F418559

General Info

Members Datasets Scaffolds Average Seq Length
351 183 351 360

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100000001|Ga0068855_100000001783
Length 409
Sequence MAKEPKDTKKKTAPAADAQPLDLETIKKDLLAKAKKDGAIDQRDITAAIADTPENADILDALYTDLADAGVQVSSDVNALPGEDLPPIAGDDEWTAEDGEEVITEDQNYLDDIADDSVRLYLREIGKIPLLSAEEEFDLAQRIKRGDAAVKDLAAFQESGSKDKKKLEEIAXDKMAEANMRLVVSIAKRYVGRGLDLLDLIQEGNTGLLRAVEKFDPDKGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLLRTQRRLTQELNREPTNEEIAAAMEIEVDKVEHIMKIKQDISSLDASIRDDEEDSVLSDFIEDEDTISPEDSATNQLLKEQVKGMLGALTEREQKILKLRFGLEDGKQHTLEEVGQEFSVTRERIRQIEAKALAKLRKHKDAKKLHDYIK

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
104 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
151 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
152 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
153 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
154 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
164 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
165 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
166 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
169 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
170 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
171 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
172 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
173 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
176 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
177 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
178 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
179 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
180 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
181 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
182 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.5
Nodule 0
Rhizoplane 0.57
Rhizosphere 74.07
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000398 3300001915 Bacteria 13132
2 JGI24740J21852_10003576 3300001979 Bacteria 6791
3 JGI24737J22298_10000068 3300001990 Bacteria 30563
4 JGI24735J21928_10000055 3300002067 Bacteria 48760
5 JGI24742J22300_10000070 3300002244 Bacteria 14887
6 rootH2_10000311 3300003320 Bacteria 277677
7 Ga0058862_10121158 3300004803 Bacteria 2701
8 Ga0065704_10085049 3300005289 Bacteria 3204
9 Ga0070658_10000097 3300005327 Bacteria 77127
10 Ga0070658_10000228 3300005327 Bacteria 49676
11 Ga0070658_10000484 3300005327 Bacteria 34597
12 Ga0070658_10010498 3300005327 Bacteria 7424
13 Ga0070658_10061391 3300005327 Bacteria 3062
14 Ga0070676_10011578 3300005328 Bacteria 4797
15 Ga0070690_100014032 3300005330 Bacteria 4749
16 Ga0070670_100033162 3300005331 Bacteria 4448
17 Ga0070680_100000241 3300005336 Bacteria 36226
18 Ga0070680_100313075 3300005336 Bacteria 1332
19 Ga0070682_100202611 3300005337 Bacteria 1401
20 Ga0070660_100000158 3300005339 Bacteria 44096
21 Ga0070660_100000169 3300005339 Bacteria 42786
22 Ga0070660_100000226 3300005339 Bacteria 37370
23 Ga0070660_100046449 3300005339 Bacteria 3328
24 Ga0070691_10012204 3300005341 Bacteria 3935
25 Ga0070661_100082495 3300005344 Bacteria 2374
26 Ga0070669_100134610 3300005353 Bacteria 1900
27 Ga0070673_100000196 3300005364 Bacteria 29915
28 Ga0070688_100068278 3300005365 Bacteria 2266
29 Ga0070659_100000131 3300005366 Bacteria 57281
30 Ga0070659_100082638 3300005366 Bacteria 2566
31 Ga0070667_100000001 3300005367 Bacteria 1108638
32 Ga0070681_10156801 3300005458 Bacteria 2201
33 Ga0070685_10001076 3300005466 Bacteria 14635
34 Ga0070685_10003561 3300005466 Bacteria 7904
35 Ga0070679_100000332 3300005530 Bacteria 40130
36 Ga0070679_100000499 3300005530 Bacteria 33449
37 Ga0070679_100031712 3300005530 Bacteria 5224
38 Ga0070679_100051299 3300005530 Bacteria 4109
39 Ga0070679_100136461 3300005530 Bacteria 2434
40 Ga0070672_100009953 3300005543 Bacteria 6576
41 Ga0070693_100020562 3300005547 Bacteria 3483
42 Ga0070665_100083305 3300005548 Bacteria 3203
43 Ga0068855_100000001 3300005563 Bacteria 818777
44 Ga0068855_100000324 3300005563 Bacteria 59520
45 Ga0068855_100005245 3300005563 Bacteria 15810
46 Ga0068855_100011636 3300005563 Bacteria 10632
47 Ga0068855_100015134 3300005563 Bacteria 9289
48 Ga0068855_100015189 3300005563 Bacteria 9273
49 Ga0068857_100000001 3300005577 Bacteria 254081
50 Ga0068857_100022116 3300005577 Bacteria 5593
51 Ga0068857_100250908 3300005577 Bacteria 1622
52 Ga0068854_100035485 3300005578 Bacteria 3490
53 Ga0068854_100177702 3300005578 Bacteria 1661
54 Ga0068856_100000002 3300005614 Bacteria 372816
55 Ga0068856_100012876 3300005614 Bacteria 8096
56 Ga0068852_100005458 3300005616 Bacteria 9096
57 Ga0068863_100104064 3300005841 Bacteria 2700
58 Ga0068858_100010008 3300005842 Bacteria 9008
59 Ga0068860_100012430 3300005843 Bacteria 8385
60 Ga0068862_100160879 3300005844 Bacteria 2004
61 Ga0081455_10000020 3300005937 Bacteria 172997
62 Ga0081539_10051450 3300005985 Bacteria 2321
63 Ga0070717_10202487 3300006028 Bacteria 1739
64 Ga0075365_10058932 3300006038 Bacteria 2557
65 Ga0075365_10105726 3300006038 Bacteria 1931
66 Ga0075365_10156337 3300006038 Bacteria 1587
67 Ga0075368_10000088 3300006042 Bacteria 22805
68 Ga0075368_10024814 3300006042 Bacteria 2298
69 Ga0075363_100000029 3300006048 Bacteria 27762
70 Ga0075364_10000161 3300006051 Bacteria 29761
71 Ga0075364_10007538 3300006051 Bacteria 6469
72 Ga0075364_10124966 3300006051 Bacteria 1724
73 Ga0075367_10000007 3300006178 Bacteria 45077
74 Ga0075367_10000242 3300006178 Bacteria 18517
75 Ga0075369_10000004 3300006186 Bacteria 154675
76 Ga0075369_10000048 3300006186 Bacteria 30990
77 Ga0075369_10013369 3300006186 Bacteria 3258
78 Ga0075366_10000003 3300006195 Bacteria 114017
79 Ga0075366_10000015 3300006195 Bacteria 66498
80 Ga0075366_10000030 3300006195 Bacteria 49629
81 Ga0075366_10000064 3300006195 Bacteria 39771
82 Ga0097621_100000001 3300006237 Bacteria 632268
83 Ga0097621_100000130 3300006237 Bacteria 44188
84 Ga0075370_10000063 3300006353 Bacteria 32195
85 Ga0075370_10035936 3300006353 Bacteria 2782
86 Ga0068871_100000001 3300006358 Bacteria 215987
87 Ga0068871_100000006 3300006358 Bacteria 116822
88 Ga0105240_10235987 3300009093 Bacteria 2122
89 Ga0111539_10010609 3300009094 Bacteria 11600
90 Ga0105245_10000001 3300009098 Bacteria 939270
91 Ga0105245_10409303 3300009098 Bacteria 1357
92 Ga0105243_10181526 3300009148 Bacteria 1831
93 Ga0105241_10000009 3300009174 Bacteria 258876
94 Ga0105241_10001004 3300009174 Bacteria 21417
95 Ga0105241_10024490 3300009174 Bacteria 4482
96 Ga0105242_10001258 3300009176 Bacteria 19993
97 Ga0105248_10188865 3300009177 Bacteria 2321
98 Ga0105238_10000151 3300009551 Bacteria 76390
99 Ga0105238_10081063 3300009551 Bacteria 3234
100 Ga0105238_10125772 3300009551 Bacteria 2542
101 Ga0105249_10000744 3300009553 Bacteria 29317
102 Ga0105249_10029942 3300009553 Bacteria 4917
103 Ga0105033_100189 3300009986 Bacteria 4740
104 Ga0105239_10002455 3300010375 Bacteria 23626
105 Ga0105239_10009666 3300010375 Bacteria 10845
106 Ga0105239_10173060 3300010375 Bacteria 2415
107 Ga0157371_10002482 3300013102 Bacteria 17534
108 Ga0157369_10000273 3300013105 Bacteria 69535
109 Ga0157369_10016734 3300013105 Bacteria 8242
110 Ga0157369_10018169 3300013105 Bacteria 7887
111 Ga0157369_10159571 3300013105 Bacteria 2380
112 Ga0157374_10000014 3300013296 Bacteria 396846
113 Ga0157374_10002318 3300013296 Bacteria 16050
114 Ga0157374_10003583 3300013296 Bacteria 13073
115 Ga0157374_10033473 3300013296 Bacteria 4689
116 Ga0157374_10099058 3300013296 Bacteria 2791
117 Ga0157378_10203670 3300013297 Bacteria 1873
118 Ga0157372_10000774 3300013307 Bacteria 34598
119 Ga0157372_10012683 3300013307 Bacteria 8979
120 Ga0157372_10015808 3300013307 Bacteria 8097
121 Ga0157372_10173195 3300013307 Bacteria 2497
122 Ga0163163_10008260 3300014325 Bacteria 9241
123 Ga0163163_10019410 3300014325 Bacteria 6386
124 Ga0163163_10235020 3300014325 Bacteria 1882
125 Ga0157377_10053574 3300014745 Bacteria 2281
126 Ga0157376_10000001 3300014969 Bacteria 842910
127 Ga0206356_10657575 3300020070 Bacteria 1853
128 Ga0207645_10014628 3300025907 Bacteria 5243
129 Ga0207705_10000019 3300025909 Bacteria 317770
130 Ga0207705_10000057 3300025909 Bacteria 157369
131 Ga0207705_10000231 3300025909 Bacteria 55679
132 Ga0207705_10002131 3300025909 Bacteria 15361
133 Ga0207705_10083937 3300025909 Bacteria 2325
134 Ga0207654_10000002 3300025911 Bacteria 1460142
135 Ga0207654_10055160 3300025911 Bacteria 2299
136 Ga0207654_10067861 3300025911 Bacteria 2108
137 Ga0207654_10102374 3300025911 Bacteria 1767
138 Ga0207707_10010266 3300025912 Bacteria 8126
139 Ga0207707_10013359 3300025912 Bacteria 7158
140 Ga0207695_10056979 3300025913 Bacteria 4063
141 Ga0207695_10206607 3300025913 Bacteria 1876
142 Ga0207660_10000180 3300025917 Bacteria 40305
143 Ga0207657_10000502 3300025919 Bacteria 41290
144 Ga0207657_10003173 3300025919 Bacteria 17584
145 Ga0207657_10023455 3300025919 Bacteria 5745
146 Ga0207652_10003400 3300025921 Bacteria 13140
147 Ga0207652_10037375 3300025921 Bacteria 4110
148 Ga0207652_10249630 3300025921 Bacteria 1600
149 Ga0207652_10310781 3300025921 Bacteria 1423
150 Ga0207694_10001155 3300025924 Bacteria 22934
151 Ga0207694_10181483 3300025924 Bacteria 1707
152 Ga0207694_10182152 3300025924 Bacteria 1704
153 Ga0207650_10006693 3300025925 Bacteria 7858
154 Ga0207687_10000001 3300025927 Bacteria 1130810
155 Ga0207687_10000004 3300025927 Bacteria 841177
156 Ga0207687_10000008 3300025927 Bacteria 497738
157 Ga0207687_10023727 3300025927 Bacteria 4091
158 Ga0207664_10000161 3300025929 Bacteria 53847
159 Ga0207644_10036256 3300025931 Bacteria 3461
160 Ga0207690_10001822 3300025932 Bacteria 13077
161 Ga0207690_10204590 3300025932 Bacteria 1501
162 Ga0207686_10002162 3300025934 Bacteria 10824
163 Ga0207709_10108585 3300025935 Bacteria 1850
164 Ga0207691_10048127 3300025940 Bacteria 3910
165 Ga0207667_10000003 3300025949 Bacteria 822935
166 Ga0207667_10000577 3300025949 Bacteria 47784
167 Ga0207667_10004707 3300025949 Bacteria 16698
168 Ga0207667_10010449 3300025949 Bacteria 10850
169 Ga0207667_10023342 3300025949 Bacteria 6812
170 Ga0207667_10023585 3300025949 Bacteria 6774
171 Ga0207667_10034628 3300025949 Bacteria 5421
172 Ga0207651_10001595 3300025960 Bacteria 10386
173 Ga0207712_10072962 3300025961 Bacteria 2474
174 Ga0207712_10258704 3300025961 Bacteria 1410
175 Ga0207658_10000003 3300025986 Bacteria 1151934
176 Ga0207703_10029719 3300026035 Bacteria 4314
177 Ga0207702_10000001 3300026078 Bacteria 895738
178 Ga0207702_10038776 3300026078 Bacteria 3990
179 Ga0207641_10091066 3300026088 Bacteria 2668
180 Ga0207641_10110193 3300026088 Bacteria 2439
181 Ga0207674_10000021 3300026116 Bacteria 161986
182 Ga0207674_10016071 3300026116 Bacteria 8199
183 Ga0207674_10125112 3300026116 Bacteria 2537
184 Ga0207674_10367570 3300026116 Bacteria 1390
185 Ga0207698_10010288 3300026142 Bacteria 6000
186 Ga0207698_10014281 3300026142 Bacteria 5274
187 Ga0210002_1004533 3300027617 Bacteria 2072
188 Ga0209813_10000003 3300027866 Bacteria 207060
189 Ga0209813_10012369 3300027866 Bacteria 2254
190 Ga0209974_10004134 3300027876 Bacteria 5187
191 Ga0268266_10002107 3300028379 Bacteria 21977
192 Ga0268266_10062784 3300028379 Bacteria 3207
193 Ga0268265_10234813 3300028380 Bacteria 1614
194 Ga0268264_10002081 3300028381 Bacteria 17870
195 Ga0268264_10040640 3300028381 Bacteria 3843
196 Ga0265337_1000048 3300028556 Bacteria 53749
197 Ga0265337_1000791 3300028556 Bacteria 16642
198 Ga0265337_1003484 3300028556 Bacteria 6799
199 Ga0265326_10000208 3300028558 Bacteria 29214
200 Ga0265326_10000917 3300028558 Bacteria 10679
201 Ga0265326_10002637 3300028558 Bacteria 6007
202 Ga0265326_10022498 3300028558 Bacteria 1805
203 Ga0265326_10045778 3300028558 Bacteria 1240
204 Ga0265319_1044591 3300028563 Bacteria 1486
205 Ga0265334_10000004 3300028573 Bacteria 243436
206 Ga0265334_10000041 3300028573 Bacteria 98258
207 Ga0265334_10001327 3300028573 Bacteria 11930
208 Ga0265334_10010386 3300028573 Bacteria 3934
209 Ga0265322_10002738 3300028654 Bacteria 5404
210 Ga0265322_10008048 3300028654 Bacteria 3074
211 Ga0265336_10000020 3300028666 Bacteria 213480
212 Ga0265336_10023535 3300028666 Bacteria 1952
213 Ga0265338_10000003 3300028800 Bacteria 733923
214 Ga0265338_10000093 3300028800 Bacteria 168444
215 Ga0265338_10001060 3300028800 Bacteria 45733
216 Ga0265338_10001799 3300028800 Bacteria 33714
217 Ga0265338_10002189 3300028800 Bacteria 29934
218 Ga0265338_10002656 3300028800 Bacteria 26294
219 Ga0265338_10003103 3300028800 Bacteria 23792
220 Ga0265338_10003205 3300028800 Bacteria 23342
221 Ga0265338_10004463 3300028800 Bacteria 18876
222 Ga0265338_10025470 3300028800 Bacteria 6000
223 Ga0265338_10056817 3300028800 Bacteria 3466
224 Ga0265338_10065073 3300028800 Bacteria 3166
225 Ga0265338_10102261 3300028800 Bacteria 2330
226 Ga0265338_10215779 3300028800 Bacteria 1437
227 Ga0265324_10002301 3300029957 Bacteria 9933
228 Ga0265324_10008000 3300029957 Bacteria 4236
229 Ga0265340_10001423 3300031247 Bacteria 13734
230 Ga0265339_10044765 3300031249 Bacteria 2439
231 Ga0265339_10049672 3300031249 Bacteria 2296
232 Ga0265327_10000025 3300031251 Bacteria 380054
233 Ga0265327_10001879 3300031251 Bacteria 24298
234 Ga0265327_10019705 3300031251 Bacteria 4136
235 Ga0265316_10022626 3300031344 Bacteria 5293
236 Ga0265313_10037105 3300031595 Bacteria 2440
237 Ga0265314_10101193 3300031711 Bacteria 1852
238 Ga0307516_10124102 3300031730 Bacteria 2369
239 Ga0395900_0000434 3300037418 Bacteria 60035
240 Ga0395900_0013775 3300037418 Bacteria 8254
241 Ga0395900_0024306 3300037418 Bacteria 6204
242 Ga0395898_0004623 3300037466 Bacteria 15027
243 Ga0395898_0016917 3300037466 Bacteria 7445
244 Ga0395905_0002998 3300037471 Bacteria 18308
245 Ga0395905_0061933 3300037471 Bacteria 3500
246 Ga0395905_0148677 3300037471 Bacteria 2204
247 Ga0395901_0004862 3300038443 Bacteria 13561
248 Ga0395901_0012573 3300038443 Bacteria 8590
249 Ga0395901_0057984 3300038443 Bacteria 4028
250 Ga0395901_0277491 3300038443 Bacteria 1742
251 Ga0451807_2078009 3300041486 Bacteria 2262
252 Ga0495629_0008743 3300046459 Bacteria 7446
253 Ga0495622_0000008 3300046557 Bacteria 232461
254 Ga0495588_0000322 3300046674 Bacteria 31828
255 Ga0495658_0002196 3300046683 Bacteria 9875
256 Ga0495649_0000025 3300046694 Bacteria 175449
257 Ga0495672_0000323 3300047320 Bacteria 63547
258 Ga0495602_0068077 3300048088 Bacteria 3060
259 Ga0496100_0011756 3300048903 Bacteria 4993
260 Ga0496126_0262858 3300048929 Bacteria 1434
261 Ga0501031_0000789 3300049568 Bacteria 19049
262 Ga0501032_0001140 3300049569 Bacteria 21269
263 Ga0501034_0008367 3300049571 Bacteria 10937
264 Ga0501034_0056811 3300049571 Bacteria 3936
265 Ga0501036_0001992 3300049572 Bacteria 15858
266 Ga0501037_0000146 3300049573 Bacteria 65527
267 Ga0501037_0092212 3300049573 Bacteria 2191
268 Ga0501037_0183439 3300049573 Bacteria 1484
269 Ga0501038_0005119 3300049574 Bacteria 12181
270 Ga0501043_0002239 3300049579 Bacteria 16470
271 Ga0501046_0000061 3300049580 Bacteria 120487
272 Ga0501047_0000024 3300049581 Bacteria 230397
273 Ga0501047_0000637 3300049581 Bacteria 36844
274 Ga0501048_0000002 3300049582 Bacteria 108048
275 Ga0501048_0054868 3300049582 Bacteria 2831
276 Ga0501070_0014554 3300049586 Bacteria 6620
277 Ga0501070_0017559 3300049586 Bacteria 6006
278 Ga0501073_0058441 3300049589 Bacteria 2695
279 Ga0501080_0000007 3300049742 Bacteria 135749
280 Ga0501083_0042106 3300049744 Bacteria 3097
281 Ga0501083_0136157 3300049744 Bacteria 1609
282 Ga0501035_0000005 3300049822 Bacteria 392980
283 Ga0501035_0004999 3300049822 Bacteria 12560
284 Ga0501044_0003400 3300049823 Bacteria 17928
285 nmdc:mga03n38_23556_c1 3300050490 Bacteria 2506
286 nmdc:mga03n38_53_c1 3300050490 Bacteria 18217
287 nmdc:mga00v17_12456_c2 3300050491 Bacteria 2336
288 nmdc:mga00v17_13380_c1 3300050491 Bacteria 4554
289 nmdc:mga00v17_171242_c1 3300050491 Bacteria 1400
290 nmdc:mga00v17_50469_c1 3300050491 Bacteria 2528
291 nmdc:mga00v17_69000_c1 3300050491 Bacteria 2186
292 nmdc:mga0yw44_137228_c1 3300050492 Bacteria 1587
293 nmdc:mga0yw44_26128_c1 3300050492 Bacteria 3331
294 nmdc:mga0yw44_37839_c1 3300050492 Bacteria 2395
295 nmdc:mga0yw44_74714_c1 3300050492 Bacteria 2112
296 nmdc:mga0yw44_7_c1 3300050492 Bacteria 260877
297 nmdc:mga0k408_15_c1 3300050493 Bacteria 124193
298 nmdc:mga0k408_181_c1 3300050493 Bacteria 33119
299 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
300 nmdc:mga0k408_56_c1 3300050493 Bacteria 57024
301 nmdc:mga0k408_59_c1 3300050493 Bacteria 39640
302 nmdc:mga06z11_144_c1 3300050494 Bacteria 28448
303 nmdc:mga06z11_2_c1 3300050494 Bacteria 169056
304 nmdc:mga04h51_10661_c1 3300050495 Bacteria 2529
305 nmdc:mga04h51_3_c1 3300050495 Bacteria 207078
306 nmdc:mga07m45_19726_c1 3300050496 Bacteria 3654
307 nmdc:mga07m45_885_c1 3300050496 Bacteria 13073
308 nmdc:mga08y16_6406_c1 3300050511 Bacteria 12340
309 nmdc:mga0sz30_10_c3 3300050516 Bacteria 40799
310 nmdc:mga0sz30_11774_c1 3300050516 Bacteria 2624
311 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
312 Ga0500610_0000011 3300053079 Bacteria 91172
313 Ga0500610_0004071 3300053079 Bacteria 5733
314 Ga0500643_000009 3300053087 Bacteria 444150
315 Ga0500644_0000436 3300053088 Bacteria 19303
316 Ga0500644_0000704 3300053088 Bacteria 11847
317 Ga0500644_0027551 3300053088 Bacteria 1769
318 Ga0500646_0000253 3300053090 Bacteria 16386
319 Ga0500583_0000085 3300053092 Bacteria 52578
320 Ga0500583_0001791 3300053092 Bacteria 6289
321 Ga0500583_0002012 3300053092 Bacteria 5989
322 Ga0500651_0000011 3300053093 Bacteria 246573
323 Ga0500651_0022760 3300053093 Bacteria 3917
324 Ga0500651_0086810 3300053093 Bacteria 1932
325 Ga0500566_0000001 3300053094 Bacteria 1101031
326 Ga0500650_0000040 3300053098 Bacteria 48637
327 Ga0500555_000001 3300053103 Bacteria 1353713
328 Ga0500555_000002 3300053103 Bacteria 1314346
329 Ga0500556_0000419 3300053104 Bacteria 30563
330 Ga0500562_000001 3300053108 Bacteria 1178987
331 Ga0500562_000002 3300053108 Bacteria 977234
332 Ga0500594_0000001 3300053118 Bacteria 1178472
333 Ga0500614_000001 3300053123 Bacteria 1274484
334 Ga0500614_001870 3300053123 Bacteria 4865
335 Ga0500614_005800 3300053123 Bacteria 2594
336 Ga0500642_0002412 3300053130 Bacteria 5483
337 Ga0500652_000012 3300053131 Bacteria 155076
338 Ga0500655_000798 3300053133 Bacteria 6192
339 Ga0500655_004856 3300053133 Bacteria 2416
340 Ga0500561_0000002 3300053137 Bacteria 394147
341 Ga0500568_0015748 3300053139 Bacteria 3378
342 Ga0500577_0001073 3300053142 Bacteria 7051
343 Ga0500577_0001601 3300053142 Bacteria 5799
344 Ga0500589_000003 3300053147 Bacteria 220717
345 Ga0500616_0000005 3300053153 Bacteria 961725
346 Ga0500633_0007245 3300053160 Bacteria 2781
347 Ga0500649_000006 3300053722 Bacteria 116211
348 Ga0500570_000001 3300053724 Bacteria 243552
349 Ga0500611_000391 3300053727 Bacteria 4460
350 Ga0587083_0009177 3300059505 Bacteria 1570
351 Ga0501082_0016454 3300060353 Bacteria 6366

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0000323 Ga0495672_0000323_16167_17384 288
2 3300005327 Ga0070658_10000097 Ga0070658_1000009746 298
3 3300025909 Ga0207705_10000057 Ga0207705_1000005732 298
4 3300009098 Ga0105245_10000001 Ga0105245_10000001878 299
5 3300025927 Ga0207687_10000001 Ga0207687_10000001439 299
6 3300025927 Ga0207687_10000004 Ga0207687_10000004393 299
7 3300006042 Ga0075368_10000088 Ga0075368_1000008822 301
8 3300006048 Ga0075363_100000029 Ga0075363_10000002933 301
9 3300006178 Ga0075367_10000242 Ga0075367_1000024222 301
10 3300006353 Ga0075370_10000063 Ga0075370_1000006319 301
11 3300027866 Ga0209813_10000003 Ga0209813_10000003167 301
12 3300028573 Ga0265334_10000041 Ga0265334_1000004170 301
13 3300028800 Ga0265338_10003205 Ga0265338_1000320512 301
14 3300031247 Ga0265340_10001423 Ga0265340_100014233 301
15 3300037471 Ga0395905_0148677 Ga0395905_0148677_141_1262 301
16 3300050490 nmdc:mga03n38_23556_c1 nmdc:mga03n38_23556_c1_709_1851 301
17 3300050490 nmdc:mga03n38_53_c1 nmdc:mga03n38_53_c1_9820_10980 301
18 3300050494 nmdc:mga06z11_2_c1 nmdc:mga06z11_2_c1_16124_17284 301
19 3300050495 nmdc:mga04h51_3_c1 nmdc:mga04h51_3_c1_54144_55304 301
20 3300050496 nmdc:mga07m45_885_c1 nmdc:mga07m45_885_c1_8758_9918 301
21 3300009174 Ga0105241_10001004 Ga0105241_1000100415 302
22 3300025911 Ga0207654_10055160 Ga0207654_100551603 302
23 3300005844 Ga0068862_100160879 Ga0068862_1001608792 305
24 3300013296 Ga0157374_10003583 Ga0157374_1000358312 305
25 3300025961 Ga0207712_10258704 Ga0207712_102587042 305
26 3300028380 Ga0268265_10234813 Ga0268265_102348131 305
27 3300005331 Ga0070670_100033162 Ga0070670_1000331622 306
28 3300005367 Ga0070667_100000001 Ga0070667_100000001105 306
29 3300005843 Ga0068860_100012430 Ga0068860_10001243010 306
30 3300025925 Ga0207650_10006693 Ga0207650_100066936 306
31 3300025986 Ga0207658_10000003 Ga0207658_1000000357 306
32 3300028381 Ga0268264_10002081 Ga0268264_1000208119 306
33 3300053092 Ga0500583_0001791 Ga0500583_0001791_1982_3229 306
34 3300049568 Ga0501031_0000789 Ga0501031_0000789_5538_6698 307
35 3300049569 Ga0501032_0001140 Ga0501032_0001140_12319_13479 307
36 3300049571 Ga0501034_0056811 Ga0501034_0056811_2058_3218 307
37 3300049572 Ga0501036_0001992 Ga0501036_0001992_3454_4614 307
38 3300049573 Ga0501037_0000146 Ga0501037_0000146_11113_12273 307
39 3300049574 Ga0501038_0005119 Ga0501038_0005119_492_1652 307
40 3300049579 Ga0501043_0002239 Ga0501043_0002239_4496_5656 307
41 3300049580 Ga0501046_0000061 Ga0501046_0000061_11173_12333 307
42 3300049581 Ga0501047_0000637 Ga0501047_0000637_22840_24000 307
43 3300049582 Ga0501048_0000002 Ga0501048_0000002_62339_63499 307
44 3300049586 Ga0501070_0017559 Ga0501070_0017559_225_1385 307
45 3300049822 Ga0501035_0004999 Ga0501035_0004999_10517_11677 307
46 3300049823 Ga0501044_0003400 Ga0501044_0003400_9121_10281 307
47 3300060353 Ga0501082_0016454 Ga0501082_0016454_3830_4990 307
48 3300041486 Ga0451807_2078009 Ga0451807_2078009_800_1975 309
49 3300053104 Ga0500556_0000419 Ga0500556_0000419_10110_11249 309
50 3300005530 Ga0070679_100031712 Ga0070679_1000317123 310
51 3300009553 Ga0105249_10029942 Ga0105249_100299424 311
52 3300005577 Ga0068857_100250908 Ga0068857_1002509081 312
53 3300006237 Ga0097621_100000130 Ga0097621_10000013013 312
54 3300006358 Ga0068871_100000006 Ga0068871_10000000654 312
55 3300010375 Ga0105239_10173060 Ga0105239_101730602 313
56 3300053108 Ga0500562_000002 Ga0500562_000002_348835_350001 313
57 3300005330 Ga0070690_100014032 Ga0070690_1000140322 314
58 3300005336 Ga0070680_100313075 Ga0070680_1003130751 314
59 3300003320 rootH2_10000311 rootH2_10000311235 316
60 3300005339 Ga0070660_100000158 Ga0070660_1000001587 316
61 3300006038 Ga0075365_10156337 Ga0075365_101563372 316
62 3300006051 Ga0075364_10124966 Ga0075364_101249662 316
63 3300006186 Ga0075369_10013369 Ga0075369_100133694 316
64 3300006353 Ga0075370_10035936 Ga0075370_100359362 316
65 3300025919 Ga0207657_10003173 Ga0207657_100031737 316
66 3300050491 nmdc:mga00v17_171242_c1 nmdc:mga00v17_171242_c1_203_1375 316
67 3300050491 nmdc:mga00v17_50469_c1 nmdc:mga00v17_50469_c1_72_1205 316
68 3300050492 nmdc:mga0yw44_137228_c1 nmdc:mga0yw44_137228_c1_159_1331 316
69 3300050492 nmdc:mga0yw44_7_c1 nmdc:mga0yw44_7_c1_161748_162890 316
70 3300050496 nmdc:mga07m45_19726_c1 nmdc:mga07m45_19726_c1_311_1453 316
71 3300050516 nmdc:mga0sz30_11774_c1 nmdc:mga0sz30_11774_c1_225_1358 316
72 3300002244 JGI24742J22300_10000070 JGI24742J22300_100000708 317
73 3300005327 Ga0070658_10000484 Ga0070658_1000048422 317
74 3300025909 Ga0207705_10000019 Ga0207705_10000019237 317
75 3300038443 Ga0395901_0012573 Ga0395901_0012573_1465_2610 317
76 3300048903 Ga0496100_0011756 Ga0496100_0011756_2525_3673 317
77 3300005289 Ga0065704_10085049 Ga0065704_100850494 318
78 3300006195 Ga0075366_10000015 Ga0075366_100000159 318
79 3300013296 Ga0157374_10000014 Ga0157374_10000014341 318
80 3300014325 Ga0163163_10008260 Ga0163163_100082606 318
81 3300025927 Ga0207687_10000008 Ga0207687_10000008341 318
82 3300049571 Ga0501034_0008367 Ga0501034_0008367_43_1191 318
83 3300049573 Ga0501037_0092212 Ga0501037_0092212_710_1858 318
84 3300049581 Ga0501047_0000024 Ga0501047_0000024_107161_108309 318
85 3300049582 Ga0501048_0054868 Ga0501048_0054868_191_1339 318
86 3300049822 Ga0501035_0000005 Ga0501035_0000005_107246_108394 318
87 3300050493 nmdc:mga0k408_59_c1 nmdc:mga0k408_59_c1_2241_3380 318
88 3300005328 Ga0070676_10011578 Ga0070676_100115784 319
89 3300005364 Ga0070673_100000196 Ga0070673_10000019631 319
90 3300005466 Ga0070685_10003561 Ga0070685_100035614 319
91 3300005543 Ga0070672_100009953 Ga0070672_1000099537 319
92 3300005548 Ga0070665_100083305 Ga0070665_1000833052 319
93 3300006186 Ga0075369_10000004 Ga0075369_1000000457 319
94 3300006237 Ga0097621_100000001 Ga0097621_100000001257 319
95 3300006358 Ga0068871_100000001 Ga0068871_100000001111 319
96 3300009098 Ga0105245_10409303 Ga0105245_104093032 319
97 3300010375 Ga0105239_10009666 Ga0105239_1000966610 319
98 3300013102 Ga0157371_10002482 Ga0157371_100024829 319
99 3300013297 Ga0157378_10203670 Ga0157378_102036702 319
100 3300025907 Ga0207645_10014628 Ga0207645_100146282 319
101 3300025909 Ga0207705_10000231 Ga0207705_1000023132 319
102 3300025940 Ga0207691_10048127 Ga0207691_100481272 319
103 3300025949 Ga0207667_10023585 Ga0207667_100235854 319
104 3300025960 Ga0207651_10001595 Ga0207651_100015957 319
105 3300028379 Ga0268266_10062784 Ga0268266_100627842 319
106 3300031251 Ga0265327_10001879 Ga0265327_100018795 319
107 3300046459 Ga0495629_0008743 Ga0495629_0008743_2576_3718 319
108 3300046557 Ga0495622_0000008 Ga0495622_0000008_228996_230138 319
109 3300046674 Ga0495588_0000322 Ga0495588_0000322_5477_6631 319
110 3300046683 Ga0495658_0002196 Ga0495658_0002196_6015_7157 319
111 3300048088 Ga0495602_0068077 Ga0495602_0068077_789_1931 319
112 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_170767_171909 319
113 3300053079 Ga0500610_0004071 Ga0500610_0004071_2533_3678 319
114 3300053088 Ga0500644_0000436 Ga0500644_0000436_278_1417 319
115 3300053092 Ga0500583_0000085 Ga0500583_0000085_34418_35563 319
116 3300053093 Ga0500651_0086810 Ga0500651_0086810_597_1742 319
117 3300053094 Ga0500566_0000001 Ga0500566_0000001_63123_64265 319
118 3300053123 Ga0500614_000001 Ga0500614_000001_949335_950489 319
119 3300053123 Ga0500614_005800 Ga0500614_005800_608_1750 319
120 3300053130 Ga0500642_0002412 Ga0500642_0002412_3210_4355 319
121 3300053142 Ga0500577_0001073 Ga0500577_0001073_658_1797 319
122 3300053147 Ga0500589_000003 Ga0500589_000003_97806_98951 319
123 3300053722 Ga0500649_000006 Ga0500649_000006_42814_43968 319
124 3300053727 Ga0500611_000391 Ga0500611_000391_1331_2470 319
125 3300014969 Ga0157376_10000001 Ga0157376_10000001795 320
126 3300025927 Ga0207687_10023727 Ga0207687_100237274 320
127 3300027617 Ga0210002_1004533 Ga0210002_10045332 320
128 3300027876 Ga0209974_10004134 Ga0209974_100041346 320
129 3300031730 Ga0307516_10124102 Ga0307516_101241022 320
130 3300053079 Ga0500610_0000011 Ga0500610_0000011_14799_15965 320
131 3300053088 Ga0500644_0000704 Ga0500644_0000704_2605_3771 320
132 3300053103 Ga0500555_000002 Ga0500555_000002_1190597_1191763 320
133 3300053131 Ga0500652_000012 Ga0500652_000012_7871_9037 320
134 3300009553 Ga0105249_10000744 Ga0105249_100007448 321
135 3300025961 Ga0207712_10072962 Ga0207712_100729622 321
136 3300049744 Ga0501083_0136157 Ga0501083_0136157_183_1343 322
137 3300053103 Ga0500555_000001 Ga0500555_000001_103541_104680 322
138 3300053108 Ga0500562_000001 Ga0500562_000001_808117_809136 322
139 3300053133 Ga0500655_004856 Ga0500655_004856_706_1725 322
140 3300005937 Ga0081455_10000020 Ga0081455_10000020120 323
141 3300006186 Ga0075369_10000048 Ga0075369_100000483 323
142 3300006195 Ga0075366_10000003 Ga0075366_1000000321 323
143 3300038443 Ga0395901_0004862 Ga0395901_0004862_11456_12601 323
144 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_98771_99919 323
145 3300050516 nmdc:mga0sz30_10_c3 nmdc:mga0sz30_10_c3_27538_28686 323
146 3300053088 Ga0500644_0027551 Ga0500644_0027551_570_1718 323
147 3300053090 Ga0500646_0000253 Ga0500646_0000253_11306_12454 323
148 3300053092 Ga0500583_0002012 Ga0500583_0002012_1463_2611 323
149 3300053098 Ga0500650_0000040 Ga0500650_0000040_6621_7769 323
150 3300053118 Ga0500594_0000001 Ga0500594_0000001_514068_515216 323
151 3300053133 Ga0500655_000798 Ga0500655_000798_3782_4930 323
152 3300053142 Ga0500577_0001601 Ga0500577_0001601_1988_3136 323
153 3300053160 Ga0500633_0007245 Ga0500633_0007245_1095_2243 323
154 3300053724 Ga0500570_000001 Ga0500570_000001_138963_140099 323
155 3300005563 Ga0068855_100011636 Ga0068855_1000116367 324
156 3300006042 Ga0075368_10024814 Ga0075368_100248143 324
157 3300006178 Ga0075367_10000007 Ga0075367_100000074 324
158 3300006195 Ga0075366_10000064 Ga0075366_1000006439 324
159 3300009094 Ga0111539_10010609 Ga0111539_100106093 324
160 3300014745 Ga0157377_10053574 Ga0157377_100535742 324
161 3300027866 Ga0209813_10012369 Ga0209813_100123692 324
162 3300031251 Ga0265327_10000025 Ga0265327_1000002564 324
163 3300049744 Ga0501083_0042106 Ga0501083_0042106_1361_2506 324
164 3300050491 nmdc:mga00v17_12456_c2 nmdc:mga00v17_12456_c2_399_1559 324
165 3300050493 nmdc:mga0k408_181_c1 nmdc:mga0k408_181_c1_14581_15741 324
166 3300050494 nmdc:mga06z11_144_c1 nmdc:mga06z11_144_c1_25155_26315 324
167 3300050495 nmdc:mga04h51_10661_c1 nmdc:mga04h51_10661_c1_451_1611 324
168 3300050511 nmdc:mga08y16_6406_c1 nmdc:mga08y16_6406_c1_1621_2784 324
169 3300053087 Ga0500643_000009 Ga0500643_000009_203888_205069 325
170 3300005578 Ga0068854_100035485 Ga0068854_1000354852 326
171 3300005616 Ga0068852_100005458 Ga0068852_1000054589 326
172 3300009174 Ga0105241_10024490 Ga0105241_100244905 326
173 3300013105 Ga0157369_10159571 Ga0157369_101595711 326
174 3300020070 Ga0206356_10657575 Ga0206356_106575752 326
175 3300025911 Ga0207654_10067861 Ga0207654_100678611 326
176 3300026142 Ga0207698_10014281 Ga0207698_100142812 326
177 3300005842 Ga0068858_100010008 Ga0068858_1000100087 328
178 3300026035 Ga0207703_10029719 Ga0207703_100297195 328
179 3300037418 Ga0395900_0024306 Ga0395900_0024306_900_2027 328
180 3300005327 Ga0070658_10000228 Ga0070658_1000022811 329
181 3300005563 Ga0068855_100005245 Ga0068855_10000524512 329
182 3300005563 Ga0068855_100015134 Ga0068855_1000151346 329
183 3300009551 Ga0105238_10000151 Ga0105238_1000015119 329
184 3300010375 Ga0105239_10002455 Ga0105239_100024552 329
185 3300013296 Ga0157374_10033473 Ga0157374_100334734 329
186 3300025909 Ga0207705_10002131 Ga0207705_100021316 329
187 3300025911 Ga0207654_10102374 Ga0207654_101023742 329
188 3300025924 Ga0207694_10001155 Ga0207694_1000115513 329
189 3300025949 Ga0207667_10034628 Ga0207667_100346283 329
190 3300006028 Ga0070717_10202487 Ga0070717_102024872 330
191 3300028800 Ga0265338_10004463 Ga0265338_1000446317 330
192 3300037418 Ga0395900_0013775 Ga0395900_0013775_4608_5735 330
193 3300037466 Ga0395898_0004623 Ga0395898_0004623_10510_11637 330
194 3300037471 Ga0395905_0061933 Ga0395905_0061933_589_1716 330
195 3300038443 Ga0395901_0277491 Ga0395901_0277491_278_1405 330
196 3300025913 Ga0207695_10206607 Ga0207695_102066071 332
197 3300005614 Ga0068856_100012876 Ga0068856_1000128764 334
198 3300026078 Ga0207702_10038776 Ga0207702_100387762 334
199 3300001990 JGI24737J22298_10000068 JGI24737J22298_1000006811 335
200 3300002067 JGI24735J21928_10000055 JGI24735J21928_100000558 335
201 3300005337 Ga0070682_100202611 Ga0070682_1002026111 335
202 3300005339 Ga0070660_100046449 Ga0070660_1000464492 335
203 3300005344 Ga0070661_100082495 Ga0070661_1000824952 335
204 3300005366 Ga0070659_100082638 Ga0070659_1000826382 335
205 3300005577 Ga0068857_100022116 Ga0068857_1000221164 335
206 3300005578 Ga0068854_100177702 Ga0068854_1001777022 335
207 3300013105 Ga0157369_10018169 Ga0157369_100181693 335
208 3300013307 Ga0157372_10012683 Ga0157372_100126836 335
209 3300025912 Ga0207707_10013359 Ga0207707_100133595 335
210 3300025919 Ga0207657_10023455 Ga0207657_100234556 335
211 3300025921 Ga0207652_10249630 Ga0207652_102496302 335
212 3300025932 Ga0207690_10204590 Ga0207690_102045902 335
213 3300025949 Ga0207667_10023342 Ga0207667_100233422 335
214 3300026116 Ga0207674_10016071 Ga0207674_100160716 335
215 3300026142 Ga0207698_10010288 Ga0207698_100102882 335
216 3300053137 Ga0500561_0000002 Ga0500561_0000002_284892_286070 335
217 3300009177 Ga0105248_10188865 Ga0105248_101888652 336
218 3300028800 Ga0265338_10025470 Ga0265338_100254705 336
219 3300005530 Ga0070679_100000332 Ga0070679_10000033219 337
220 3300025921 Ga0207652_10003400 Ga0207652_100034006 337
221 3300053153 Ga0500616_0000005 Ga0500616_0000005_836276_837418 337
222 3300037471 Ga0395905_0002998 Ga0395905_0002998_16717_17847 338
223 3300004803 Ga0058862_10121158 Ga0058862_101211583 339
224 3300005841 Ga0068863_100104064 Ga0068863_1001040642 339
225 3300013296 Ga0157374_10002318 Ga0157374_100023182 339
226 3300025931 Ga0207644_10036256 Ga0207644_100362562 339
227 3300026088 Ga0207641_10091066 Ga0207641_100910662 339
228 3300026088 Ga0207641_10110193 Ga0207641_101101932 339
229 3300059505 Ga0587083_0009177 Ga0587083_0009177_34_1155 339
230 3300046694 Ga0495649_0000025 Ga0495649_0000025_139913_141052 340
231 3300028556 Ga0265337_1000048 Ga0265337_100004822 341
232 3300028800 Ga0265338_10001060 Ga0265338_1000106024 341
233 3300049573 Ga0501037_0183439 Ga0501037_0183439_165_1292 342
234 3300049586 Ga0501070_0014554 Ga0501070_0014554_1875_3002 342
235 3300009093 Ga0105240_10235987 Ga0105240_102359873 343
236 3300006038 Ga0075365_10105726 Ga0075365_101057262 344
237 3300009148 Ga0105243_10181526 Ga0105243_101815262 344
238 3300013307 Ga0157372_10015808 Ga0157372_100158087 344
239 3300013307 Ga0157372_10173195 Ga0157372_101731952 344
240 3300025935 Ga0207709_10108585 Ga0207709_101085852 344
241 3300050491 nmdc:mga00v17_69000_c1 nmdc:mga00v17_69000_c1_261_1382 344
242 3300050492 nmdc:mga0yw44_74714_c1 nmdc:mga0yw44_74714_c1_236_1357 344
243 3300053139 Ga0500568_0015748 Ga0500568_0015748_969_2090 344
244 3300005365 Ga0070688_100068278 Ga0070688_1000682782 345
245 3300005466 Ga0070685_10001076 Ga0070685_100010765 345
246 3300005563 Ga0068855_100015189 Ga0068855_1000151892 345
247 3300005614 Ga0068856_100000002 Ga0068856_100000002289 345
248 3300014325 Ga0163163_10019410 Ga0163163_100194106 345
249 3300025924 Ga0207694_10182152 Ga0207694_101821522 345
250 3300025949 Ga0207667_10004707 Ga0207667_1000470719 345
251 3300026078 Ga0207702_10000001 Ga0207702_10000001143 345
252 3300028379 Ga0268266_10002107 Ga0268266_1000210716 345
253 3300053093 Ga0500651_0000011 Ga0500651_0000011_229988_231112 345
254 3300053123 Ga0500614_001870 Ga0500614_001870_3237_4361 345
255 3300005327 Ga0070658_10010498 Ga0070658_100104983 346
256 3300005327 Ga0070658_10061391 Ga0070658_100613912 346
257 3300005336 Ga0070680_100000241 Ga0070680_10000024132 346
258 3300005339 Ga0070660_100000169 Ga0070660_10000016928 346
259 3300005339 Ga0070660_100000226 Ga0070660_1000002265 346
260 3300005341 Ga0070691_10012204 Ga0070691_100122043 346
261 3300005366 Ga0070659_100000131 Ga0070659_10000013120 346
262 3300005458 Ga0070681_10156801 Ga0070681_101568012 346
263 3300005530 Ga0070679_100000499 Ga0070679_1000004998 346
264 3300005530 Ga0070679_100051299 Ga0070679_1000512992 346
265 3300005563 Ga0068855_100000324 Ga0068855_10000032429 346
266 3300005577 Ga0068857_100000001 Ga0068857_10000000193 346
267 3300009551 Ga0105238_10125772 Ga0105238_101257722 346
268 3300013307 Ga0157372_10000774 Ga0157372_100007748 346
269 3300025909 Ga0207705_10083937 Ga0207705_100839372 346
270 3300025912 Ga0207707_10010266 Ga0207707_100102668 346
271 3300025917 Ga0207660_10000180 Ga0207660_1000018014 346
272 3300025919 Ga0207657_10000502 Ga0207657_1000050215 346
273 3300025921 Ga0207652_10037375 Ga0207652_100373752 346
274 3300025924 Ga0207694_10181483 Ga0207694_101814832 346
275 3300025932 Ga0207690_10001822 Ga0207690_1000182210 346
276 3300025949 Ga0207667_10000577 Ga0207667_1000057722 346
277 3300026116 Ga0207674_10000021 Ga0207674_1000002190 346
278 3300026116 Ga0207674_10125112 Ga0207674_101251122 346
279 3300026116 Ga0207674_10367570 Ga0207674_103675702 346
280 3300028556 Ga0265337_1003484 Ga0265337_10034845 346
281 3300028558 Ga0265326_10000917 Ga0265326_100009178 346
282 3300028563 Ga0265319_1044591 Ga0265319_10445911 346
283 3300028573 Ga0265334_10000004 Ga0265334_100000043 346
284 3300028800 Ga0265338_10000003 Ga0265338_10000003825 346
285 3300028800 Ga0265338_10001799 Ga0265338_1000179911 346
286 3300053093 Ga0500651_0022760 Ga0500651_0022760_277_1404 346
287 3300009176 Ga0105242_10001258 Ga0105242_1000125816 347
288 3300009551 Ga0105238_10081063 Ga0105238_100810633 347
289 3300025913 Ga0207695_10056979 Ga0207695_100569793 347
290 3300025934 Ga0207686_10002162 Ga0207686_100021626 347
291 3300028800 Ga0265338_10065073 Ga0265338_100650732 347
292 3300037418 Ga0395900_0000434 Ga0395900_0000434_47166_48293 347
293 3300037466 Ga0395898_0016917 Ga0395898_0016917_2723_3850 347
294 3300038443 Ga0395901_0057984 Ga0395901_0057984_2093_3220 347
295 3300049589 Ga0501073_0058441 Ga0501073_0058441_649_1797 347
296 3300049742 Ga0501080_0000007 Ga0501080_0000007_61362_62510 347
297 3300006051 Ga0075364_10000161 Ga0075364_1000016112 348
298 3300028558 Ga0265326_10000208 Ga0265326_1000020824 348
299 3300028573 Ga0265334_10001327 Ga0265334_1000132712 348
300 3300028654 Ga0265322_10008048 Ga0265322_100080483 348
301 3300028666 Ga0265336_10000020 Ga0265336_10000020234 348
302 3300028800 Ga0265338_10000093 Ga0265338_1000009322 348
303 3300028800 Ga0265338_10056817 Ga0265338_100568172 348
304 3300029957 Ga0265324_10002301 Ga0265324_100023017 348
305 3300005530 Ga0070679_100136461 Ga0070679_1001364612 349
306 3300014325 Ga0163163_10235020 Ga0163163_102350202 349
307 3300025929 Ga0207664_10000161 Ga0207664_1000016167 349
308 3300028800 Ga0265338_10003103 Ga0265338_1000310321 349
309 3300028800 Ga0265338_10215779 Ga0265338_102157791 349
310 3300005353 Ga0070669_100134610 Ga0070669_1001346102 350
311 3300005985 Ga0081539_10051450 Ga0081539_100514502 350
312 3300013296 Ga0157374_10099058 Ga0157374_100990582 350
313 3300028381 Ga0268264_10040640 Ga0268264_100406403 350
314 3300028558 Ga0265326_10022498 Ga0265326_100224981 350
315 3300028573 Ga0265334_10010386 Ga0265334_100103861 350
316 3300028800 Ga0265338_10002189 Ga0265338_1000218928 350
317 3300028800 Ga0265338_10102261 Ga0265338_101022612 350
318 3300029957 Ga0265324_10008000 Ga0265324_100080003 350
319 3300031249 Ga0265339_10049672 Ga0265339_100496722 350
320 3300031251 Ga0265327_10019705 Ga0265327_100197052 350
321 3300031344 Ga0265316_10022626 Ga0265316_100226264 350
322 3300031711 Ga0265314_10101193 Ga0265314_101011932 350
323 3300005547 Ga0070693_100020562 Ga0070693_1000205621 351
324 3300025921 Ga0207652_10310781 Ga0207652_103107812 351
325 3300025949 Ga0207667_10010449 Ga0207667_100104492 351
326 3300013105 Ga0157369_10016734 Ga0157369_100167345 352
327 3300028556 Ga0265337_1000791 Ga0265337_100079120 352
328 3300028558 Ga0265326_10002637 Ga0265326_100026372 352
329 3300028558 Ga0265326_10045778 Ga0265326_100457781 352
330 3300028654 Ga0265322_10002738 Ga0265322_100027383 352
331 3300028666 Ga0265336_10023535 Ga0265336_100235352 352
332 3300028800 Ga0265338_10002656 Ga0265338_100026562 352
333 3300031249 Ga0265339_10044765 Ga0265339_100447652 352
334 3300031595 Ga0265313_10037105 Ga0265313_100371052 352
335 3300006038 Ga0075365_10058932 Ga0075365_100589322 354
336 3300006195 Ga0075366_10000030 Ga0075366_100000308 354
337 3300050492 nmdc:mga0yw44_26128_c1 nmdc:mga0yw44_26128_c1_2099_3259 354
338 3300050493 nmdc:mga0k408_15_c1 nmdc:mga0k408_15_c1_37240_38400 354
339 3300005563 Ga0068855_100000001 Ga0068855_100000001783 355
340 3300006051 Ga0075364_10007538 Ga0075364_100075387 355
341 3300009174 Ga0105241_10000009 Ga0105241_10000009158 355
342 3300013105 Ga0157369_10000273 Ga0157369_1000027337 355
343 3300025911 Ga0207654_10000002 Ga0207654_10000002120 355
344 3300025949 Ga0207667_10000003 Ga0207667_10000003766 355
345 3300048929 Ga0496126_0262858 Ga0496126_0262858_220_1377 355
346 3300050491 nmdc:mga00v17_13380_c1 nmdc:mga00v17_13380_c1_2397_3563 355
347 3300050492 nmdc:mga0yw44_37839_c1 nmdc:mga0yw44_37839_c1_1184_2350 355
348 3300050493 nmdc:mga0k408_56_c1 nmdc:mga0k408_56_c1_42025_43191 355
349 3300009986 Ga0105033_100189 Ga0105033_1001894 357
350 3300001915 JGI24741J21665_1000398 JGI24741J21665_10003983 361
351 3300001979 JGI24740J21852_10003576 JGI24740J21852_100035766 361

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

344

397

0.98

PF00140

Sigma70_r1_2

Sigma-70 factor, region 1.2

116

149

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

175

245

0.97

PF04539

Sigma70_r3

Sigma-70 region 3

254

332

0.95

PF03979

Sigma70_r1_1

Sigma-70 factor, region 1.1

22

106

0.81

Feature Viewer

pLDDT pTM Quality
73.2 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map