F418446

General Info

Members Datasets Scaffolds Average Seq Length
350 244 330 148

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606384|2808970776
Length 164
Sequence IHAAPVDDERTGNSSNGASVLRPILLVEDNPDDIELTLIALEKTRLANPVVSVRDGEEALDFLRRQGKWAERVDQNPAVILLDKKLPKIDGHEVLKSVRADESLRHIPVVMLTSSREEKDLLRSYDLGVNAYVVKPVAFDDFMAAINDLGMFWAVLNEPPPYQR

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
4 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
5 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
6 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
7 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
8 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
9 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
10 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
11 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
12 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
13 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
14 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
15 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
16 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
17 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
18 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
35 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
36 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
39 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.29
Metatranscriptomes 0
Isolates 5.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.14
Nodule 1.43
Rhizoplane 5.43
Rhizosphere 68.86
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10164762 3300002067 Bacteria 640
2 JGI25156J39149_1000202 3300002705 Bacteria 41101
3 JGI25156J39149_1000439 3300002705 Bacteria 25558
4 JGI25151J46595_10000055 3300003187 Bacteria 152655
5 JGI25151J46595_10000469 3300003187 Bacteria 38425
6 JGI25151J46595_10003517 3300003187 Bacteria 8623
7 JGI25165J46597_1001651 3300003214 Bacteria 10289
8 rootH2_10018765 3300003320 Bacteria 24216
9 rootL2_10049672 3300003322 Bacteria 5155
10 rootH1_10053990 3300003323 Bacteria 4467
11 JGI25160J50197_1000036 3300003354 Bacteria 166820
12 Ga0055533_1000139 3300003756 Bacteria 76866
13 Ga0055532_1000003 3300003758 Bacteria 494004
14 Ga0055525_1004250 3300003759 Bacteria 1238
15 Ga0055527_1000006 3300003760 Bacteria 494004
16 Ga0055535_1000003 3300003761 Bacteria 494004
17 Ga0055542_1000007 3300003762 Bacteria 494004
18 Ga0055529_1000003 3300003763 Bacteria 494004
19 Ga0055526_1001191 3300003771 Bacteria 18835
20 Ga0055526_1001806 3300003771 Bacteria 14822
21 Ga0055526_1031704 3300003771 Bacteria 1508
22 Ga0055537_1000518 3300003773 Bacteria 22738
23 Ga0055537_1011789 3300003773 Bacteria 1748
24 Ga0055524_1000784 3300003775 Bacteria 21254
25 Ga0055524_1011953 3300003775 Bacteria 3359
26 Ga0055536_1002043 3300003781 Bacteria 11555
27 Ga0055534_1000029 3300003784 Bacteria 123436
28 Ga0055534_1000438 3300003784 Bacteria 24605
29 Ga0065165_1000686 3300005262 Bacteria 48410
30 Ga0070680_100000360 3300005336 Bacteria 30651
31 Ga0070682_100316856 3300005337 Bacteria 1150
32 Ga0070660_100000463 3300005339 Bacteria 26996
33 Ga0070661_100000011 3300005344 Bacteria 175355
34 Ga0070668_100004635 3300005347 Bacteria 10182
35 Ga0070669_100246461 3300005353 Bacteria 1421
36 Ga0070667_100003206 3300005367 Bacteria 14012
37 Ga0070709_11065811 3300005434 Bacteria 645
38 Ga0070713_100436175 3300005436 Bacteria 1228
39 Ga0070711_100527462 3300005439 Bacteria 977
40 Ga0070705_100336593 3300005440 Bacteria 1095
41 Ga0070705_100534572 3300005440 Bacteria 896
42 Ga0070694_101276569 3300005444 Bacteria 617
43 Ga0070708_100005751 3300005445 Bacteria 9837
44 Ga0070708_100021008 3300005445 Bacteria 5512
45 Ga0070708_100037368 3300005445 Bacteria 4236
46 Ga0070708_100818031 3300005445 Bacteria 876
47 Ga0070708_101435681 3300005445 Bacteria 643
48 Ga0070663_100227839 3300005455 Bacteria 1466
49 Ga0070681_10129908 3300005458 Bacteria 2451
50 Ga0070685_10085162 3300005466 Bacteria 1903
51 Ga0070706_100091848 3300005467 Unclassified 2816
52 Ga0070707_100003042 3300005468 Bacteria 15899
53 Ga0070707_100214819 3300005468 Unclassified 1874
54 Ga0070698_100043896 3300005471 Unclassified 4581
55 Ga0070698_100314582 3300005471 Unclassified 1496
56 Ga0070698_101342325 3300005471 Bacteria 665
57 Ga0070699_100053916 3300005518 Bacteria 3480
58 Ga0070699_100186228 3300005518 Bacteria 1843
59 Ga0070679_100000008 3300005530 Bacteria 194672
60 Ga0070697_100072195 3300005536 Unclassified 2832
61 Ga0070697_100147436 3300005536 Bacteria 1982
62 Ga0070697_100223935 3300005536 Bacteria 1603
63 Ga0070695_100017197 3300005545 Bacteria 4384
64 Ga0070695_100091284 3300005545 Bacteria 2034
65 Ga0070696_100108259 3300005546 Bacteria 1999
66 Ga0070696_100296985 3300005546 Bacteria 1236
67 Ga0070696_101000017 3300005546 Bacteria 699
68 Ga0070665_100001069 3300005548 Bacteria 34148
69 Ga0070665_101145138 3300005548 Bacteria 789
70 Ga0068856_100575048 3300005614 Bacteria 1148
71 Ga0068859_100344234 3300005617 Bacteria 1585
72 Ga0068860_100903370 3300005843 Bacteria 899
73 Ga0068862_100011779 3300005844 Bacteria 7219
74 Ga0075433_10021335 3300006852 Bacteria 5431
75 Ga0075433_10074419 3300006852 Bacteria 2989
76 Ga0075433_10780632 3300006852 Bacteria 835
77 Ga0075434_100041466 3300006871 Bacteria 4560
78 Ga0075434_100160376 3300006871 Bacteria 2269
79 Ga0075434_100313074 3300006871 Bacteria 1590
80 Ga0075434_100956047 3300006871 Bacteria 871
81 Ga0075434_101282605 3300006871 Bacteria 743
82 Ga0075436_100076468 3300006914 Bacteria 2318
83 Ga0097620_100344237 3300006931 Bacteria 1585
84 Ga0075435_100248908 3300007076 Bacteria 1513
85 Ga0075435_100505615 3300007076 Bacteria 1045
86 Ga0105250_10215941 3300009092 Bacteria 812
87 Ga0105240_10002534 3300009093 Bacteria 29308
88 Ga0105240_10127277 3300009093 Bacteria 3059
89 Ga0105240_10502982 3300009093 Bacteria 1347
90 Ga0105247_10725436 3300009101 Bacteria 751
91 Ga0114129_10105858 3300009147 Bacteria 3886
92 Ga0114129_10117783 3300009147 Bacteria 3659
93 Ga0114129_11435867 3300009147 Bacteria 850
94 Ga0105242_12040268 3300009176 Bacteria 616
95 Ga0105248_10014633 3300009177 Bacteria 8632
96 Ga0105237_11355461 3300009545 Bacteria 718
97 Ga0105238_10125674 3300009551 Bacteria 2543
98 Ga0105238_11100276 3300009551 Bacteria 817
99 Ga0105249_10174317 3300009553 Bacteria 2088
100 Ga0105249_10356825 3300009553 Bacteria 1482
101 Ga0105249_10438126 3300009553 Bacteria 1344
102 Ga0105239_10000156 3300010375 Bacteria 98400
103 Ga0105239_10733125 3300010375 Bacteria 1131
104 Ga0157369_10062274 3300013105 Bacteria 4021
105 Ga0157369_10116557 3300013105 Bacteria 2836
106 Ga0183361_10021 3300016635 Bacteria 114065
107 Ga0209674_100025 3300025226 Bacteria 515942
108 Ga0209672_100002 3300025228 Bacteria 1733325
109 Ga0209147_100003 3300025229 Bacteria 1733325
110 Ga0209563_101308 3300025230 Bacteria 6796
111 Ga0207427_101488 3300025231 Bacteria 8357
112 Ga0209258_100005 3300025242 Bacteria 1087938
113 Ga0209646_1014752 3300025246 Bacteria 1173
114 Ga0209148_1000006 3300025254 Bacteria 1733325
115 Ga0209759_1000014 3300025256 Bacteria 396291
116 Ga0209759_1000250 3300025256 Bacteria 80232
117 Ga0209233_1000018 3300025261 Bacteria 886857
118 Ga0209565_1000095 3300025263 Bacteria 134566
119 Ga0209565_1005021 3300025263 Bacteria 3918
120 Ga0209455_1000003 3300025272 Bacteria 1471893
121 Ga0209673_1034746 3300025273 Bacteria 1518
122 Ga0209130_1006005 3300025284 Bacteria 4044
123 Ga0209130_1010471 3300025284 Bacteria 2550
124 Ga0209675_1000050 3300025291 Bacteria 212222
125 Ga0209675_1000067 3300025291 Bacteria 171840
126 Ga0209675_1003571 3300025291 Bacteria 7317
127 Ga0209676_1000053 3300025292 Bacteria 370111
128 Ga0209025_1000059 3300025294 Bacteria 305480
129 Ga0209025_1000093 3300025294 Bacteria 241788
130 Ga0209025_1002027 3300025294 Bacteria 23125
131 Ga0209564_1000158 3300025295 Bacteria 164425
132 Ga0209564_1000224 3300025295 Bacteria 126345
133 Ga0209564_1000645 3300025295 Bacteria 52727
134 Ga0209758_1007523 3300025297 Bacteria 7380
135 Ga0209256_1000086 3300025299 Bacteria 218837
136 Ga0209256_1000985 3300025299 Bacteria 34104
137 Ga0207426_1000014 3300025302 Bacteria 649413
138 Ga0209051_1005375 3300025303 Bacteria 7512
139 Ga0207710_10174369 3300025900 Bacteria 1052
140 Ga0207647_10004326 3300025904 Bacteria 10528
141 Ga0207699_10804862 3300025906 Bacteria 691
142 Ga0207684_10018524 3300025910 Bacteria 5960
143 Ga0207684_10049803 3300025910 Bacteria 3553
144 Ga0207684_10395409 3300025910 Unclassified 1188
145 Ga0207707_10069637 3300025912 Bacteria 3066
146 Ga0207695_10000521 3300025913 Bacteria 81496
147 Ga0207695_10386926 3300025913 Bacteria 1284
148 Ga0207695_10434522 3300025913 Bacteria 1196
149 Ga0207671_11144012 3300025914 Bacteria 610
150 Ga0207660_10001011 3300025917 Bacteria 18633
151 Ga0207657_10024282 3300025919 Bacteria 5620
152 Ga0207649_10000038 3300025920 Bacteria 129260
153 Ga0207652_10000008 3300025921 Bacteria 286698
154 Ga0207652_11123531 3300025921 Bacteria 687
155 Ga0207646_10015088 3300025922 Bacteria 7310
156 Ga0207646_10214579 3300025922 Unclassified 1738
157 Ga0207694_10209436 3300025924 Bacteria 1588
158 Ga0207700_10317103 3300025928 Bacteria 1350
159 Ga0207709_10410351 3300025935 Bacteria 1038
160 Ga0207711_10030840 3300025941 Bacteria 4523
161 Ga0207712_10079254 3300025961 Bacteria 2385
162 Ga0207712_10139768 3300025961 Bacteria 1857
163 Ga0207668_10000018 3300025972 Bacteria 158577
164 Ga0207640_10175637 3300025981 Bacteria 1601
165 Ga0207658_10003900 3300025986 Bacteria 10491
166 Ga0207678_10531882 3300026067 Bacteria 1027
167 Ga0207648_10623402 3300026089 Bacteria 995
168 Ga0209371_1013065 3300027312 Bacteria 2360
169 Ga0268266_10002757 3300028379 Bacteria 18364
170 Ga0268266_10645634 3300028379 Bacteria 1018
171 Ga0268265_10008276 3300028380 Bacteria 7026
172 Ga0268264_10869388 3300028381 Bacteria 904
173 Ga0265336_10013275 3300028666 Bacteria 2749
174 Ga0268256_1014325 3300030500 Bacteria 2360
175 Ga0265330_10194573 3300031235 Bacteria 858
176 Ga0265325_10025458 3300031241 Bacteria 3213
177 Ga0265340_10078526 3300031247 Unclassified 1556
178 Ga0265331_10048752 3300031250 Bacteria 2035
179 Ga0265327_10052964 3300031251 Bacteria 2109
180 Ga0265316_10095623 3300031344 Bacteria 2262
181 Ga0307408_100058794 3300031548 Bacteria 2796
182 Ga0265313_10034082 3300031595 Bacteria 2579
183 Ga0265314_10342344 3300031711 Unclassified 825
184 Ga0265342_10107181 3300031712 Bacteria 1585
185 Ga0307409_100713449 3300031995 Bacteria 1003
186 Ga0307416_100051129 3300032002 Bacteria 3299
187 Ga0307411_10721320 3300032005 Bacteria 870
188 Ga0395899_0009160 3300037312 Bacteria 7604
189 Ga0395905_0000009 3300037471 Bacteria 488729
190 Ga0436363_1164496 3300039450 Unclassified 989
191 Ga0451807_1287531 3300041486 Bacteria 1028
192 Ga0439458_0062835 3300042157 Unclassified 929
193 Ga0439435_0364172 3300042436 Unclassified 504
194 Ga0451577_0041316 3300042876 Bacteria 4139
195 Ga0451577_0349483 3300042876 Bacteria 1341
196 Ga0453683_0135108 3300044673 Bacteria 1555
197 Ga0466961_0679963 3300044693 Bacteria 617
198 Ga0453684_0000287 3300044712 Bacteria 216926
199 Ga0453684_0510642 3300044712 Bacteria 1329
200 Ga0466957_1105210 3300044842 Bacteria 572
201 Ga0451576_0007456 3300045051 Bacteria 13062
202 Ga0466958_0000236 3300045836 Bacteria 21167
203 Ga0495592_0089045 3300046454 Bacteria 2217
204 Ga0495603_0037926 3300046455 Bacteria 2891
205 Ga0495629_0009252 3300046459 Bacteria 7207
206 Ga0495638_0001947 3300046460 Bacteria 17708
207 Ga0495651_0022252 3300046462 Bacteria 4928
208 Ga0495651_0349370 3300046462 Bacteria 978
209 Ga0495653_0043913 3300046463 Bacteria 3471
210 Ga0495653_0054531 3300046463 Bacteria 3054
211 Ga0495580_0000760 3300046472 Bacteria 27683
212 Ga0495580_0011511 3300046472 Bacteria 6843
213 Ga0495580_0024046 3300046472 Bacteria 4465
214 Ga0495580_0089278 3300046472 Bacteria 2146
215 Ga0495582_0004286 3300046473 Bacteria 8023
216 Ga0495605_0007204 3300046474 Bacteria 6326
217 Ga0495662_0072930 3300046476 Bacteria 1665
218 Ga0495664_0037724 3300046477 Bacteria 2852
219 Ga0495584_0093133 3300046491 Bacteria 1520
220 Ga0495596_0020226 3300046500 Bacteria 2727
221 Ga0495583_0011154 3300046506 Bacteria 5178
222 Ga0495606_0343958 3300046507 Bacteria 794
223 Ga0495608_0004848 3300046511 Bacteria 9617
224 Ga0495616_0009174 3300046513 Bacteria 5804
225 Ga0495628_0054390 3300046516 Bacteria 3156
226 Ga0495628_0173947 3300046516 Bacteria 1631
227 Ga0495630_0072443 3300046517 Bacteria 2593
228 Ga0495648_0030089 3300046524 Bacteria 3596
229 Ga0495666_0014504 3300046526 Bacteria 3924
230 Ga0495666_0048695 3300046526 Bacteria 2040
231 Ga0495652_0532093 3300046529 Bacteria 810
232 Ga0495665_0070602 3300046531 Bacteria 1840
233 Ga0495640_0087226 3300046533 Bacteria 2064
234 Ga0495586_0024631 3300046535 Bacteria 3219
235 Ga0495586_0242490 3300046535 Bacteria 1027
236 Ga0495597_0131032 3300046542 Bacteria 1040
237 Ga0495645_0413191 3300046543 Bacteria 858
238 Ga0495667_0144877 3300046559 Bacteria 1530
239 Ga0495634_0031196 3300046642 Bacteria 3672
240 Ga0495625_0515347 3300046660 Bacteria 729
241 Ga0495635_0001485 3300046663 Bacteria 15686
242 Ga0495657_0337241 3300046675 Bacteria 894
243 Ga0495599_0008580 3300046678 Bacteria 6221
244 Ga0495599_0734412 3300046678 Bacteria 567
245 Ga0495646_0132437 3300046680 Bacteria 1402
246 Ga0495646_0144039 3300046680 Bacteria 1330
247 Ga0495613_0581124 3300046689 Bacteria 747
248 Ga0495624_0004455 3300046690 Bacteria 10244
249 Ga0495624_0183433 3300046690 Bacteria 1274
250 Ga0495624_0662638 3300046690 Bacteria 620
251 Ga0495589_0079387 3300046794 Bacteria 1597
252 Ga0495600_0049549 3300046809 Bacteria 2740
253 Ga0495600_0415256 3300046809 Bacteria 836
254 Ga0495660_0001646 3300046810 Bacteria 14975
255 Ga0495581_0003242 3300047315 Bacteria 9325
256 Ga0495604_0108282 3300047317 Bacteria 2030
257 Ga0495604_0136569 3300047317 Bacteria 1756
258 Ga0495604_0637587 3300047317 Bacteria 681
259 Ga0495674_0002885 3300047319 Bacteria 16727
260 Ga0495674_0062533 3300047319 Bacteria 3240
261 Ga0495672_0054555 3300047320 Bacteria 2335
262 Ga0495683_0007050 3300047323 Bacteria 6098
263 Ga0495683_0088346 3300047323 Bacteria 1504
264 Ga0495687_007576 3300047443 Bacteria 6367
265 Ga0495687_078251 3300047443 Bacteria 1303
266 Ga0495675_0022869 3300047444 Bacteria 3985
267 Ga0495675_0505936 3300047444 Bacteria 693
268 Ga0495673_0071358 3300047469 Bacteria 1460
269 Ga0495684_0011372 3300047471 Bacteria 6872
270 Ga0495684_0263887 3300047471 Bacteria 1248
271 Ga0495686_0091102 3300047472 Bacteria 1851
272 Ga0495602_0055359 3300048088 Bacteria 3493
273 Ga0495602_0176635 3300048088 Bacteria 1651
274 Ga0495602_0178691 3300048088 Bacteria 1639
275 Ga0495614_0025701 3300048089 Bacteria 2539
276 Ga0496100_0000124 3300048903 Bacteria 43738
277 Ga0496100_0003586 3300048903 Bacteria 8112
278 Ga0496101_0000147 3300048904 Bacteria 60811
279 Ga0496101_0068687 3300048904 Bacteria 2591
280 Ga0496102_0000057 3300048905 Bacteria 171634
281 Ga0496102_0004284 3300048905 Bacteria 12061
282 Ga0496103_0000142 3300048906 Bacteria 75004
283 Ga0496103_0253104 3300048906 Bacteria 1133
284 Ga0496104_0056347 3300048907 Bacteria 3716
285 Ga0496104_0164371 3300048907 Bacteria 2128
286 Ga0496105_0515041 3300048908 Bacteria 937
287 Ga0496106_0093534 3300048909 Bacteria 2323
288 Ga0496107_0171939 3300048910 Bacteria 1608
289 Ga0496107_0906252 3300048910 Bacteria 642
290 Ga0496110_0461322 3300048913 Bacteria 1158
291 Ga0496112_0032289 3300048915 Bacteria 5083
292 Ga0496112_0316209 3300048915 Bacteria 1506
293 Ga0496113_0155680 3300048916 Bacteria 1804
294 Ga0496116_0039246 3300048919 Bacteria 3275
295 Ga0496117_0000118 3300048920 Bacteria 173803
296 Ga0496117_0002473 3300048920 Bacteria 23206
297 Ga0496118_0000068 3300048921 Bacteria 204242
298 Ga0496118_0000126 3300048921 Bacteria 135644
299 Ga0496118_0295215 3300048921 Bacteria 893
300 Ga0496119_0043261 3300048922 Bacteria 2848
301 Ga0496121_0002363 3300048924 Bacteria 29039
302 Ga0496121_0003526 3300048924 Bacteria 22204
303 Ga0496121_0010620 3300048924 Bacteria 10343
304 Ga0496121_0057994 3300048924 Bacteria 3205
305 Ga0496122_0281022 3300048925 Bacteria 910
306 Ga0496125_0140661 3300048928 Bacteria 1679
307 Ga0496125_0432262 3300048928 Bacteria 759
308 Ga0496126_0001253 3300048929 Bacteria 41064
309 Ga0496126_0049344 3300048929 Bacteria 3843
310 Ga0496126_0099034 3300048929 Bacteria 2554
311 Ga0495682_0123541 3300049460 Bacteria 926
312 Ga0501038_1094896 3300049574 Unclassified 582
313 Ga0501041_0372981 3300049577 Bacteria 903
314 Ga0501046_0003530 3300049580 Bacteria 14319
315 Ga0501047_0003953 3300049581 Bacteria 13937
316 Ga0501035_0004424 3300049822 Bacteria 13339
317 nmdc:mga05p37_184819_c1 3300050507 Bacteria 2534
318 nmdc:mga0n895_373309_c1 3300050512 Unclassified 1444
319 nmdc:mga0n895_661012_c1 3300050512 Bacteria 1043
320 nmdc:mga0n895_79897_c1 3300050512 Bacteria 3257
321 nmdc:mga0n895_984841_c1 3300050512 Bacteria 825
322 nmdc:mga0rr50_1565043_c1 3300050513 Unclassified 557
323 nmdc:mga0rr50_536919_c1 3300050513 Bacteria 995
324 nmdc:mga0rr50_595338_c1 3300050513 Bacteria 942
325 nmdc:mga08x19_206153_c1 3300050514 Bacteria 1349
326 nmdc:mga08x19_25408_c1 3300050514 Bacteria 3689
327 nmdc:mga0a205_11198_c3 3300050515 Bacteria 5890
328 nmdc:mga0a205_401055_c1 3300050515 Bacteria 1235
329 nmdc:mga0a205_48675_c1 3300050515 Unclassified 4092
330 Ga0500568_0002237 3300053139 Bacteria 11592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005440 Ga0070705_100534572 Ga0070705_1005345722 134
2 3300005545 Ga0070695_100091284 Ga0070695_1000912841 134
3 3300005546 Ga0070696_101000017 Ga0070696_1010000171 134
4 iso_pu_bacteria 2904434214 2904435991 134
5 3300005468 Ga0070707_100214819 Ga0070707_1002148192 136
6 3300025922 Ga0207646_10214579 Ga0207646_102145792 136
7 3300009093 Ga0105240_10127277 Ga0105240_101272773 137
8 3300009551 Ga0105238_11100276 Ga0105238_111002762 137
9 3300042436 Ga0439435_0364172 Ga0439435_0364172_19_447 137
10 3300047472 Ga0495686_0091102 Ga0495686_0091102_659_1075 138
11 3300037471 Ga0395905_0000009 Ga0395905_0000009_270519_270938 139
12 3300044842 Ga0466957_1105210 Ga0466957_1105210_112_531 139
13 3300047317 Ga0495604_0637587 Ga0495604_0637587_231_653 140
14 3300048929 Ga0496126_0049344 Ga0496126_0049344_1705_2127 140
15 3300049574 Ga0501038_1094896 Ga0501038_1094896_87_527 140
16 3300049580 Ga0501046_0003530 Ga0501046_0003530_9477_9917 140
17 3300049581 Ga0501047_0003953 Ga0501047_0003953_6526_6966 140
18 3300049822 Ga0501035_0004424 Ga0501035_0004424_1790_2230 140
19 iso_pu_bacteria 2513237166 2514048455 140
20 iso_pu_bacteria 2562617112 2563057629 140
21 iso_pu_bacteria 2687453341 2688391789 140
22 iso_pu_bacteria 2711768613 2713473673 140
23 3300005353 Ga0070669_100246461 Ga0070669_1002464612 141
24 3300005440 Ga0070705_100336593 Ga0070705_1003365932 141
25 3300005444 Ga0070694_101276569 Ga0070694_1012765691 141
26 3300005445 Ga0070708_100005751 Ga0070708_1000057515 141
27 3300005445 Ga0070708_100021008 Ga0070708_1000210084 141
28 3300005445 Ga0070708_100818031 Ga0070708_1008180312 141
29 3300005467 Ga0070706_100091848 Ga0070706_1000918482 141
30 3300005468 Ga0070707_100003042 Ga0070707_1000030429 141
31 3300005471 Ga0070698_100043896 Ga0070698_1000438962 141
32 3300005471 Ga0070698_100314582 Ga0070698_1003145822 141
33 3300005471 Ga0070698_101342325 Ga0070698_1013423251 141
34 3300005518 Ga0070699_100053916 Ga0070699_1000539161 141
35 3300005518 Ga0070699_100186228 Ga0070699_1001862284 141
36 3300005536 Ga0070697_100072195 Ga0070697_1000721953 141
37 3300005536 Ga0070697_100223935 Ga0070697_1002239351 141
38 3300006871 Ga0075434_100313074 Ga0075434_1003130742 141
39 3300007076 Ga0075435_100248908 Ga0075435_1002489082 141
40 3300007076 Ga0075435_100505615 Ga0075435_1005056152 141
41 3300009147 Ga0114129_11435867 Ga0114129_114358672 141
42 3300009553 Ga0105249_10438126 Ga0105249_104381262 141
43 3300025910 Ga0207684_10018524 Ga0207684_100185242 141
44 3300025910 Ga0207684_10049803 Ga0207684_100498032 141
45 3300025910 Ga0207684_10395409 Ga0207684_103954091 141
46 3300025922 Ga0207646_10015088 Ga0207646_100150884 141
47 3300025935 Ga0207709_10410351 Ga0207709_104103512 141
48 3300025961 Ga0207712_10139768 Ga0207712_101397682 141
49 3300041486 Ga0451807_1287531 Ga0451807_1287531_363_806 141
50 3300042157 Ga0439458_0062835 Ga0439458_0062835_331_786 141
51 3300042876 Ga0451577_0041316 Ga0451577_0041316_2401_2847 141
52 3300042876 Ga0451577_0349483 Ga0451577_0349483_536_991 141
53 3300044673 Ga0453683_0135108 Ga0453683_0135108_1054_1509 141
54 3300044712 Ga0453684_0000287 Ga0453684_0000287_160428_160874 141
55 3300044712 Ga0453684_0510642 Ga0453684_0510642_464_919 141
56 3300049577 Ga0501041_0372981 Ga0501041_0372981_200_652 141
57 3300050512 nmdc:mga0n895_79897_c1 nmdc:mga0n895_79897_c1_1068_1514 141
58 3300050513 nmdc:mga0rr50_1565043_c1 nmdc:mga0rr50_1565043_c1_88_543 141
59 3300050513 nmdc:mga0rr50_536919_c1 nmdc:mga0rr50_536919_c1_356_811 141
60 3300050513 nmdc:mga0rr50_595338_c1 nmdc:mga0rr50_595338_c1_277_723 141
61 3300050514 nmdc:mga08x19_206153_c1 nmdc:mga08x19_206153_c1_75_521 141
62 iso_pu_bacteria 2508501125 2509128201 141
63 iso_pu_bacteria 2842324504 2842325605 141
64 iso_pu_bacteria 2842348783 2842349884 141
65 iso_pu_bacteria 2842454564 2842454887 141
66 iso_pu_bacteria 2856287931 2856288559 141
67 iso_pu_bacteria 2857357740 2857367013 141
68 iso_pu_bacteria 2904434214 2904435978 141
69 iso_pu_bacteria 2904483920 2904486989 141
70 iso_pu_bacteria 2919527303 2919528304 141
71 3300009176 Ga0105242_12040268 Ga0105242_120402682 143
72 3300009553 Ga0105249_10174317 Ga0105249_101743172 143
73 iso_pu_bacteria 2524023250 2524612699 143
74 3300003354 JGI25160J50197_1000036 JGI25160J50197_100003681 144
75 3300005262 Ga0065165_1000686 Ga0065165_100068633 144
76 3300005455 Ga0070663_100227839 Ga0070663_1002278392 144
77 3300009092 Ga0105250_10215941 Ga0105250_102159412 144
78 3300025284 Ga0209130_1006005 Ga0209130_10060053 144
79 3300025302 Ga0207426_1000014 Ga0207426_1000014360 144
80 3300026067 Ga0207678_10531882 Ga0207678_105318822 144
81 3300031251 Ga0265327_10052964 Ga0265327_100529642 144
82 3300031548 Ga0307408_100058794 Ga0307408_1000587942 144
83 3300031995 Ga0307409_100713449 Ga0307409_1007134491 144
84 3300032002 Ga0307416_100051129 Ga0307416_1000511292 144
85 3300032005 Ga0307411_10721320 Ga0307411_107213202 144
86 3300046455 Ga0495603_0037926 Ga0495603_0037926_962_1396 144
87 3300046472 Ga0495580_0011511 Ga0495580_0011511_4119_4553 144
88 3300046472 Ga0495580_0024046 Ga0495580_0024046_2094_2528 144
89 3300046474 Ga0495605_0007204 Ga0495605_0007204_5309_5743 144
90 3300046491 Ga0495584_0093133 Ga0495584_0093133_339_773 144
91 3300046506 Ga0495583_0011154 Ga0495583_0011154_2546_2980 144
92 3300046513 Ga0495616_0009174 Ga0495616_0009174_3329_3763 144
93 3300046524 Ga0495648_0030089 Ga0495648_0030089_2074_2508 144
94 3300046535 Ga0495586_0242490 Ga0495586_0242490_128_562 144
95 3300046542 Ga0495597_0131032 Ga0495597_0131032_114_548 144
96 3300046660 Ga0495625_0515347 Ga0495625_0515347_116_550 144
97 3300047319 Ga0495674_0002885 Ga0495674_0002885_14789_15223 144
98 3300047320 Ga0495672_0054555 Ga0495672_0054555_820_1254 144
99 3300047323 Ga0495683_0088346 Ga0495683_0088346_382_816 144
100 3300047443 Ga0495687_007576 Ga0495687_007576_3851_4285 144
101 3300047469 Ga0495673_0071358 Ga0495673_0071358_794_1228 144
102 3300048903 Ga0496100_0000124 Ga0496100_0000124_19767_20201 144
103 3300048903 Ga0496100_0003586 Ga0496100_0003586_6708_7142 144
104 3300048904 Ga0496101_0000147 Ga0496101_0000147_15868_16302 144
105 3300048904 Ga0496101_0068687 Ga0496101_0068687_2048_2482 144
106 3300048905 Ga0496102_0000057 Ga0496102_0000057_72129_72563 144
107 3300048906 Ga0496103_0000142 Ga0496103_0000142_55584_56018 144
108 3300048906 Ga0496103_0253104 Ga0496103_0253104_559_993 144
109 3300048907 Ga0496104_0056347 Ga0496104_0056347_2894_3328 144
110 3300048907 Ga0496104_0164371 Ga0496104_0164371_385_819 144
111 3300048908 Ga0496105_0515041 Ga0496105_0515041_423_857 144
112 3300048909 Ga0496106_0093534 Ga0496106_0093534_661_1095 144
113 3300048910 Ga0496107_0171939 Ga0496107_0171939_1098_1532 144
114 3300048910 Ga0496107_0906252 Ga0496107_0906252_80_514 144
115 3300048913 Ga0496110_0461322 Ga0496110_0461322_481_915 144
116 3300048915 Ga0496112_0032289 Ga0496112_0032289_2054_2488 144
117 3300048915 Ga0496112_0316209 Ga0496112_0316209_318_752 144
118 3300048916 Ga0496113_0155680 Ga0496113_0155680_407_841 144
119 3300048920 Ga0496117_0000118 Ga0496117_0000118_72638_73072 144
120 3300048921 Ga0496118_0000068 Ga0496118_0000068_72110_72544 144
121 3300048922 Ga0496119_0043261 Ga0496119_0043261_1997_2431 144
122 3300048924 Ga0496121_0002363 Ga0496121_0002363_27346_27780 144
123 3300048924 Ga0496121_0003526 Ga0496121_0003526_11280_11714 144
124 3300048928 Ga0496125_0140661 Ga0496125_0140661_655_1089 144
125 3300048929 Ga0496126_0099034 Ga0496126_0099034_116_550 144
126 3300049460 Ga0495682_0123541 Ga0495682_0123541_117_551 144
127 3300002067 JGI24735J21928_10164762 JGI24735J21928_101647621 145
128 3300002705 JGI25156J39149_1000202 JGI25156J39149_100020220 145
129 3300002705 JGI25156J39149_1000439 JGI25156J39149_100043916 145
130 3300003187 JGI25151J46595_10000055 JGI25151J46595_10000055127 145
131 3300003187 JGI25151J46595_10000469 JGI25151J46595_1000046917 145
132 3300003187 JGI25151J46595_10003517 JGI25151J46595_100035177 145
133 3300003214 JGI25165J46597_1001651 JGI25165J46597_10016518 145
134 3300003320 rootH2_10018765 rootH2_100187654 145
135 3300003322 rootL2_10049672 rootL2_100496727 145
136 3300003323 rootH1_10053990 rootH1_100539902 145
137 3300003756 Ga0055533_1000139 Ga0055533_100013959 145
138 3300003758 Ga0055532_1000003 Ga0055532_1000003314 145
139 3300003759 Ga0055525_1004250 Ga0055525_10042502 145
140 3300003760 Ga0055527_1000006 Ga0055527_1000006143 145
141 3300003761 Ga0055535_1000003 Ga0055535_1000003314 145
142 3300003762 Ga0055542_1000007 Ga0055542_1000007314 145
143 3300003763 Ga0055529_1000003 Ga0055529_1000003143 145
144 3300003771 Ga0055526_1001191 Ga0055526_100119110 145
145 3300003771 Ga0055526_1001806 Ga0055526_10018067 145
146 3300003771 Ga0055526_1031704 Ga0055526_10317042 145
147 3300003773 Ga0055537_1000518 Ga0055537_10005182 145
148 3300003773 Ga0055537_1011789 Ga0055537_10117892 145
149 3300003775 Ga0055524_1000784 Ga0055524_10007846 145
150 3300003775 Ga0055524_1011953 Ga0055524_10119532 145
151 3300003781 Ga0055536_1002043 Ga0055536_10020439 145
152 3300003784 Ga0055534_1000029 Ga0055534_100002997 145
153 3300003784 Ga0055534_1000438 Ga0055534_100043816 145
154 3300005336 Ga0070680_100000360 Ga0070680_1000003603 145
155 3300005337 Ga0070682_100316856 Ga0070682_1003168562 145
156 3300005339 Ga0070660_100000463 Ga0070660_10000046321 145
157 3300005344 Ga0070661_100000011 Ga0070661_100000011129 145
158 3300005347 Ga0070668_100004635 Ga0070668_10000463511 145
159 3300005367 Ga0070667_100003206 Ga0070667_10000320611 145
160 3300005434 Ga0070709_11065811 Ga0070709_110658111 145
161 3300005436 Ga0070713_100436175 Ga0070713_1004361752 145
162 3300005439 Ga0070711_100527462 Ga0070711_1005274622 145
163 3300005445 Ga0070708_100037368 Ga0070708_1000373682 145
164 3300005445 Ga0070708_101435681 Ga0070708_1014356812 145
165 3300005458 Ga0070681_10129908 Ga0070681_101299082 145
166 3300005466 Ga0070685_10085162 Ga0070685_100851622 145
167 3300005530 Ga0070679_100000008 Ga0070679_10000000844 145
168 3300005536 Ga0070697_100147436 Ga0070697_1001474362 145
169 3300005545 Ga0070695_100017197 Ga0070695_1000171975 145
170 3300005546 Ga0070696_100108259 Ga0070696_1001082592 145
171 3300005546 Ga0070696_100296985 Ga0070696_1002969852 145
172 3300005548 Ga0070665_100001069 Ga0070665_1000010697 145
173 3300005548 Ga0070665_101145138 Ga0070665_1011451382 145
174 3300005614 Ga0068856_100575048 Ga0068856_1005750482 145
175 3300005617 Ga0068859_100344234 Ga0068859_1003442342 145
176 3300005843 Ga0068860_100903370 Ga0068860_1009033702 145
177 3300005844 Ga0068862_100011779 Ga0068862_1000117795 145
178 3300006852 Ga0075433_10021335 Ga0075433_100213353 145
179 3300006852 Ga0075433_10074419 Ga0075433_100744192 145
180 3300006852 Ga0075433_10780632 Ga0075433_107806322 145
181 3300006871 Ga0075434_100041466 Ga0075434_1000414662 145
182 3300006871 Ga0075434_100160376 Ga0075434_1001603762 145
183 3300006871 Ga0075434_100956047 Ga0075434_1009560472 145
184 3300006871 Ga0075434_101282605 Ga0075434_1012826052 145
185 3300006914 Ga0075436_100076468 Ga0075436_1000764682 145
186 3300006931 Ga0097620_100344237 Ga0097620_1003442372 145
187 3300009093 Ga0105240_10002534 Ga0105240_100025349 145
188 3300009093 Ga0105240_10502982 Ga0105240_105029822 145
189 3300009101 Ga0105247_10725436 Ga0105247_107254362 145
190 3300009147 Ga0114129_10105858 Ga0114129_101058582 145
191 3300009147 Ga0114129_10117783 Ga0114129_101177832 145
192 3300009177 Ga0105248_10014633 Ga0105248_100146336 145
193 3300009545 Ga0105237_11355461 Ga0105237_113554611 145
194 3300009551 Ga0105238_10125674 Ga0105238_101256742 145
195 3300009553 Ga0105249_10356825 Ga0105249_103568252 145
196 3300010375 Ga0105239_10000156 Ga0105239_1000015628 145
197 3300010375 Ga0105239_10733125 Ga0105239_107331252 145
198 3300013105 Ga0157369_10062274 Ga0157369_100622742 145
199 3300013105 Ga0157369_10116557 Ga0157369_101165572 145
200 3300016635 Ga0183361_10021 Ga0183361_1002151 145
201 3300025226 Ga0209674_100025 Ga0209674_100025313 145
202 3300025228 Ga0209672_100002 Ga0209672_1000021206 145
203 3300025229 Ga0209147_100003 Ga0209147_1000031206 145
204 3300025230 Ga0209563_101308 Ga0209563_1013082 145
205 3300025231 Ga0207427_101488 Ga0207427_1014882 145
206 3300025242 Ga0209258_100005 Ga0209258_100005847 145
207 3300025246 Ga0209646_1014752 Ga0209646_10147522 145
208 3300025254 Ga0209148_1000006 Ga0209148_10000061206 145
209 3300025256 Ga0209759_1000014 Ga0209759_1000014140 145
210 3300025256 Ga0209759_1000250 Ga0209759_100025036 145
211 3300025261 Ga0209233_1000018 Ga0209233_1000018139 145
212 3300025263 Ga0209565_1000095 Ga0209565_1000095104 145
213 3300025263 Ga0209565_1005021 Ga0209565_10050212 145
214 3300025272 Ga0209455_1000003 Ga0209455_10000031206 145
215 3300025273 Ga0209673_1034746 Ga0209673_10347462 145
216 3300025284 Ga0209130_1010471 Ga0209130_10104712 145
217 3300025291 Ga0209675_1000050 Ga0209675_1000050153 145
218 3300025291 Ga0209675_1000067 Ga0209675_100006757 145
219 3300025291 Ga0209675_1003571 Ga0209675_10035717 145
220 3300025292 Ga0209676_1000053 Ga0209676_100005395 145
221 3300025294 Ga0209025_1000059 Ga0209025_100005919 145
222 3300025294 Ga0209025_1000093 Ga0209025_1000093181 145
223 3300025294 Ga0209025_1002027 Ga0209025_10020275 145
224 3300025295 Ga0209564_1000158 Ga0209564_100015832 145
225 3300025295 Ga0209564_1000224 Ga0209564_100022412 145
226 3300025295 Ga0209564_1000645 Ga0209564_10006457 145
227 3300025297 Ga0209758_1007523 Ga0209758_10075232 145
228 3300025299 Ga0209256_1000086 Ga0209256_100008611 145
229 3300025299 Ga0209256_1000985 Ga0209256_100098519 145
230 3300025303 Ga0209051_1005375 Ga0209051_10053756 145
231 3300025900 Ga0207710_10174369 Ga0207710_101743691 145
232 3300025904 Ga0207647_10004326 Ga0207647_100043267 145
233 3300025906 Ga0207699_10804862 Ga0207699_108048622 145
234 3300025912 Ga0207707_10069637 Ga0207707_100696372 145
235 3300025913 Ga0207695_10000521 Ga0207695_1000052110 145
236 3300025913 Ga0207695_10386926 Ga0207695_103869262 145
237 3300025913 Ga0207695_10434522 Ga0207695_104345222 145
238 3300025914 Ga0207671_11144012 Ga0207671_111440122 145
239 3300025917 Ga0207660_10001011 Ga0207660_1000101115 145
240 3300025919 Ga0207657_10024282 Ga0207657_100242825 145
241 3300025920 Ga0207649_10000038 Ga0207649_1000003846 145
242 3300025921 Ga0207652_10000008 Ga0207652_10000008250 145
243 3300025921 Ga0207652_11123531 Ga0207652_111235312 145
244 3300025924 Ga0207694_10209436 Ga0207694_102094362 145
245 3300025928 Ga0207700_10317103 Ga0207700_103171032 145
246 3300025941 Ga0207711_10030840 Ga0207711_100308402 145
247 3300025961 Ga0207712_10079254 Ga0207712_100792542 145
248 3300025972 Ga0207668_10000018 Ga0207668_10000018128 145
249 3300025981 Ga0207640_10175637 Ga0207640_101756372 145
250 3300025986 Ga0207658_10003900 Ga0207658_100039004 145
251 3300026089 Ga0207648_10623402 Ga0207648_106234022 145
252 3300027312 Ga0209371_1013065 Ga0209371_10130652 145
253 3300028379 Ga0268266_10002757 Ga0268266_100027579 145
254 3300028379 Ga0268266_10645634 Ga0268266_106456342 145
255 3300028380 Ga0268265_10008276 Ga0268265_100082765 145
256 3300028381 Ga0268264_10869388 Ga0268264_108693882 145
257 3300028666 Ga0265336_10013275 Ga0265336_100132752 145
258 3300030500 Ga0268256_1014325 Ga0268256_10143252 145
259 3300031235 Ga0265330_10194573 Ga0265330_101945732 145
260 3300031241 Ga0265325_10025458 Ga0265325_100254582 145
261 3300031247 Ga0265340_10078526 Ga0265340_100785262 145
262 3300031250 Ga0265331_10048752 Ga0265331_100487522 145
263 3300031344 Ga0265316_10095623 Ga0265316_100956232 145
264 3300031595 Ga0265313_10034082 Ga0265313_100340823 145
265 3300031711 Ga0265314_10342344 Ga0265314_103423441 145
266 3300031712 Ga0265342_10107181 Ga0265342_101071812 145
267 3300037312 Ga0395899_0009160 Ga0395899_0009160_5412_5849 145
268 3300039450 Ga0436363_1164496 Ga0436363_1164496_420_872 145
269 3300044693 Ga0466961_0679963 Ga0466961_0679963_45_482 145
270 3300045051 Ga0451576_0007456 Ga0451576_0007456_5538_5996 145
271 3300045836 Ga0466958_0000236 Ga0466958_0000236_11848_12285 145
272 3300046454 Ga0495592_0089045 Ga0495592_0089045_1514_1951 145
273 3300046459 Ga0495629_0009252 Ga0495629_0009252_5259_5696 145
274 3300046460 Ga0495638_0001947 Ga0495638_0001947_2943_3392 145
275 3300046462 Ga0495651_0022252 Ga0495651_0022252_3737_4198 145
276 3300046462 Ga0495651_0349370 Ga0495651_0349370_155_592 145
277 3300046463 Ga0495653_0043913 Ga0495653_0043913_16_453 145
278 3300046463 Ga0495653_0054531 Ga0495653_0054531_1136_1597 145
279 3300046472 Ga0495580_0000760 Ga0495580_0000760_7791_8252 145
280 3300046472 Ga0495580_0089278 Ga0495580_0089278_1224_1661 145
281 3300046473 Ga0495582_0004286 Ga0495582_0004286_3419_3856 145
282 3300046476 Ga0495662_0072930 Ga0495662_0072930_1014_1451 145
283 3300046477 Ga0495664_0037724 Ga0495664_0037724_2366_2803 145
284 3300046500 Ga0495596_0020226 Ga0495596_0020226_1364_1801 145
285 3300046507 Ga0495606_0343958 Ga0495606_0343958_72_509 145
286 3300046511 Ga0495608_0004848 Ga0495608_0004848_5203_5640 145
287 3300046516 Ga0495628_0054390 Ga0495628_0054390_1779_2240 145
288 3300046516 Ga0495628_0173947 Ga0495628_0173947_927_1364 145
289 3300046517 Ga0495630_0072443 Ga0495630_0072443_1681_2142 145
290 3300046526 Ga0495666_0014504 Ga0495666_0014504_1124_1585 145
291 3300046526 Ga0495666_0048695 Ga0495666_0048695_152_589 145
292 3300046529 Ga0495652_0532093 Ga0495652_0532093_140_577 145
293 3300046531 Ga0495665_0070602 Ga0495665_0070602_1312_1749 145
294 3300046533 Ga0495640_0087226 Ga0495640_0087226_188_625 145
295 3300046535 Ga0495586_0024631 Ga0495586_0024631_1029_1466 145
296 3300046543 Ga0495645_0413191 Ga0495645_0413191_267_704 145
297 3300046559 Ga0495667_0144877 Ga0495667_0144877_267_704 145
298 3300046642 Ga0495634_0031196 Ga0495634_0031196_1712_2149 145
299 3300046663 Ga0495635_0001485 Ga0495635_0001485_8135_8572 145
300 3300046675 Ga0495657_0337241 Ga0495657_0337241_326_787 145
301 3300046678 Ga0495599_0008580 Ga0495599_0008580_5058_5519 145
302 3300046678 Ga0495599_0734412 Ga0495599_0734412_67_504 145
303 3300046680 Ga0495646_0132437 Ga0495646_0132437_937_1374 145
304 3300046680 Ga0495646_0144039 Ga0495646_0144039_370_831 145
305 3300046689 Ga0495613_0581124 Ga0495613_0581124_36_473 145
306 3300046690 Ga0495624_0004455 Ga0495624_0004455_6858_7319 145
307 3300046690 Ga0495624_0183433 Ga0495624_0183433_746_1183 145
308 3300046690 Ga0495624_0662638 Ga0495624_0662638_137_574 145
309 3300046794 Ga0495589_0079387 Ga0495589_0079387_1034_1471 145
310 3300046809 Ga0495600_0049549 Ga0495600_0049549_1349_1786 145
311 3300046809 Ga0495600_0415256 Ga0495600_0415256_181_642 145
312 3300046810 Ga0495660_0001646 Ga0495660_0001646_8353_8838 145
313 3300047315 Ga0495581_0003242 Ga0495581_0003242_5161_5598 145
314 3300047317 Ga0495604_0108282 Ga0495604_0108282_855_1316 145
315 3300047317 Ga0495604_0136569 Ga0495604_0136569_292_729 145
316 3300047319 Ga0495674_0062533 Ga0495674_0062533_1881_2318 145
317 3300047323 Ga0495683_0007050 Ga0495683_0007050_1312_1749 145
318 3300047443 Ga0495687_078251 Ga0495687_078251_53_490 145
319 3300047444 Ga0495675_0022869 Ga0495675_0022869_1612_2049 145
320 3300047444 Ga0495675_0505936 Ga0495675_0505936_222_683 145
321 3300047471 Ga0495684_0011372 Ga0495684_0011372_4456_4917 145
322 3300047471 Ga0495684_0263887 Ga0495684_0263887_76_513 145
323 3300048088 Ga0495602_0055359 Ga0495602_0055359_2852_3313 145
324 3300048088 Ga0495602_0176635 Ga0495602_0176635_292_729 145
325 3300048088 Ga0495602_0178691 Ga0495602_0178691_844_1305 145
326 3300048089 Ga0495614_0025701 Ga0495614_0025701_949_1386 145
327 3300048905 Ga0496102_0004284 Ga0496102_0004284_1755_2192 145
328 3300048919 Ga0496116_0039246 Ga0496116_0039246_2693_3130 145
329 3300048920 Ga0496117_0002473 Ga0496117_0002473_7332_7769 145
330 3300048921 Ga0496118_0000126 Ga0496118_0000126_77845_78282 145
331 3300048921 Ga0496118_0295215 Ga0496118_0295215_441_878 145
332 3300048924 Ga0496121_0010620 Ga0496121_0010620_3019_3474 145
333 3300048924 Ga0496121_0057994 Ga0496121_0057994_2646_3083 145
334 3300048925 Ga0496122_0281022 Ga0496122_0281022_381_818 145
335 3300048928 Ga0496125_0432262 Ga0496125_0432262_278_715 145
336 3300048929 Ga0496126_0001253 Ga0496126_0001253_24098_24559 145
337 3300050507 nmdc:mga05p37_184819_c1 nmdc:mga05p37_184819_c1_1174_1635 145
338 3300050512 nmdc:mga0n895_373309_c1 nmdc:mga0n895_373309_c1_539_1000 145
339 3300050512 nmdc:mga0n895_661012_c1 nmdc:mga0n895_661012_c1_470_931 145
340 3300050512 nmdc:mga0n895_984841_c1 nmdc:mga0n895_984841_c1_157_612 145
341 3300050514 nmdc:mga08x19_25408_c1 nmdc:mga08x19_25408_c1_2894_3355 145
342 3300050515 nmdc:mga0a205_11198_c3 nmdc:mga0a205_11198_c3_1357_1812 145
343 3300050515 nmdc:mga0a205_401055_c1 nmdc:mga0a205_401055_c1_582_1040 145
344 3300050515 nmdc:mga0a205_48675_c1 nmdc:mga0a205_48675_c1_3115_3576 145
345 3300053139 Ga0500568_0002237 Ga0500568_0002237_6528_6992 145
346 iso_pu_bacteria 2808606384 2808970776 145
347 iso_pu_bacteria 2808606390 2809005607 145
348 iso_pu_bacteria 2808606391 2809012636 145
349 iso_pu_bacteria 2900634093 2900635693 145
350 iso_pu_bacteria 642555113 642620842 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

24

147

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5brj-assembly1.cif.gz_A-2 structure of the bacteriophytochrome response regulator atbrr 0.9254 1 139
5ic5-assembly1.cif.gz_A-2 bacteriophytochrome response regulator rtbrr 0.9194 1 142
5brj-assembly1.cif.gz_A-2 structure of the bacteriophytochrome response regulator atbrr 0.9127 1 139
1vlz-assembly1.cif.gz_B uncoupled phosphorylation and activation in bacterial chemotaxis: the 2.1 angstrom structure of a threonine to isoleucine mutant at position 87 of chey 0.8983 2 130
5ic5-assembly1.cif.gz_A-2 bacteriophytochrome response regulator rtbrr 0.8949 1 142
ID Description Score Start End Superfamily
af_K7LAM2_53_309_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.929 72 96 3.50.50.60
5brjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9254 1 139 3.40.50.2300
5ic5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9194 1 142 3.40.50.2300
5brjA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9127 1 139 3.40.50.2300
5ic5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8949 1 142 3.40.50.2300
ID Description Score Start End GO Terms
AF-J8V183-F1-model_v4 deleted 0.9834 1 97
AF-A0A560V8J2-F1-model_v4 Response regulator receiver domain-containing protein 0.9823 1 145 GO:0000160
AF-A0A560V8J2-F1-model_v4 Response regulator receiver domain-containing protein 0.9756 1 145 GO:0000160
AF-A0A261UG08-F1-model_v4 Two-component system response regulator 0.9678 2 145 GO:0000160
AF-A0A0F4FSC0-F1-model_v4 deleted 0.9648 2 143

Feature Viewer

pLDDT pTM Quality
82.3 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map