F418491

General Info

Members Datasets Scaffolds Average Seq Length
351 181 702 184

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10002669|Ga0065712_100026692
Length 213
Sequence MELAGAGDIDGKRGSVSELARANQTPYNDLVSIVTKTGDKGETSLMYGRRLSKADPRVEAYGCVDELSAALGLARSIATDKFLSDQIFAAQKDLIVVMGELATASSDHHRYAKDGFHLTKTEMVDRITSVVFDLEKDKSLYPKDWVVPGATKISAALDFARTTCRRAERHIAAFGVEESDLNPEILRXLNRLSDLCWILARYAEKNLPAQEXS

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
113 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
127 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
179 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.4
Rhizosphere 88.32
Stem 0
Stem Tuber 0
Unclassified 13.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10002669 3300005290 Bacteria 4850
2 SwRhRL2b_contig_2624327 2162886007 Unclassified 1126
3 SwRhRL2b_contig_528231 2162886007 Bacteria 1309
4 2214866335 2209111006 Unclassified 595
5 JGI25406J46586_10000001 3300003203 Bacteria 251772
6 JGI25406J46586_10098405 3300003203 Unclassified 875
7 Ga0065704_10002559 3300005289 Bacteria 6791
8 Ga0065704_10042338 3300005289 Unclassified 1149
9 Ga0065704_10422804 3300005289 Unclassified 718
10 Ga0065712_10002205 3300005290 Bacteria 4733
11 Ga0065712_10002881 3300005290 Bacteria 6014
12 Ga0065712_10010994 3300005290 Unclassified 2195
13 Ga0065715_10004718 3300005293 Bacteria 3742
14 Ga0065715_10007274 3300005293 Bacteria 5215
15 Ga0065715_10014879 3300005293 Bacteria 2584
16 Ga0065715_10138044 3300005293 Unclassified 1894
17 Ga0065715_10510396 3300005293 Bacteria 772
18 Ga0065707_10036105 3300005295 Unclassified 1159
19 Ga0065707_10177689 3300005295 Unclassified 1425
20 Ga0070690_100052830 3300005330 Bacteria 2598
21 Ga0070689_100017242 3300005340 Bacteria 5299
22 Ga0070689_100043100 3300005340 Bacteria 3466
23 Ga0070687_100023917 3300005343 Bacteria 2909
24 Ga0070675_100308738 3300005354 Bacteria 1395
25 Ga0070671_100054173 3300005355 Bacteria 3334
26 Ga0070671_100084514 3300005355 Bacteria 2654
27 Ga0070688_100002299 3300005365 Bacteria 9656
28 Ga0070667_100019333 3300005367 Bacteria 5650
29 Ga0070703_10028313 3300005406 Bacteria 1674
30 Ga0070709_10628655 3300005434 Unclassified 829
31 Ga0070713_100116452 3300005436 Bacteria 2337
32 Ga0070713_100130631 3300005436 Bacteria 2214
33 Ga0070711_100222571 3300005439 Bacteria 1468
34 Ga0070711_100229923 3300005439 Bacteria 1445
35 Ga0070705_100022560 3300005440 Bacteria 3365
36 Ga0070700_100021352 3300005441 Bacteria 3762
37 Ga0070708_100001887 3300005445 Bacteria 16088
38 Ga0070708_100059823 3300005445 Bacteria 3398
39 Ga0070708_100107782 3300005445 Bacteria 2558
40 Ga0070708_100169865 3300005445 Bacteria 2035
41 Ga0070708_100183142 3300005445 Bacteria 1958
42 Ga0070708_100304238 3300005445 Bacteria 1501
43 Ga0070662_100001372 3300005457 Bacteria 14974
44 Ga0070685_10023299 3300005466 Bacteria 3389
45 Ga0070706_100010507 3300005467 Bacteria 8592
46 Ga0070706_100011357 3300005467 Bacteria 8276
47 Ga0070706_100269278 3300005467 Bacteria 1590
48 Ga0070706_100631233 3300005467 Bacteria 995
49 Ga0070706_100968670 3300005467 Unclassified 785
50 Ga0070707_100007819 3300005468 Bacteria 9927
51 Ga0070707_100023996 3300005468 Bacteria 5771
52 Ga0070707_100062295 3300005468 Bacteria 3578
53 Ga0070707_100065564 3300005468 Bacteria 3489
54 Ga0070707_100079579 3300005468 Bacteria 3163
55 Ga0070707_100350343 3300005468 Bacteria 1434
56 Ga0070707_100703798 3300005468 Bacteria 973
57 Ga0070698_100025074 3300005471 Bacteria 6215
58 Ga0070698_100036909 3300005471 Bacteria 5042
59 Ga0070698_100122128 3300005471 Bacteria 2564
60 Ga0070698_100126657 3300005471 Bacteria 2511
61 Ga0070698_100724060 3300005471 Unclassified 938
62 Ga0070698_100837097 3300005471 Bacteria 865
63 Ga0070699_100068349 3300005518 Bacteria 3085
64 Ga0070699_100918328 3300005518 Unclassified 802
65 Ga0070684_100001523 3300005535 Bacteria 16755
66 Ga0070697_100001163 3300005536 Bacteria 19934
67 Ga0070697_100002323 3300005536 Bacteria 14616
68 Ga0070697_100009748 3300005536 Bacteria 7491
69 Ga0070697_100013326 3300005536 Bacteria 6448
70 Ga0070697_100036716 3300005536 Bacteria 3958
71 Ga0070697_100041468 3300005536 Bacteria 3725
72 Ga0070697_100139384 3300005536 Bacteria 2039
73 Ga0070697_100961652 3300005536 Unclassified 759
74 Ga0070686_100080001 3300005544 Bacteria 2161
75 Ga0070695_100025252 3300005545 Bacteria 3668
76 Ga0070693_100056651 3300005547 Bacteria 2263
77 Ga0070665_100142887 3300005548 Bacteria 2396
78 Ga0070664_100226892 3300005564 Bacteria 1673
79 Ga0070702_100027531 3300005615 Bacteria 3068
80 Ga0068859_100012007 3300005617 Bacteria 8702
81 Ga0068864_100243194 3300005618 Bacteria 1668
82 Ga0068863_100009650 3300005841 Bacteria 9416
83 Ga0068863_100064786 3300005841 Bacteria 3456
84 Ga0068863_100197568 3300005841 Bacteria 1934
85 Ga0068858_100004649 3300005842 Bacteria 13450
86 Ga0068858_100252628 3300005842 Bacteria 1675
87 Ga0068860_100059681 3300005843 Bacteria 3626
88 Ga0068862_100029823 3300005844 Bacteria 4597
89 Ga0081455_10000281 3300005937 Bacteria 67337
90 Ga0081455_10056637 3300005937 Bacteria 3327
91 Ga0081539_10000014 3300005985 Bacteria 411270
92 Ga0081539_10005490 3300005985 Bacteria 12883
93 Ga0070717_10023656 3300006028 Bacteria 4871
94 Ga0070717_10051195 3300006028 Bacteria 3397
95 Ga0070717_10065949 3300006028 Bacteria 3010
96 Ga0070716_100047822 3300006173 Bacteria 2415
97 Ga0070716_100111905 3300006173 Bacteria 1694
98 Ga0070716_100211442 3300006173 Unclassified 1296
99 Ga0070716_100244871 3300006173 Bacteria 1218
100 Ga0070712_100022714 3300006175 Bacteria 4135
101 Ga0070712_100030702 3300006175 Bacteria 3615
102 Ga0070712_100149317 3300006175 Bacteria 1793
103 Ga0070712_100363328 3300006175 Unclassified 1188
104 Ga0070712_100555735 3300006175 Bacteria 967
105 Ga0070712_100786471 3300006175 Bacteria 816
106 Ga0068871_100227767 3300006358 Bacteria 1617
107 Ga0075434_100561619 3300006871 Bacteria 1161
108 Ga0075434_100609533 3300006871 Bacteria 1111
109 Ga0068865_100913251 3300006881 Bacteria 764
110 Ga0097620_100012007 3300006931 Bacteria 8702
111 Ga0099794_10133743 3300007265 Bacteria 1253
112 Ga0105245_10123431 3300009098 Bacteria 2422
113 Ga0105247_10227051 3300009101 Bacteria 1266
114 Ga0114129_10003628 3300009147 Bacteria 21715
115 Ga0114129_10328193 3300009147 Bacteria 2032
116 Ga0105243_10082840 3300009148 Bacteria 2623
117 Ga0105243_10279489 3300009148 Bacteria 1503
118 Ga0105241_10247527 3300009174 Bacteria 1510
119 Ga0105248_10284736 3300009177 Bacteria 1861
120 Ga0105237_10063589 3300009545 Bacteria 3688
121 Ga0105249_10001939 3300009553 Bacteria 17967
122 Ga0105249_10056228 3300009553 Bacteria 3602
123 Ga0105249_10961932 3300009553 Unclassified 922
124 Ga0105249_11342944 3300009553 Unclassified 787
125 Ga0099796_10016179 3300010159 Bacteria 2197
126 Ga0099796_10051408 3300010159 Bacteria 1432
127 Ga0105239_10008184 3300010375 Bacteria 11927
128 Ga0105239_10163482 3300010375 Bacteria 2488
129 Ga0105239_10269871 3300010375 Bacteria 1913
130 Ga0105246_10025344 3300011119 Bacteria 3865
131 Ga0157370_10063050 3300013104 Bacteria 3513
132 Ga0157369_10026885 3300013105 Bacteria 6381
133 Ga0157374_10005031 3300013296 Bacteria 11087
134 Ga0157374_10035253 3300013296 Bacteria 4577
135 Ga0157374_10048201 3300013296 Bacteria 3953
136 Ga0157374_10081536 3300013296 Bacteria 3070
137 Ga0157374_10090191 3300013296 Bacteria 2922
138 Ga0157374_10099400 3300013296 Bacteria 2787
139 Ga0157374_10218791 3300013296 Bacteria 1869
140 Ga0157378_10108865 3300013297 Bacteria 2538
141 Ga0157378_10263357 3300013297 Bacteria 1655
142 Ga0157378_10447697 3300013297 Bacteria 1281
143 Ga0157378_10917205 3300013297 Bacteria 907
144 Ga0163162_10017622 3300013306 Bacteria 6987
145 Ga0163162_10046371 3300013306 Bacteria 4356
146 Ga0157372_10132038 3300013307 Bacteria 2874
147 Ga0157372_10403865 3300013307 Bacteria 1592
148 Ga0157372_10592693 3300013307 Bacteria 1292
149 Ga0157375_10001983 3300013308 Bacteria 17679
150 Ga0157375_10109810 3300013308 Bacteria 2854
151 Ga0157375_10295592 3300013308 Bacteria 1783
152 Ga0163163_10088850 3300014325 Bacteria 3102
153 Ga0163163_10395745 3300014325 Bacteria 1439
154 Ga0157377_10052399 3300014745 Bacteria 2304
155 Ga0157377_10168828 3300014745 Bacteria 1367
156 Ga0157377_10524864 3300014745 Viruses 832
157 Ga0157379_10156528 3300014968 Bacteria 2056
158 Ga0157376_10021048 3300014969 Bacteria 5060
159 Ga0157376_10241904 3300014969 Bacteria 1681
160 Ga0207666_1041010 3300025271 Viruses 724
161 Ga0207673_1001777 3300025290 Bacteria 2396
162 Ga0207697_10000141 3300025315 Bacteria 34858
163 Ga0207697_10000555 3300025315 Bacteria 21125
164 Ga0207697_10132496 3300025315 Bacteria 1078
165 Ga0207653_10026666 3300025885 Bacteria 1853
166 Ga0207692_10678156 3300025898 Unclassified 668
167 Ga0207710_10096968 3300025900 Bacteria 1387
168 Ga0207645_10001403 3300025907 Bacteria 19722
169 Ga0207684_10003481 3300025910 Bacteria 15355
170 Ga0207684_10004403 3300025910 Bacteria 13277
171 Ga0207684_10008163 3300025910 Bacteria 9324
172 Ga0207684_10026846 3300025910 Bacteria 4910
173 Ga0207684_10028698 3300025910 Bacteria 4740
174 Ga0207684_10055403 3300025910 Bacteria 3364
175 Ga0207684_10371872 3300025910 Bacteria 1230
176 Ga0207671_10338599 3300025914 Bacteria 1192
177 Ga0207693_10005679 3300025915 Bacteria 10372
178 Ga0207693_10036885 3300025915 Bacteria 3854
179 Ga0207693_10096344 3300025915 Bacteria 2320
180 Ga0207693_10271270 3300025915 Bacteria 1329
181 Ga0207693_10293472 3300025915 Bacteria 1274
182 Ga0207693_10301513 3300025915 Unclassified 1255
183 Ga0207663_10156881 3300025916 Bacteria 1602
184 Ga0207663_10267045 3300025916 Bacteria 1266
185 Ga0207662_10000732 3300025918 Bacteria 15042
186 Ga0207657_10028716 3300025919 Bacteria 5070
187 Ga0207649_10114886 3300025920 Unclassified 1805
188 Ga0207646_10000317 3300025922 Bacteria 65310
189 Ga0207646_10007978 3300025922 Bacteria 10677
190 Ga0207646_10021163 3300025922 Bacteria 6015
191 Ga0207646_10030946 3300025922 Bacteria 4848
192 Ga0207646_10086357 3300025922 Bacteria 2807
193 Ga0207646_10094498 3300025922 Bacteria 2677
194 Ga0207646_10198311 3300025922 Bacteria 1813
195 Ga0207646_10263315 3300025922 Bacteria 1558
196 Ga0207646_10265773 3300025922 Bacteria 1551
197 Ga0207681_10001792 3300025923 Bacteria 13794
198 Ga0207659_10001955 3300025926 Bacteria 12237
199 Ga0207687_10256879 3300025927 Bacteria 1391
200 Ga0207687_10259988 3300025927 Bacteria 1384
201 Ga0207700_10091041 3300025928 Bacteria 2408
202 Ga0207664_10007287 3300025929 Bacteria 7671
203 Ga0207664_10120191 3300025929 Bacteria 2197
204 Ga0207644_10038495 3300025931 Bacteria 3369
205 Ga0207690_10006433 3300025932 Bacteria 6961
206 Ga0207690_10045879 3300025932 Bacteria 2890
207 Ga0207706_10015703 3300025933 Bacteria 6845
208 Ga0207706_10216378 3300025933 Bacteria 1678
209 Ga0207670_10000380 3300025936 Bacteria 25579
210 Ga0207670_10240131 3300025936 Bacteria 1395
211 Ga0207665_10022352 3300025939 Bacteria 4160
212 Ga0207665_10050772 3300025939 Bacteria 2790
213 Ga0207665_10110250 3300025939 Bacteria 1933
214 Ga0207665_10164982 3300025939 Bacteria 1596
215 Ga0207689_10130101 3300025942 Bacteria 2071
216 Ga0207712_10029871 3300025961 Bacteria 3660
217 Ga0207712_11462325 3300025961 Unclassified 612
218 Ga0207668_10053847 3300025972 Bacteria 2790
219 Ga0207658_10013918 3300025986 Bacteria 5505
220 Ga0207658_10207112 3300025986 Bacteria 1641
221 Ga0207658_10301202 3300025986 Bacteria 1381
222 Ga0207703_10035241 3300026035 Bacteria 3977
223 Ga0207708_10065963 3300026075 Bacteria 2768
224 Ga0207641_10485487 3300026088 Unclassified 1198
225 Ga0207641_10859444 3300026088 Bacteria 899
226 Ga0207683_10030846 3300026121 Bacteria 4648
227 Ga0268265_10027139 3300028380 Bacteria 4083
228 Ga0268264_10027991 3300028381 Bacteria 4609
229 Ga0268264_10634008 3300028381 Bacteria 1056
230 Ga0265336_10091399 3300028666 Unclassified 907
231 Ga0373953_0160010 3300035117 Bacteria 968
232 Ga0373954_0113302 3300035118 Bacteria 1313
233 Ga0373957_0008348 3300035120 Bacteria 3350
234 Ga0373942_0131996 3300035207 Unclassified 789
235 Ga0373924_0093963 3300035410 Bacteria 1285
236 Ga0373931_0232192 3300035691 Bacteria 1115
237 Ga0373935_0002468 3300035692 Bacteria 10578
238 Ga0373935_0030415 3300035692 Bacteria 3347
239 Ga0373933_0436551 3300035724 Bacteria 856
240 Ga0373947_0315695 3300035725 Unclassified 1044
241 Ga0373937_0038066 3300036401 Bacteria 4384
242 Ga0373937_0318292 3300036401 Unclassified 1472
243 Ga0373937_0493890 3300036401 Bacteria 1163
244 Ga0373925_0122983 3300037068 Bacteria 2016
245 Ga0373925_0351366 3300037068 Bacteria 1197
246 Ga0395899_0042555 3300037312 Bacteria 3391
247 Ga0395900_1167167 3300037418 Unclassified 686
248 Ga0395898_0003960 3300037466 Bacteria 16321
249 Ga0395898_0407559 3300037466 Unclassified 1296
250 Ga0395905_0333826 3300037471 Bacteria 1407
251 Ga0395905_0562443 3300037471 Bacteria 1042
252 Ga0395901_0005337 3300038443 Bacteria 12984
253 Ga0395901_0114211 3300038443 Bacteria 2836
254 Ga0395901_0321470 3300038443 Bacteria 1601
255 Ga0395901_1547944 3300038443 Unclassified 618
256 Ga0451853_2269887 3300041512 Unclassified 899
257 Ga0439455_0008591 3300042012 Bacteria 2193
258 Ga0439458_0003943 3300042157 Bacteria 3427
259 Ga0439458_0010716 3300042157 Unclassified 2047
260 Ga0439440_0004188 3300042993 Bacteria 2825
261 Ga0495592_0007988 3300046454 Bacteria 7938
262 Ga0495592_0280003 3300046454 Unclassified 1091
263 Ga0495603_0091731 3300046455 Bacteria 1776
264 Ga0495629_0116033 3300046459 Bacteria 1866
265 Ga0495651_0264778 3300046462 Bacteria 1168
266 Ga0495651_0458297 3300046462 Bacteria 823
267 Ga0495653_0076503 3300046463 Bacteria 2488
268 Ga0495639_0049769 3300046475 Unclassified 1903
269 Ga0495664_0045046 3300046477 Unclassified 2616
270 Ga0495664_0101708 3300046477 Bacteria 1732
271 Ga0495608_0182859 3300046511 Bacteria 1326
272 Ga0495628_0011212 3300046516 Bacteria 7584
273 Ga0495630_0010624 3300046517 Bacteria 6648
274 Ga0495652_0012119 3300046529 Bacteria 7789
275 Ga0495652_0245630 3300046529 Unclassified 1329
276 Ga0495640_0190776 3300046533 Bacteria 1303
277 Ga0495586_0142987 3300046535 Bacteria 1343
278 Ga0495586_0498724 3300046535 Unclassified 702
279 Ga0495645_0003075 3300046543 Bacteria 11304
280 Ga0495635_0120825 3300046663 Bacteria 1787
281 Ga0495635_0343012 3300046663 Bacteria 997
282 Ga0495599_0005908 3300046678 Bacteria 7356
283 Ga0495623_0011497 3300046679 Bacteria 5729
284 Ga0495646_0010846 3300046680 Bacteria 5789
285 Ga0495658_0335383 3300046683 Bacteria 960
286 Ga0495613_0601179 3300046689 Unclassified 732
287 Ga0495624_0218508 3300046690 Bacteria 1156
288 Ga0495581_0131224 3300047315 Bacteria 1460
289 Ga0495581_0208177 3300047315 Bacteria 1144
290 Ga0495604_0135776 3300047317 Bacteria 1763
291 Ga0495604_0166574 3300047317 Bacteria 1553
292 Ga0495675_0012468 3300047444 Bacteria 5351
293 Ga0495684_0026656 3300047471 Bacteria 4441
294 Ga0495593_0237715 3300047673 Bacteria 913
295 Ga0495602_0056715 3300048088 Bacteria 3442
296 Ga0496100_0757406 3300048903 Unclassified 760
297 Ga0496101_0084984 3300048904 Bacteria 2344
298 Ga0496101_0251458 3300048904 Bacteria 1377
299 Ga0496102_0226838 3300048905 Unclassified 1761
300 Ga0496102_0335959 3300048905 Bacteria 1423
301 Ga0496102_0377709 3300048905 Bacteria 1334
302 Ga0496102_0458643 3300048905 Bacteria 1195
303 Ga0496104_0115131 3300048907 Bacteria 2580
304 Ga0496105_0049445 3300048908 Bacteria 3472
305 Ga0496105_0141688 3300048908 Bacteria 1979
306 Ga0496105_0168213 3300048908 Bacteria 1798
307 Ga0496105_1006717 3300048908 Unclassified 623
308 Ga0496106_0087886 3300048909 Bacteria 2395
309 Ga0496107_0129325 3300048910 Bacteria 1864
310 Ga0496107_0517417 3300048910 Bacteria 885
311 Ga0496108_0025877 3300048911 Bacteria 4839
312 Ga0496109_0002468 3300048912 Bacteria 15507
313 Ga0496109_0048940 3300048912 Bacteria 3847
314 Ga0496109_0384575 3300048912 Bacteria 1326
315 Ga0496109_0917735 3300048912 Bacteria 814
316 Ga0496110_0118155 3300048913 Bacteria 2388
317 Ga0496110_0260500 3300048913 Bacteria 1578
318 Ga0496110_0981473 3300048913 Bacteria 752
319 Ga0496111_0420206 3300048914 Bacteria 988
320 Ga0496111_0498856 3300048914 Bacteria 896
321 Ga0496112_0015642 3300048915 Bacteria 7086
322 Ga0496112_0038155 3300048915 Bacteria 4691
323 Ga0496112_0058149 3300048915 Bacteria 3808
324 Ga0496112_0079992 3300048915 Bacteria 3232
325 Ga0496112_0141481 3300048915 Unclassified 2375
326 Ga0496112_0542934 3300048915 Bacteria 1097
327 Ga0496113_0015670 3300048916 Bacteria 5219
328 Ga0496114_0105403 3300048917 Bacteria 2411
329 Ga0496114_0464858 3300048917 Unclassified 1120
330 Ga0496115_0003135 3300048918 Bacteria 11887
331 Ga0496115_0102994 3300048918 Bacteria 2341
332 Ga0496115_0105674 3300048918 Bacteria 2311
333 Ga0496115_0116675 3300048918 Bacteria 2196
334 Ga0496115_0146157 3300048918 Bacteria 1951
335 Ga0496115_0665626 3300048918 Unclassified 821
336 Ga0501067_0290282 3300049583 Unclassified 911
337 Ga0501068_0360713 3300049584 Unclassified 935
338 nmdc:mga05p37_14789_c2 3300050507 Bacteria 6639
339 nmdc:mga05p37_155240_c1 3300050507 Unclassified 2797
340 nmdc:mga05p37_262147_c1 3300050507 Bacteria 2068
341 nmdc:mga0n895_1035719_c1 3300050512 Unclassified 800
342 nmdc:mga0n895_437421_c1 3300050512 Bacteria 1321
343 nmdc:mga0rr50_542139_c1 3300050513 Bacteria 990
344 nmdc:mga0a205_1131471_c1 3300050515 Unclassified 630
345 nmdc:mga0a205_787218_c1 3300050515 Bacteria 799
346 Ga0495601_0014831 3300053077 Bacteria 4703
347 Ga0495601_0321282 3300053077 Bacteria 1008
348 Ga0495612_0028180 3300053078 Bacteria 2261
349 Ga0495595_0235741 3300053084 Bacteria 915
350 Ga0495619_0117525 3300053085 Bacteria 1821
351 Ga0495619_0149124 3300053085 Bacteria 1613
352 Ga0065712_10002669
353 SwRhRL2b_contig_2624327
354 SwRhRL2b_contig_528231
355 2214866335
356 JGI25406J46586_10000001
357 JGI25406J46586_10098405
358 Ga0065704_10002559
359 Ga0065704_10042338
360 Ga0065704_10422804
361 Ga0065712_10002205
362 Ga0065712_10002881
363 Ga0065712_10010994
364 Ga0065715_10004718
365 Ga0065715_10007274
366 Ga0065715_10014879
367 Ga0065715_10138044
368 Ga0065715_10510396
369 Ga0065707_10036105
370 Ga0065707_10177689
371 Ga0070690_100052830
372 Ga0070689_100017242
373 Ga0070689_100043100
374 Ga0070687_100023917
375 Ga0070675_100308738
376 Ga0070671_100054173
377 Ga0070671_100084514
378 Ga0070688_100002299
379 Ga0070667_100019333
380 Ga0070703_10028313
381 Ga0070709_10628655
382 Ga0070713_100116452
383 Ga0070713_100130631
384 Ga0070711_100222571
385 Ga0070711_100229923
386 Ga0070705_100022560
387 Ga0070700_100021352
388 Ga0070708_100001887
389 Ga0070708_100059823
390 Ga0070708_100107782
391 Ga0070708_100169865
392 Ga0070708_100183142
393 Ga0070708_100304238
394 Ga0070662_100001372
395 Ga0070685_10023299
396 Ga0070706_100010507
397 Ga0070706_100011357
398 Ga0070706_100269278
399 Ga0070706_100631233
400 Ga0070706_100968670
401 Ga0070707_100007819
402 Ga0070707_100023996
403 Ga0070707_100062295
404 Ga0070707_100065564
405 Ga0070707_100079579
406 Ga0070707_100350343
407 Ga0070707_100703798
408 Ga0070698_100025074
409 Ga0070698_100036909
410 Ga0070698_100122128
411 Ga0070698_100126657
412 Ga0070698_100724060
413 Ga0070698_100837097
414 Ga0070699_100068349
415 Ga0070699_100918328
416 Ga0070684_100001523
417 Ga0070697_100001163
418 Ga0070697_100002323
419 Ga0070697_100009748
420 Ga0070697_100013326
421 Ga0070697_100036716
422 Ga0070697_100041468
423 Ga0070697_100139384
424 Ga0070697_100961652
425 Ga0070686_100080001
426 Ga0070695_100025252
427 Ga0070693_100056651
428 Ga0070665_100142887
429 Ga0070664_100226892
430 Ga0070702_100027531
431 Ga0068859_100012007
432 Ga0068864_100243194
433 Ga0068863_100009650
434 Ga0068863_100064786
435 Ga0068863_100197568
436 Ga0068858_100004649
437 Ga0068858_100252628
438 Ga0068860_100059681
439 Ga0068862_100029823
440 Ga0081455_10000281
441 Ga0081455_10056637
442 Ga0081539_10000014
443 Ga0081539_10005490
444 Ga0070717_10023656
445 Ga0070717_10051195
446 Ga0070717_10065949
447 Ga0070716_100047822
448 Ga0070716_100111905
449 Ga0070716_100211442
450 Ga0070716_100244871
451 Ga0070712_100022714
452 Ga0070712_100030702
453 Ga0070712_100149317
454 Ga0070712_100363328
455 Ga0070712_100555735
456 Ga0070712_100786471
457 Ga0068871_100227767
458 Ga0075434_100561619
459 Ga0075434_100609533
460 Ga0068865_100913251
461 Ga0097620_100012007
462 Ga0099794_10133743
463 Ga0105245_10123431
464 Ga0105247_10227051
465 Ga0114129_10003628
466 Ga0114129_10328193
467 Ga0105243_10082840
468 Ga0105243_10279489
469 Ga0105241_10247527
470 Ga0105248_10284736
471 Ga0105237_10063589
472 Ga0105249_10001939
473 Ga0105249_10056228
474 Ga0105249_10961932
475 Ga0105249_11342944
476 Ga0099796_10016179
477 Ga0099796_10051408
478 Ga0105239_10008184
479 Ga0105239_10163482
480 Ga0105239_10269871
481 Ga0105246_10025344
482 Ga0157370_10063050
483 Ga0157369_10026885
484 Ga0157374_10005031
485 Ga0157374_10035253
486 Ga0157374_10048201
487 Ga0157374_10081536
488 Ga0157374_10090191
489 Ga0157374_10099400
490 Ga0157374_10218791
491 Ga0157378_10108865
492 Ga0157378_10263357
493 Ga0157378_10447697
494 Ga0157378_10917205
495 Ga0163162_10017622
496 Ga0163162_10046371
497 Ga0157372_10132038
498 Ga0157372_10403865
499 Ga0157372_10592693
500 Ga0157375_10001983
501 Ga0157375_10109810
502 Ga0157375_10295592
503 Ga0163163_10088850
504 Ga0163163_10395745
505 Ga0157377_10052399
506 Ga0157377_10168828
507 Ga0157377_10524864
508 Ga0157379_10156528
509 Ga0157376_10021048
510 Ga0157376_10241904
511 Ga0207666_1041010
512 Ga0207673_1001777
513 Ga0207697_10000141
514 Ga0207697_10000555
515 Ga0207697_10132496
516 Ga0207653_10026666
517 Ga0207692_10678156
518 Ga0207710_10096968
519 Ga0207645_10001403
520 Ga0207684_10003481
521 Ga0207684_10004403
522 Ga0207684_10008163
523 Ga0207684_10026846
524 Ga0207684_10028698
525 Ga0207684_10055403
526 Ga0207684_10371872
527 Ga0207671_10338599
528 Ga0207693_10005679
529 Ga0207693_10036885
530 Ga0207693_10096344
531 Ga0207693_10271270
532 Ga0207693_10293472
533 Ga0207693_10301513
534 Ga0207663_10156881
535 Ga0207663_10267045
536 Ga0207662_10000732
537 Ga0207657_10028716
538 Ga0207649_10114886
539 Ga0207646_10000317
540 Ga0207646_10007978
541 Ga0207646_10021163
542 Ga0207646_10030946
543 Ga0207646_10086357
544 Ga0207646_10094498
545 Ga0207646_10198311
546 Ga0207646_10263315
547 Ga0207646_10265773
548 Ga0207681_10001792
549 Ga0207659_10001955
550 Ga0207687_10256879
551 Ga0207687_10259988
552 Ga0207700_10091041
553 Ga0207664_10007287
554 Ga0207664_10120191
555 Ga0207644_10038495
556 Ga0207690_10006433
557 Ga0207690_10045879
558 Ga0207706_10015703
559 Ga0207706_10216378
560 Ga0207670_10000380
561 Ga0207670_10240131
562 Ga0207665_10022352
563 Ga0207665_10050772
564 Ga0207665_10110250
565 Ga0207665_10164982
566 Ga0207689_10130101
567 Ga0207712_10029871
568 Ga0207712_11462325
569 Ga0207668_10053847
570 Ga0207658_10013918
571 Ga0207658_10207112
572 Ga0207658_10301202
573 Ga0207703_10035241
574 Ga0207708_10065963
575 Ga0207641_10485487
576 Ga0207641_10859444
577 Ga0207683_10030846
578 Ga0268265_10027139
579 Ga0268264_10027991
580 Ga0268264_10634008
581 Ga0265336_10091399
582 Ga0373953_0160010
583 Ga0373954_0113302
584 Ga0373957_0008348
585 Ga0373942_0131996
586 Ga0373924_0093963
587 Ga0373931_0232192
588 Ga0373935_0002468
589 Ga0373935_0030415
590 Ga0373933_0436551
591 Ga0373947_0315695
592 Ga0373937_0038066
593 Ga0373937_0318292
594 Ga0373937_0493890
595 Ga0373925_0122983
596 Ga0373925_0351366
597 Ga0395899_0042555
598 Ga0395900_1167167
599 Ga0395898_0003960
600 Ga0395898_0407559
601 Ga0395905_0333826
602 Ga0395905_0562443
603 Ga0395901_0005337
604 Ga0395901_0114211
605 Ga0395901_0321470
606 Ga0395901_1547944
607 Ga0451853_2269887
608 Ga0439455_0008591
609 Ga0439458_0003943
610 Ga0439458_0010716
611 Ga0439440_0004188
612 Ga0495592_0007988
613 Ga0495592_0280003
614 Ga0495603_0091731
615 Ga0495629_0116033
616 Ga0495651_0264778
617 Ga0495651_0458297
618 Ga0495653_0076503
619 Ga0495639_0049769
620 Ga0495664_0045046
621 Ga0495664_0101708
622 Ga0495608_0182859
623 Ga0495628_0011212
624 Ga0495630_0010624
625 Ga0495652_0012119
626 Ga0495652_0245630
627 Ga0495640_0190776
628 Ga0495586_0142987
629 Ga0495586_0498724
630 Ga0495645_0003075
631 Ga0495635_0120825
632 Ga0495635_0343012
633 Ga0495599_0005908
634 Ga0495623_0011497
635 Ga0495646_0010846
636 Ga0495658_0335383
637 Ga0495613_0601179
638 Ga0495624_0218508
639 Ga0495581_0131224
640 Ga0495581_0208177
641 Ga0495604_0135776
642 Ga0495604_0166574
643 Ga0495675_0012468
644 Ga0495684_0026656
645 Ga0495593_0237715
646 Ga0495602_0056715
647 Ga0496100_0757406
648 Ga0496101_0084984
649 Ga0496101_0251458
650 Ga0496102_0226838
651 Ga0496102_0335959
652 Ga0496102_0377709
653 Ga0496102_0458643
654 Ga0496104_0115131
655 Ga0496105_0049445
656 Ga0496105_0141688
657 Ga0496105_0168213
658 Ga0496105_1006717
659 Ga0496106_0087886
660 Ga0496107_0129325
661 Ga0496107_0517417
662 Ga0496108_0025877
663 Ga0496109_0002468
664 Ga0496109_0048940
665 Ga0496109_0384575
666 Ga0496109_0917735
667 Ga0496110_0118155
668 Ga0496110_0260500
669 Ga0496110_0981473
670 Ga0496111_0420206
671 Ga0496111_0498856
672 Ga0496112_0015642
673 Ga0496112_0038155
674 Ga0496112_0058149
675 Ga0496112_0079992
676 Ga0496112_0141481
677 Ga0496112_0542934
678 Ga0496113_0015670
679 Ga0496114_0105403
680 Ga0496114_0464858
681 Ga0496115_0003135
682 Ga0496115_0102994
683 Ga0496115_0105674
684 Ga0496115_0116675
685 Ga0496115_0146157
686 Ga0496115_0665626
687 Ga0501067_0290282
688 Ga0501068_0360713
689 nmdc:mga05p37_14789_c2
690 nmdc:mga05p37_155240_c1
691 nmdc:mga05p37_262147_c1
692 nmdc:mga0n895_1035719_c1
693 nmdc:mga0n895_437421_c1
694 nmdc:mga0rr50_542139_c1
695 nmdc:mga0a205_1131471_c1
696 nmdc:mga0a205_787218_c1
697 Ga0495601_0014831
698 Ga0495601_0321282
699 Ga0495612_0028180
700 Ga0495595_0235741
701 Ga0495619_0117525
702 Ga0495619_0149124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

33

203

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5im6-assembly1.cif.gz_A crystal structure of designed two-component self-assembling icosahedral cage i32-28 0.9426 25 174
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9287 25 174
5cy5-assembly1.cif.gz_B crystal structure of the t33-51h designed self-assembling protein tetrahedron 0.9201 25 174
8g3k-assembly1.cif.gz_A cryo-em imaging scaffold subunits a and b used to display kras g12c complex with gdp 0.9194 25 174
1wy1-assembly1.cif.gz_C crystal structure of the ph0671 protein from pyrococcus horikoshii ot3 0.9161 25 175
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9362 13 174 1.20.1200.10
5cy5B00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9201 25 174 1.20.1200.10
2ah6A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.91 25 173 1.20.1200.10
4nwpB00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9034 23 174 1.20.1200.10
2r6xB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.902 13 174 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A2V6K5D8-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 1.001 32 174 GO:0005524
GO:0008817
GO:0009236
AF-A0A2V5LT20-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9789 85 174 GO:0005524
GO:0008817
GO:0009236
AF-A0A2V6F810-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9566 1 174 GO:0005524
GO:0008817
GO:0009236
AF-A0A7Y9T3M3-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9544 27 174 GO:0005524
GO:0008817
GO:0009236
AF-A0A3D2YUG6-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.951 20 172 GO:0005524
GO:0008817
GO:0009236

Map