | 307 |
| 40 | 3300049579 | Ga0501043_0002239 | Ga0501043_0002239_4496_5656 | 307 |
| 41 | 3300049580 | Ga0501046_0000061 | Ga0501046_0000061_11173_12333 | 307 |
| 42 | 3300049581 | Ga0501047_0000637 | Ga0501047_0000637_22840_24000 | 307 |
| 43 | 3300049582 | Ga0501048_0000002 | Ga0501048_0000002_62339_63499 | 307 |
| 44 | 3300049586 | Ga0501070_0017559 | Ga0501070_0017559_225_1385 | 307 |
| 45 | 3300049822 | Ga0501035_0004999 | Ga0501035_0004999_10517_11677 | 307 |
| 46 | 3300049823 | Ga0501044_0003400 | Ga0501044_0003400_9121_10281 | 307 |
| 47 | 3300060353 | Ga0501082_0016454 | Ga0501082_0016454_3830_4990 | 307 |
| 48 | 3300041486 | Ga0451807_2078009 | Ga0451807_2078009_800_1975 | 309 |
| 49 | 3300053104 | Ga0500556_0000419 | Ga0500556_0000419_10110_11249 | 309 |
| 50 | 3300005530 | Ga0070679_100031712 | Ga0070679_1000317123 | 310 |
| 51 | 3300009553 | Ga0105249_10029942 | Ga0105249_100299424 | 311 |
| 52 | 3300005577 | Ga0068857_100250908 | Ga0068857_1002509081 | 312 |
| 53 | 3300006237 | Ga0097621_100000130 | Ga0097621_10000013013 | 312 |
| 54 | 3300006358 | Ga0068871_100000006 | Ga0068871_10000000654 | 312 |
| 55 | 3300010375 | Ga0105239_10173060 | Ga0105239_101730602 | 313 |
| 56 | 3300053108 | Ga0500562_000002 | Ga0500562_000002_348835_350001 | 313 |
| 57 | 3300005330 | Ga0070690_100014032 | Ga0070690_1000140322 | 314 |
| 58 | 3300005336 | Ga0070680_100313075 | Ga0070680_1003130751 | 314 |
| 59 | 3300003320 | rootH2_10000311 | rootH2_10000311235 | 316 |
| 60 | 3300005339 | Ga0070660_100000158 | Ga0070660_1000001587 | 316 |
| 61 | 3300006038 | Ga0075365_10156337 | Ga0075365_101563372 | 316 |
| 62 | 3300006051 | Ga0075364_10124966 | Ga0075364_101249662 | 316 |
| 63 | 3300006186 | Ga0075369_10013369 | Ga0075369_100133694 | 316 |
| 64 | 3300006353 | Ga0075370_10035936 | Ga0075370_100359362 | 316 |
| 65 | 3300025919 | Ga0207657_10003173 | Ga0207657_100031737 | 316 |
| 66 | 3300050491 | nmdc:mga00v17_171242_c1 | nmdc:mga00v17_171242_c1_203_1375 | 316 |
| 67 | 3300050491 | nmdc:mga00v17_50469_c1 | nmdc:mga00v17_50469_c1_72_1205 | 316 |
| 68 | 3300050492 | nmdc:mga0yw44_137228_c1 | nmdc:mga0yw44_137228_c1_159_1331 | 316 |
| 69 | 3300050492 | nmdc:mga0yw44_7_c1 | nmdc:mga0yw44_7_c1_161748_162890 | 316 |
| 70 | 3300050496 | nmdc:mga07m45_19726_c1 | nmdc:mga07m45_19726_c1_311_1453 | 316 |
| 71 | 3300050516 | nmdc:mga0sz30_11774_c1 | nmdc:mga0sz30_11774_c1_225_1358 | 316 |
| 72 | 3300002244 | JGI24742J22300_10000070 | JGI24742J22300_100000708 | 317 |
| 73 | 3300005327 | Ga0070658_10000484 | Ga0070658_1000048422 | 317 |
| 74 | 3300025909 | Ga0207705_10000019 | Ga0207705_10000019237 | 317 |
| 75 | 3300038443 | Ga0395901_0012573 | Ga0395901_0012573_1465_2610 | 317 |
| 76 | 3300048903 | Ga0496100_0011756 | Ga0496100_0011756_2525_3673 | 317 |
| 77 | 3300005289 | Ga0065704_10085049 | Ga0065704_100850494 | 318 |
| 78 | 3300006195 | Ga0075366_10000015 | Ga0075366_100000159 | 318 |
| 79 | 3300013296 | Ga0157374_10000014 | Ga0157374_10000014341 | 318 |
| 80 | 3300014325 | Ga0163163_10008260 | Ga0163163_100082606 | 318 |
| 81 | 3300025927 | Ga0207687_10000008 | Ga0207687_10000008341 | 318 |
| 82 | 3300049571 | Ga0501034_0008367 | Ga0501034_0008367_43_1191 | 318 |
| 83 | 3300049573 | Ga0501037_0092212 | Ga0501037_0092212_710_1858 | 318 |
| 84 | 3300049581 | Ga0501047_0000024 | Ga0501047_0000024_107161_108309 | 318 |
| 85 | 3300049582 | Ga0501048_0054868 | Ga0501048_0054868_191_1339 | 318 |
| 86 | 3300049822 | Ga0501035_0000005 | Ga0501035_0000005_107246_108394 | 318 |
| 87 | 3300050493 | nmdc:mga0k408_59_c1 | nmdc:mga0k408_59_c1_2241_3380 | 318 |
| 88 | 3300005328 | Ga0070676_10011578 | Ga0070676_100115784 | 319 |
| 89 | 3300005364 | Ga0070673_100000196 | Ga0070673_10000019631 | 319 |
| 90 | 3300005466 | Ga0070685_10003561 | Ga0070685_100035614 | 319 |
| 91 | 3300005543 | Ga0070672_100009953 | Ga0070672_1000099537 | 319 |
| 92 | 3300005548 | Ga0070665_100083305 | Ga0070665_1000833052 | 319 |
| 93 | 3300006186 | Ga0075369_10000004 | Ga0075369_1000000457 | 319 |
| 94 | 3300006237 | Ga0097621_100000001 | Ga0097621_100000001257 | 319 |
| 95 | 3300006358 | Ga0068871_100000001 | Ga0068871_100000001111 | 319 |
| 96 | 3300009098 | Ga0105245_10409303 | Ga0105245_104093032 | 319 |
| 97 | 3300010375 | Ga0105239_10009666 | Ga0105239_1000966610 | 319 |
| 98 | 3300013102 | Ga0157371_10002482 | Ga0157371_100024829 | 319 |
| 99 | 3300013297 | Ga0157378_10203670 | Ga0157378_102036702 | 319 |
| 100 | 3300025907 | Ga0207645_10014628 | Ga0207645_100146282 | 319 |
| 101 | 3300025909 | Ga0207705_10000231 | Ga0207705_1000023132 | 319 |
| 102 | 3300025940 | Ga0207691_10048127 | Ga0207691_100481272 | 319 |
| 103 | 3300025949 | Ga0207667_10023585 | Ga0207667_100235854 | 319 |
| 104 | 3300025960 | Ga0207651_10001595 | Ga0207651_100015957 | 319 |
| 105 | 3300028379 | Ga0268266_10062784 | Ga0268266_100627842 | 319 |
| 106 | 3300031251 | Ga0265327_10001879 | Ga0265327_100018795 | 319 |
| 107 | 3300046459 | Ga0495629_0008743 | Ga0495629_0008743_2576_3718 | 319 |
| 108 | 3300046557 | Ga0495622_0000008 | Ga0495622_0000008_228996_230138 | 319 |
| 109 | 3300046674 | Ga0495588_0000322 | Ga0495588_0000322_5477_6631 | 319 |
| 110 | 3300046683 | Ga0495658_0002196 | Ga0495658_0002196_6015_7157 | 319 |
| 111 | 3300048088 | Ga0495602_0068077 | Ga0495602_0068077_789_1931 | 319 |
| 112 | 3300050516 | nmdc:mga0sz30_2_c1 | nmdc:mga0sz30_2_c1_170767_171909 | 319 |
| 113 | 3300053079 | Ga0500610_0004071 | Ga0500610_0004071_2533_3678 | 319 |
| 114 | 3300053088 | Ga0500644_0000436 | Ga0500644_0000436_278_1417 | 319 |
| 115 | 3300053092 | Ga0500583_0000085 | Ga0500583_0000085_34418_35563 | 319 |
| 116 | 3300053093 | Ga0500651_0086810 | Ga0500651_0086810_597_1742 | 319 |
| 117 | 3300053094 | Ga0500566_0000001 | Ga0500566_0000001_63123_64265 | 319 |
| 118 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_949335_950489 | 319 |
| 119 | 3300053123 | Ga0500614_005800 | Ga0500614_005800_608_1750 | 319 |
| 120 | 3300053130 | Ga0500642_0002412 | Ga0500642_0002412_3210_4355 | 319 |
| 121 | 3300053142 | Ga0500577_0001073 | Ga0500577_0001073_658_1797 | 319 |
| 122 | 3300053147 | Ga0500589_000003 | Ga0500589_000003_97806_98951 | 319 |
| 123 | 3300053722 | Ga0500649_000006 | Ga0500649_000006_42814_43968 | 319 |
| 124 | 3300053727 | Ga0500611_000391 | Ga0500611_000391_1331_2470 | 319 |
| 125 | 3300014969 | Ga0157376_10000001 | Ga0157376_10000001795 | 320 |
| 126 | 3300025927 | Ga0207687_10023727 | Ga0207687_100237274 | 320 |
| 127 | 3300027617 | Ga0210002_1004533 | Ga0210002_10045332 | 320 |
| 128 | 3300027876 | Ga0209974_10004134 | Ga0209974_100041346 | 320 |
| 129 | 3300031730 | Ga0307516_10124102 | Ga0307516_101241022 | 320 |
| 130 | 3300053079 | Ga0500610_0000011 | Ga0500610_0000011_14799_15965 | 320 |
| 131 | 3300053088 | Ga0500644_0000704 | Ga0500644_0000704_2605_3771 | 320 |
| 132 | 3300053103 | Ga0500555_000002 | Ga0500555_000002_1190597_1191763 | 320 |
| 133 | 3300053131 | Ga0500652_000012 | Ga0500652_000012_7871_9037 | 320 |
| 134 | 3300009553 | Ga0105249_10000744 | Ga0105249_100007448 | 321 |
| 135 | 3300025961 | Ga0207712_10072962 | Ga0207712_100729622 | 321 |
| 136 | 3300049744 | Ga0501083_0136157 | Ga0501083_0136157_183_1343 | 322 |
| 137 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_103541_104680 | 322 |
| 138 | 3300053108 | Ga0500562_000001 | Ga0500562_000001_808117_809136 | 322 |
| 139 | 3300053133 | Ga0500655_004856 | Ga0500655_004856_706_1725 | 322 |
| 140 | 3300005937 | Ga0081455_10000020 | Ga0081455_10000020120 | 323 |
| 141 | 3300006186 | Ga0075369_10000048 | Ga0075369_100000483 | 323 |
| 142 | 3300006195 | Ga0075366_10000003 | Ga0075366_1000000321 | 323 |
| 143 | 3300038443 | Ga0395901_0004862 | Ga0395901_0004862_11456_12601 | 323 |
| 144 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_98771_99919 | 323 |
| 145 | 3300050516 | nmdc:mga0sz30_10_c3 | nmdc:mga0sz30_10_c3_27538_28686 | 323 |
| 146 | 3300053088 | Ga0500644_0027551 | Ga0500644_0027551_570_1718 | 323 |
| 147 | 3300053090 | Ga0500646_0000253 | Ga0500646_0000253_11306_12454 | 323 |
| 148 | 3300053092 | Ga0500583_0002012 | Ga0500583_0002012_1463_2611 | 323 |
| 149 | 3300053098 | Ga0500650_0000040 | Ga0500650_0000040_6621_7769 | 323 |
| 150 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_514068_515216 | 323 |
| 151 | 3300053133 | Ga0500655_000798 | Ga0500655_000798_3782_4930 | 323 |
| 152 | 3300053142 | Ga0500577_0001601 | Ga0500577_0001601_1988_3136 | 323 |
| 153 | 3300053160 | Ga0500633_0007245 | Ga0500633_0007245_1095_2243 | 323 |
| 154 | 3300053724 | Ga0500570_000001 | Ga0500570_000001_138963_140099 | 323 |
| 155 | 3300005563 | Ga0068855_100011636 | Ga0068855_1000116367 | 324 |
| 156 | 3300006042 | Ga0075368_10024814 | Ga0075368_100248143 | 324 |
| 157 | 3300006178 | Ga0075367_10000007 | Ga0075367_100000074 | 324 |
| 158 | 3300006195 | Ga0075366_10000064 | Ga0075366_1000006439 | 324 |
| 159 | 3300009094 | Ga0111539_10010609 | Ga0111539_100106093 | 324 |
| 160 | 3300014745 | Ga0157377_10053574 | Ga0157377_100535742 | 324 |
| 161 | 3300027866 | Ga0209813_10012369 | Ga0209813_100123692 | 324 |
| 162 | 3300031251 | Ga0265327_10000025 | Ga0265327_1000002564 | 324 |
| 163 | 3300049744 | Ga0501083_0042106 | Ga0501083_0042106_1361_2506 | 324 |
| 164 | 3300050491 | nmdc:mga00v17_12456_c2 | nmdc:mga00v17_12456_c2_399_1559 | 324 |
| 165 | 3300050493 | nmdc:mga0k408_181_c1 | nmdc:mga0k408_181_c1_14581_15741 | 324 |
| 166 | 3300050494 | nmdc:mga06z11_144_c1 | nmdc:mga06z11_144_c1_25155_26315 | 324 |
| 167 | 3300050495 | nmdc:mga04h51_10661_c1 | nmdc:mga04h51_10661_c1_451_1611 | 324 |
| 168 | 3300050511 | nmdc:mga08y16_6406_c1 | nmdc:mga08y16_6406_c1_1621_2784 | 324 |
| 169 | 3300053087 | Ga0500643_000009 | Ga0500643_000009_203888_205069 | 325 |
| 170 | 3300005578 | Ga0068854_100035485 | Ga0068854_1000354852 | 326 |
| 171 | 3300005616 | Ga0068852_100005458 | Ga0068852_1000054589 | 326 |
| 172 | 3300009174 | Ga0105241_10024490 | Ga0105241_100244905 | 326 |
| 173 | 3300013105 | Ga0157369_10159571 | Ga0157369_101595711 | 326 |
| 174 | 3300020070 | Ga0206356_10657575 | Ga0206356_106575752 | 326 |
| 175 | 3300025911 | Ga0207654_10067861 | Ga0207654_100678611 | 326 |
| 176 | 3300026142 | Ga0207698_10014281 | Ga0207698_100142812 | 326 |
| 177 | 3300005842 | Ga0068858_100010008 | Ga0068858_1000100087 | 328 |
| 178 | 3300026035 | Ga0207703_10029719 | Ga0207703_100297195 | 328 |
| 179 | 3300037418 | Ga0395900_0024306 | Ga0395900_0024306_900_2027 | 328 |
| 180 | 3300005327 | Ga0070658_10000228 | Ga0070658_1000022811 | 329 |
| 181 | 3300005563 | Ga0068855_100005245 | Ga0068855_10000524512 | 329 |
| 182 | 3300005563 | Ga0068855_100015134 | Ga0068855_1000151346 | 329 |
| 183 | 3300009551 | Ga0105238_10000151 | Ga0105238_1000015119 | 329 |
| 184 | 3300010375 | Ga0105239_10002455 | Ga0105239_100024552 | 329 |
| 185 | 3300013296 | Ga0157374_10033473 | Ga0157374_100334734 | 329 |
| 186 | 3300025909 | Ga0207705_10002131 | Ga0207705_100021316 | 329 |
| 187 | 3300025911 | Ga0207654_10102374 | Ga0207654_101023742 | 329 |
| 188 | 3300025924 | Ga0207694_10001155 | Ga0207694_1000115513 | 329 |
| 189 | 3300025949 | Ga0207667_10034628 | Ga0207667_100346283 | 329 |
| 190 | 3300006028 | Ga0070717_10202487 | Ga0070717_102024872 | 330 |
| 191 | 3300028800 | Ga0265338_10004463 | Ga0265338_1000446317 | 330 |
| 192 | 3300037418 | Ga0395900_0013775 | Ga0395900_0013775_4608_5735 | 330 |
| 193 | 3300037466 | Ga0395898_0004623 | Ga0395898_0004623_10510_11637 | 330 |
| 194 | 3300037471 | Ga0395905_0061933 | Ga0395905_0061933_589_1716 | 330 |
| 195 | 3300038443 | Ga0395901_0277491 | Ga0395901_0277491_278_1405 | 330 |
| 196 | 3300025913 | Ga0207695_10206607 | Ga0207695_102066071 | 332 |
| 197 | 3300005614 | Ga0068856_100012876 | Ga0068856_1000128764 | 334 |
| 198 | 3300026078 | Ga0207702_10038776 | Ga0207702_100387762 | 334 |
| 199 | 3300001990 | JGI24737J22298_10000068 | JGI24737J22298_1000006811 | 335 |
| 200 | 3300002067 | JGI24735J21928_10000055 | JGI24735J21928_100000558 | 335 |
| 201 | 3300005337 | Ga0070682_100202611 | Ga0070682_1002026111 | 335 |
| 202 | 3300005339 | Ga0070660_100046449 | Ga0070660_1000464492 | 335 |
| 203 | 3300005344 | Ga0070661_100082495 | Ga0070661_1000824952 | 335 |
| 204 | 3300005366 | Ga0070659_100082638 | Ga0070659_1000826382 | 335 |
| 205 | 3300005577 | Ga0068857_100022116 | Ga0068857_1000221164 | 335 |
| 206 | 3300005578 | Ga0068854_100177702 | Ga0068854_1001777022 | 335 |
| 207 | 3300013105 | Ga0157369_10018169 | Ga0157369_100181693 | 335 |
| 208 | 3300013307 | Ga0157372_10012683 | Ga0157372_100126836 | 335 |
| 209 | 3300025912 | Ga0207707_10013359 | Ga0207707_100133595 | 335 |
| 210 | 3300025919 | Ga0207657_10023455 | Ga0207657_100234556 | 335 |
| 211 | 3300025921 | Ga0207652_10249630 | Ga0207652_102496302 | 335 |
| 212 | 3300025932 | Ga0207690_10204590 | Ga0207690_102045902 | 335 |
| 213 | 3300025949 | Ga0207667_10023342 | Ga0207667_100233422 | 335 |
| 214 | 3300026116 | Ga0207674_10016071 | Ga0207674_100160716 | 335 |
| 215 | 3300026142 | Ga0207698_10010288 | Ga0207698_100102882 | 335 |
| 216 | 3300053137 | Ga0500561_0000002 | Ga0500561_0000002_284892_286070 | 335 |
| 217 | 3300009177 | Ga0105248_10188865 | Ga0105248_101888652 | 336 |
| 218 | 3300028800 | Ga0265338_10025470 | Ga0265338_100254705 | 336 |
| 219 | 3300005530 | Ga0070679_100000332 | Ga0070679_10000033219 | 337 |
| 220 | 3300025921 | Ga0207652_10003400 | Ga0207652_100034006 | 337 |
| 221 | 3300053153 | Ga0500616_0000005 | Ga0500616_0000005_836276_837418 | 337 |
| 222 | 3300037471 | Ga0395905_0002998 | Ga0395905_0002998_16717_17847 | 338 |
| 223 | 3300004803 | Ga0058862_10121158 | Ga0058862_101211583 | 339 |
| 224 | 3300005841 | Ga0068863_100104064 | Ga0068863_1001040642 | 339 |
| 225 | 3300013296 | Ga0157374_10002318 | Ga0157374_100023182 | 339 |
| 226 | 3300025931 | Ga0207644_10036256 | Ga0207644_100362562 | 339 |
| 227 | 3300026088 | Ga0207641_10091066 | Ga0207641_100910662 | 339 |
| 228 | 3300026088 | Ga0207641_10110193 | Ga0207641_101101932 | 339 |
| 229 | 3300059505 | Ga0587083_0009177 | Ga0587083_0009177_34_1155 | 339 |
| 230 | 3300046694 | Ga0495649_0000025 | Ga0495649_0000025_139913_141052 | 340 |
| 231 | 3300028556 | Ga0265337_1000048 | Ga0265337_100004822 | 341 |
| 232 | 3300028800 | Ga0265338_10001060 | Ga0265338_1000106024 | 341 |
| 233 | 3300049573 | Ga0501037_0183439 | Ga0501037_0183439_165_1292 | 342 |
| 234 | 3300049586 | Ga0501070_0014554 | Ga0501070_0014554_1875_3002 | 342 |
| 235 | 3300009093 | Ga0105240_10235987 | Ga0105240_102359873 | 343 |
| 236 | 3300006038 | Ga0075365_10105726 | Ga0075365_101057262 | 344 |
| 237 | 3300009148 | Ga0105243_10181526 | Ga0105243_101815262 | 344 |
| 238 | 3300013307 | Ga0157372_10015808 | Ga0157372_100158087 | 344 |
| 239 | 3300013307 | Ga0157372_10173195 | Ga0157372_101731952 | 344 |
| 240 | 3300025935 | Ga0207709_10108585 | Ga0207709_101085852 | 344 |
| 241 | 3300050491 | nmdc:mga00v17_69000_c1 | nmdc:mga00v17_69000_c1_261_1382 | 344 |
| 242 | 3300050492 | nmdc:mga0yw44_74714_c1 | nmdc:mga0yw44_74714_c1_236_1357 | 344 |
| 243 | 3300053139 | Ga0500568_0015748 | Ga0500568_0015748_969_2090 | 344 |
| 244 | 3300005365 | Ga0070688_100068278 | Ga0070688_1000682782 | 345 |
| 245 | 3300005466 | Ga0070685_10001076 | Ga0070685_100010765 | 345 |
| 246 | 3300005563 | Ga0068855_100015189 | Ga0068855_1000151892 | 345 |
| 247 | 3300005614 | Ga0068856_100000002 | Ga0068856_100000002289 | 345 |
| 248 | 3300014325 | Ga0163163_10019410 | Ga0163163_100194106 | 345 |
| 249 | 3300025924 | Ga0207694_10182152 | Ga0207694_101821522 | 345 |
| 250 | 3300025949 | Ga0207667_10004707 | Ga0207667_1000470719 | 345 |
| 251 | 3300026078 | Ga0207702_10000001 | Ga0207702_10000001143 | 345 |
| 252 | 3300028379 | Ga0268266_10002107 | Ga0268266_1000210716 | 345 |
| 253 | 3300053093 | Ga0500651_0000011 | Ga0500651_0000011_229988_231112 | 345 |
| 254 | 3300053123 | Ga0500614_001870 | Ga0500614_001870_3237_4361 | 345 |
| 255 | 3300005327 | Ga0070658_10010498 | Ga0070658_100104983 | 346 |
| 256 | 3300005327 | Ga0070658_10061391 | Ga0070658_100613912 | 346 |
| 257 | 3300005336 | Ga0070680_100000241 | Ga0070680_10000024132 | 346 |
| 258 | 3300005339 | Ga0070660_100000169 | Ga0070660_10000016928 | 346 |
| 259 | 3300005339 | Ga0070660_100000226 | Ga0070660_1000002265 | 346 |
| 260 | 3300005341 | Ga0070691_10012204 | Ga0070691_100122043 | 346 |
| 261 | 3300005366 | Ga0070659_100000131 | Ga0070659_10000013120 | 346 |
| 262 | 3300005458 | Ga0070681_10156801 | Ga0070681_101568012 | 346 |
| 263 | 3300005530 | Ga0070679_100000499 | Ga0070679_1000004998 | 346 |
| 264 | 3300005530 | Ga0070679_100051299 | Ga0070679_1000512992 | 346 |
| 265 | 3300005563 | Ga0068855_100000324 | Ga0068855_10000032429 | 346 |
| 266 | 3300005577 | Ga0068857_100000001 | Ga0068857_10000000193 | 346 |
| 267 | 3300009551 | Ga0105238_10125772 | Ga0105238_101257722 | 346 |
| 268 | 3300013307 | Ga0157372_10000774 | Ga0157372_100007748 | 346 |
| 269 | 3300025909 | Ga0207705_10083937 | Ga0207705_100839372 | 346 |
| 270 | 3300025912 | Ga0207707_10010266 | Ga0207707_100102668 | 346 |
| 271 | 3300025917 | Ga0207660_10000180 | Ga0207660_1000018014 | 346 |
| 272 | 3300025919 | Ga0207657_10000502 | Ga0207657_1000050215 | 346 |
| 273 | 3300025921 | Ga0207652_10037375 | Ga0207652_100373752 | 346 |
| 274 | 3300025924 | Ga0207694_10181483 | Ga0207694_101814832 | 346 |
| 275 | 3300025932 | Ga0207690_10001822 | Ga0207690_1000182210 | 346 |
| 276 | 3300025949 | Ga0207667_10000577 | Ga0207667_1000057722 | 346 |
| 277 | 3300026116 | Ga0207674_10000021 | Ga0207674_1000002190 | 346 |
| 278 | 3300026116 | Ga0207674_10125112 | Ga0207674_101251122 | 346 |
| 279 | 3300026116 | Ga0207674_10367570 | Ga0207674_103675702 | 346 |
| 280 | 3300028556 | Ga0265337_1003484 | Ga0265337_10034845 | 346 |
| 281 | 3300028558 | Ga0265326_10000917 | Ga0265326_100009178 | 346 |
| 282 | 3300028563 | Ga0265319_1044591 | Ga0265319_10445911 | 346 |
| 283 | 3300028573 | Ga0265334_10000004 | Ga0265334_100000043 | 346 |
| 284 | 3300028800 | Ga0265338_10000003 | Ga0265338_10000003825 | 346 |
| 285 | 3300028800 | Ga0265338_10001799 | Ga0265338_1000179911 | 346 |
| 286 | 3300053093 | Ga0500651_0022760 | Ga0500651_0022760_277_1404 | 346 |
| 287 | 3300009176 | Ga0105242_10001258 | Ga0105242_1000125816 | 347 |
| 288 | 3300009551 | Ga0105238_10081063 | Ga0105238_100810633 | 347 |
| 289 | 3300025913 | Ga0207695_10056979 | Ga0207695_100569793 | 347 |
| 290 | 3300025934 | Ga0207686_10002162 | Ga0207686_100021626 | 347 |
| 291 | 3300028800 | Ga0265338_10065073 | Ga0265338_100650732 | 347 |
| 292 | 3300037418 | Ga0395900_0000434 | Ga0395900_0000434_47166_48293 | 347 |
| 293 | 3300037466 | Ga0395898_0016917 | Ga0395898_0016917_2723_3850 | 347 |
| 294 | 3300038443 | Ga0395901_0057984 | Ga0395901_0057984_2093_3220 | 347 |
| 295 | 3300049589 | Ga0501073_0058441 | Ga0501073_0058441_649_1797 | 347 |
| 296 | 3300049742 | Ga0501080_0000007 | Ga0501080_0000007_61362_62510 | 347 |
| 297 | 3300006051 | Ga0075364_10000161 | Ga0075364_1000016112 | 348 |
| 298 | 3300028558 | Ga0265326_10000208 | Ga0265326_1000020824 | 348 |
| 299 | 3300028573 | Ga0265334_10001327 | Ga0265334_1000132712 | 348 |
| 300 | 3300028654 | Ga0265322_10008048 | Ga0265322_100080483 | 348 |
| 301 | 3300028666 | Ga0265336_10000020 | Ga0265336_10000020234 | 348 |
| 302 | 3300028800 | Ga0265338_10000093 | Ga0265338_1000009322 | 348 |
| 303 | 3300028800 | Ga0265338_10056817 | Ga0265338_100568172 | 348 |
| 304 | 3300029957 | Ga0265324_10002301 | Ga0265324_100023017 | 348 |
| 305 | 3300005530 | Ga0070679_100136461 | Ga0070679_1001364612 | 349 |
| 306 | 3300014325 | Ga0163163_10235020 | Ga0163163_102350202 | 349 |
| 307 | 3300025929 | Ga0207664_10000161 | Ga0207664_1000016167 | 349 |
| 308 | 3300028800 | Ga0265338_10003103 | Ga0265338_1000310321 | 349 |
| 309 | 3300028800 | Ga0265338_10215779 | Ga0265338_102157791 | 349 |
| 310 | 3300005353 | Ga0070669_100134610 | Ga0070669_1001346102 | 350 |
| 311 | 3300005985 | Ga0081539_10051450 | Ga0081539_100514502 | 350 |
| 312 | 3300013296 | Ga0157374_10099058 | Ga0157374_100990582 | 350 |
| 313 | 3300028381 | Ga0268264_10040640 | Ga0268264_100406403 | 350 |
| 314 | 3300028558 | Ga0265326_10022498 | Ga0265326_100224981 | 350 |
| 315 | 3300028573 | Ga0265334_10010386 | Ga0265334_100103861 | 350 |
| 316 | 3300028800 | Ga0265338_10002189 | Ga0265338_1000218928 | 350 |
| 317 | 3300028800 | Ga0265338_10102261 | Ga0265338_101022612 | 350 |
| 318 | 3300029957 | Ga0265324_10008000 | Ga0265324_100080003 | 350 |
| 319 | 3300031249 | Ga0265339_10049672 | Ga0265339_100496722 | 350 |
| 320 | 3300031251 | Ga0265327_10019705 | Ga0265327_100197052 | 350 |
| 321 | 3300031344 | Ga0265316_10022626 | Ga0265316_100226264 | 350 |
| 322 | 3300031711 | Ga0265314_10101193 | Ga0265314_101011932 | 350 |
| 323 | 3300005547 | Ga0070693_100020562 | Ga0070693_1000205621 | 351 |
| 324 | 3300025921 | Ga0207652_10310781 | Ga0207652_103107812 | 351 |
| 325 | 3300025949 | Ga0207667_10010449 | Ga0207667_100104492 | 351 |
| 326 | 3300013105 | Ga0157369_10016734 | Ga0157369_100167345 | 352 |
| 327 | 3300028556 | Ga0265337_1000791 | Ga0265337_100079120 | 352 |
| 328 | 3300028558 | Ga0265326_10002637 | Ga0265326_100026372 | 352 |
| 329 | 3300028558 | Ga0265326_10045778 | Ga0265326_100457781 | 352 |
| 330 | 3300028654 | Ga0265322_10002738 | Ga0265322_100027383 | 352 |
| 331 | 3300028666 | Ga0265336_10023535 | Ga0265336_100235352 | 352 |
| 332 | 3300028800 | Ga0265338_10002656 | Ga0265338_100026562 | 352 |
| 333 | 3300031249 | Ga0265339_10044765 | Ga0265339_100447652 | 352 |
| 334 | 3300031595 | Ga0265313_10037105 | Ga0265313_100371052 | 352 |
| 335 | 3300006038 | Ga0075365_10058932 | Ga0075365_100589322 | 354 |
| 336 | 3300006195 | Ga0075366_10000030 | Ga0075366_100000308 | 354 |
| 337 | 3300050492 | nmdc:mga0yw44_26128_c1 | nmdc:mga0yw44_26128_c1_2099_3259 | 354 |
| 338 | 3300050493 | nmdc:mga0k408_15_c1 | nmdc:mga0k408_15_c1_37240_38400 | 354 |
| 339 | 3300005563 | Ga0068855_100000001 | Ga0068855_100000001783 | 355 |
| 340 | 3300006051 | Ga0075364_10007538 | Ga0075364_100075387 | 355 |
| 341 | 3300009174 | Ga0105241_10000009 | Ga0105241_10000009158 | 355 |
| 342 | 3300013105 | Ga0157369_10000273 | Ga0157369_1000027337 | 355 |
| 343 | 3300025911 | Ga0207654_10000002 | Ga0207654_10000002120 | 355 |
| 344 | 3300025949 | Ga0207667_10000003 | Ga0207667_10000003766 | 355 |
| 345 | 3300048929 | Ga0496126_0262858 | Ga0496126_0262858_220_1377 | 355 |
| 346 | 3300050491 | nmdc:mga00v17_13380_c1 | nmdc:mga00v17_13380_c1_2397_3563 | 355 |
| 347 | 3300050492 | nmdc:mga0yw44_37839_c1 | nmdc:mga0yw44_37839_c1_1184_2350 | 355 |
| 348 | 3300050493 | nmdc:mga0k408_56_c1 | nmdc:mga0k408_56_c1_42025_43191 | 355 |
| 349 | 3300009986 | Ga0105033_100189 | Ga0105033_1001894 | 357 |
| 350 | 3300001915 | JGI24741J21665_1000398 | JGI24741J21665_10003983 | 361 |
| 351 | 3300001979 | JGI24740J21852_10003576 | JGI24740J21852_100035766 | 361 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar