F418323
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 133 | 350 | 562 |
Family's Representative Sequence
| Representative Sequence | 3300037418|Ga0395900_0021255|Ga0395900_0021255_1740_3443 |
| Length | 554 |
| Sequence | VNDSKNLILAVVLSALVLLGWTFAANKYFPTSNPASTRVENGRQVAVPQPQAQPAPATPKTLQSVAQALGSTPRVKIETPSLEGSINLKGAQIDDLLLVRHEQTLAKNSPPVRLLSPLGTLDAYTTSFGWTAQGTQAPDLNTVWTADGNILSPGHPVTLSTQTPDDVRYQIKISVDDGYLFTVQQSVTNASGKPVTVRPIGLASRASKSADPSSWTNHVGPISVFGGKADYDVNWKDLDKEGTKAFSDVSGWLGFTDKYWLTALIPNGSVAADFRHSVAVAPGQAVMTQARLFAGAKEKAWLDRYEAAGVPLLSYAIDWGWFWFFARPIFDLLMFLFHAIGNFGLAIICLTLIVRVVMFPIAQKQFQSMAAMRKLQPKLKAIQERFKDDKPRQQQEIMKLYQAEKINPAAGCLPIVLQIPVFYALYKCLLVAVEMRHQPFILWIKDLSAPDPLTPVNLFGLLHFTPPAMLAIGVLPILVGATQWMSMKLNPQPMDPAQAQIFAIMPWFLVFIMAPFAAGLQLYWITNNLLTMAQQWWLYRKFGLHLSDTHPVHT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 37 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 38 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 39 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 63 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 101 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 102 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 103 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 104 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 105 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 109 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 110 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 111 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 112 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 113 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 114 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 115 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 116 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 117 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 118 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 119 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 120 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 121 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 122 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 125 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 126 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 128 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 129 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 130 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 133 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 4.86 |
| Rhizosphere | 93.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1003115 | 3300001915 | Bacteria | 4069 |
| 2 | JGI24737J22298_10000229 | 3300001990 | Bacteria | 18537 |
| 3 | JGI24737J22298_10001469 | 3300001990 | Bacteria | 8398 |
| 4 | JGI24737J22298_10005397 | 3300001990 | Bacteria | 4416 |
| 5 | JGI24737J22298_10006449 | 3300001990 | Bacteria | 4008 |
| 6 | JGI24735J21928_10000919 | 3300002067 | Bacteria | 10521 |
| 7 | Ga0070658_10002803 | 3300005327 | Bacteria | 14482 |
| 8 | Ga0070658_10039751 | 3300005327 | Bacteria | 3795 |
| 9 | Ga0070658_10090038 | 3300005327 | Bacteria | 2527 |
| 10 | Ga0070670_100024585 | 3300005331 | Bacteria | 5179 |
| 11 | Ga0070670_100027175 | 3300005331 | Bacteria | 4923 |
| 12 | Ga0068869_100004062 | 3300005334 | Bacteria | 9057 |
| 13 | Ga0070666_10000630 | 3300005335 | Bacteria | 21198 |
| 14 | Ga0068868_100000881 | 3300005338 | Bacteria | 20375 |
| 15 | Ga0068868_100083093 | 3300005338 | Bacteria | 2570 |
| 16 | Ga0070660_100001159 | 3300005339 | Bacteria | 17807 |
| 17 | Ga0070660_100004955 | 3300005339 | Bacteria | 9209 |
| 18 | Ga0070660_100007977 | 3300005339 | Bacteria | 7398 |
| 19 | Ga0070660_100024417 | 3300005339 | Bacteria | 4483 |
| 20 | Ga0070660_100030447 | 3300005339 | Bacteria | 4049 |
| 21 | Ga0070660_100097077 | 3300005339 | Bacteria | 2331 |
| 22 | Ga0070691_10031868 | 3300005341 | Bacteria | 2474 |
| 23 | Ga0070661_100004337 | 3300005344 | Bacteria | 9786 |
| 24 | Ga0070661_100034038 | 3300005344 | Bacteria | 3694 |
| 25 | Ga0070661_100074397 | 3300005344 | Bacteria | 2502 |
| 26 | Ga0070661_100109555 | 3300005344 | Bacteria | 2061 |
| 27 | Ga0070692_10034057 | 3300005345 | Bacteria | 2570 |
| 28 | Ga0070669_100038156 | 3300005353 | Bacteria | 3487 |
| 29 | Ga0070671_100010200 | 3300005355 | Bacteria | 7541 |
| 30 | Ga0070671_100022193 | 3300005355 | Bacteria | 5185 |
| 31 | Ga0070671_100075982 | 3300005355 | Bacteria | 2806 |
| 32 | Ga0070671_100076714 | 3300005355 | Bacteria | 2792 |
| 33 | Ga0070671_100087303 | 3300005355 | Bacteria | 2610 |
| 34 | Ga0070673_100000613 | 3300005364 | Bacteria | 19502 |
| 35 | Ga0070673_100006064 | 3300005364 | Bacteria | 7829 |
| 36 | Ga0070673_100027808 | 3300005364 | Bacteria | 4196 |
| 37 | Ga0070659_100001497 | 3300005366 | Bacteria | 16828 |
| 38 | Ga0070659_100001672 | 3300005366 | Bacteria | 15938 |
| 39 | Ga0070659_100004174 | 3300005366 | Bacteria | 10299 |
| 40 | Ga0070659_100006754 | 3300005366 | Bacteria | 8297 |
| 41 | Ga0070659_100010044 | 3300005366 | Bacteria | 6968 |
| 42 | Ga0070659_100050919 | 3300005366 | Bacteria | 3256 |
| 43 | Ga0070659_100054143 | 3300005366 | Bacteria | 3160 |
| 44 | Ga0070667_100003077 | 3300005367 | Bacteria | 14332 |
| 45 | Ga0070667_100003302 | 3300005367 | Bacteria | 13792 |
| 46 | Ga0070667_100025102 | 3300005367 | Bacteria | 4954 |
| 47 | Ga0070713_100021196 | 3300005436 | Bacteria | 4993 |
| 48 | Ga0070663_100002429 | 3300005455 | Bacteria | 10478 |
| 49 | Ga0070663_100005583 | 3300005455 | Bacteria | 7487 |
| 50 | Ga0070663_100033035 | 3300005455 | Bacteria | 3571 |
| 51 | Ga0070678_100001960 | 3300005456 | Bacteria | 11113 |
| 52 | Ga0070678_100006370 | 3300005456 | Bacteria | 6924 |
| 53 | Ga0070662_100001014 | 3300005457 | Bacteria | 17175 |
| 54 | Ga0070662_100001950 | 3300005457 | Bacteria | 12681 |
| 55 | Ga0070662_100007201 | 3300005457 | Bacteria | 7206 |
| 56 | Ga0070662_100036277 | 3300005457 | Bacteria | 3487 |
| 57 | Ga0070681_10024034 | 3300005458 | Bacteria | 6135 |
| 58 | Ga0068867_100005300 | 3300005459 | Bacteria | 9106 |
| 59 | Ga0070679_100019105 | 3300005530 | Bacteria | 6659 |
| 60 | Ga0070679_100102636 | 3300005530 | Bacteria | 2846 |
| 61 | Ga0070684_100047718 | 3300005535 | Bacteria | 3712 |
| 62 | Ga0070684_100136385 | 3300005535 | Bacteria | 2217 |
| 63 | Ga0068853_100006858 | 3300005539 | Bacteria | 9083 |
| 64 | Ga0068853_100015471 | 3300005539 | Bacteria | 6267 |
| 65 | Ga0068853_100019243 | 3300005539 | Bacteria | 5659 |
| 66 | Ga0070672_100001691 | 3300005543 | Bacteria | 13764 |
| 67 | Ga0070672_100005149 | 3300005543 | Bacteria | 8635 |
| 68 | Ga0068855_100026207 | 3300005563 | Bacteria | 6975 |
| 69 | Ga0068855_100052153 | 3300005563 | Bacteria | 4816 |
| 70 | Ga0070664_100000796 | 3300005564 | Bacteria | 24295 |
| 71 | Ga0070664_100001230 | 3300005564 | Bacteria | 20486 |
| 72 | Ga0070664_100006146 | 3300005564 | Bacteria | 9711 |
| 73 | Ga0070664_100006440 | 3300005564 | Bacteria | 9468 |
| 74 | Ga0070664_100026695 | 3300005564 | Bacteria | 4793 |
| 75 | Ga0070664_100086816 | 3300005564 | Bacteria | 2703 |
| 76 | Ga0070664_100091393 | 3300005564 | Bacteria | 2635 |
| 77 | Ga0070664_100151513 | 3300005564 | Bacteria | 2047 |
| 78 | Ga0068857_100003503 | 3300005577 | Bacteria | 13106 |
| 79 | Ga0068857_100004732 | 3300005577 | Bacteria | 11531 |
| 80 | Ga0068857_100004979 | 3300005577 | Bacteria | 11284 |
| 81 | Ga0068857_100025428 | 3300005577 | Bacteria | 5213 |
| 82 | Ga0068857_100054109 | 3300005577 | Bacteria | 3561 |
| 83 | Ga0068854_100014647 | 3300005578 | Bacteria | 5173 |
| 84 | Ga0068854_100027254 | 3300005578 | Bacteria | 3936 |
| 85 | Ga0068854_100087339 | 3300005578 | Bacteria | 2313 |
| 86 | Ga0068856_100160448 | 3300005614 | Bacteria | 2259 |
| 87 | Ga0068852_100033057 | 3300005616 | Bacteria | 4290 |
| 88 | Ga0068852_100040998 | 3300005616 | Bacteria | 3910 |
| 89 | Ga0068859_100011725 | 3300005617 | Bacteria | 8807 |
| 90 | Ga0068864_100002050 | 3300005618 | Bacteria | 16638 |
| 91 | Ga0068864_100003062 | 3300005618 | Bacteria | 13803 |
| 92 | Ga0068861_100024487 | 3300005719 | Bacteria | 4366 |
| 93 | Ga0068863_100012542 | 3300005841 | Bacteria | 8178 |
| 94 | Ga0068863_100025366 | 3300005841 | Bacteria | 5652 |
| 95 | Ga0068863_100044232 | 3300005841 | Bacteria | 4227 |
| 96 | Ga0068863_100105246 | 3300005841 | Bacteria | 2684 |
| 97 | Ga0068858_100009043 | 3300005842 | Bacteria | 9524 |
| 98 | Ga0068858_100023047 | 3300005842 | Bacteria | 5807 |
| 99 | Ga0068858_100032745 | 3300005842 | Bacteria | 4827 |
| 100 | Ga0068860_100007732 | 3300005843 | Bacteria | 10742 |
| 101 | Ga0068862_100071393 | 3300005844 | Bacteria | 2998 |
| 102 | Ga0075366_10073801 | 3300006195 | Bacteria | 2034 |
| 103 | Ga0097621_100049163 | 3300006237 | Bacteria | 3425 |
| 104 | Ga0097621_100089069 | 3300006237 | Bacteria | 2579 |
| 105 | Ga0068871_100005970 | 3300006358 | Bacteria | 8574 |
| 106 | Ga0097620_100011725 | 3300006931 | Bacteria | 8807 |
| 107 | Ga0105240_10010767 | 3300009093 | Bacteria | 12824 |
| 108 | Ga0105240_10023135 | 3300009093 | Bacteria | 8227 |
| 109 | Ga0105245_10000285 | 3300009098 | Bacteria | 48237 |
| 110 | Ga0105245_10011260 | 3300009098 | Bacteria | 7787 |
| 111 | Ga0105241_10075249 | 3300009174 | Bacteria | 2631 |
| 112 | Ga0105248_10004871 | 3300009177 | Bacteria | 14855 |
| 113 | Ga0105248_10006610 | 3300009177 | Bacteria | 12705 |
| 114 | Ga0105248_10008019 | 3300009177 | Bacteria | 11597 |
| 115 | Ga0105237_10044364 | 3300009545 | Bacteria | 4476 |
| 116 | Ga0105238_10014766 | 3300009551 | Bacteria | 7898 |
| 117 | Ga0105249_10113495 | 3300009553 | Bacteria | 2564 |
| 118 | Ga0157373_10003505 | 3300013100 | Bacteria | 11868 |
| 119 | Ga0157373_10027556 | 3300013100 | Bacteria | 4099 |
| 120 | Ga0157371_10006517 | 3300013102 | Bacteria | 9607 |
| 121 | Ga0157371_10009211 | 3300013102 | Bacteria | 7792 |
| 122 | Ga0157371_10012175 | 3300013102 | Bacteria | 6586 |
| 123 | Ga0157371_10039194 | 3300013102 | Bacteria | 3388 |
| 124 | Ga0157371_10052294 | 3300013102 | Bacteria | 2901 |
| 125 | Ga0157371_10088500 | 3300013102 | Bacteria | 2192 |
| 126 | Ga0157370_10002640 | 3300013104 | Bacteria | 21532 |
| 127 | Ga0157369_10000106 | 3300013105 | Bacteria | 117964 |
| 128 | Ga0157369_10011956 | 3300013105 | Bacteria | 9859 |
| 129 | Ga0157369_10013407 | 3300013105 | Bacteria | 9269 |
| 130 | Ga0157374_10029251 | 3300013296 | Bacteria | 4986 |
| 131 | Ga0157378_10001258 | 3300013297 | Bacteria | 22842 |
| 132 | Ga0163162_10003164 | 3300013306 | Bacteria | 15732 |
| 133 | Ga0157375_10050841 | 3300013308 | Bacteria | 4067 |
| 134 | Ga0163163_10003524 | 3300014325 | Bacteria | 13288 |
| 135 | Ga0157377_10070074 | 3300014745 | Bacteria | 2025 |
| 136 | Ga0213876_10002997 | 3300021384 | Bacteria | 9774 |
| 137 | Ga0213876_10033616 | 3300021384 | Bacteria | 2703 |
| 138 | Ga0207697_10000158 | 3300025315 | Bacteria | 33821 |
| 139 | Ga0207688_10000924 | 3300025901 | Bacteria | 14835 |
| 140 | Ga0207647_10000114 | 3300025904 | Bacteria | 62368 |
| 141 | Ga0207647_10000253 | 3300025904 | Bacteria | 43758 |
| 142 | Ga0207647_10012008 | 3300025904 | Bacteria | 6045 |
| 143 | Ga0207647_10012561 | 3300025904 | Bacteria | 5890 |
| 144 | Ga0207647_10043786 | 3300025904 | Bacteria | 2799 |
| 145 | Ga0207647_10057227 | 3300025904 | Bacteria | 2391 |
| 146 | Ga0207645_10003650 | 3300025907 | Bacteria | 11612 |
| 147 | Ga0207705_10000929 | 3300025909 | Bacteria | 23915 |
| 148 | Ga0207705_10002967 | 3300025909 | Bacteria | 12964 |
| 149 | Ga0207705_10007878 | 3300025909 | Bacteria | 7822 |
| 150 | Ga0207705_10024855 | 3300025909 | Bacteria | 4275 |
| 151 | Ga0207705_10027473 | 3300025909 | Bacteria | 4058 |
| 152 | Ga0207705_10029679 | 3300025909 | Bacteria | 3898 |
| 153 | Ga0207705_10032252 | 3300025909 | Bacteria | 3743 |
| 154 | Ga0207705_10063220 | 3300025909 | Bacteria | 2674 |
| 155 | Ga0207705_10084720 | 3300025909 | Bacteria | 2314 |
| 156 | Ga0207695_10019220 | 3300025913 | Bacteria | 7868 |
| 157 | Ga0207657_10000498 | 3300025919 | Bacteria | 41427 |
| 158 | Ga0207657_10000504 | 3300025919 | Bacteria | 41239 |
| 159 | Ga0207657_10000806 | 3300025919 | Bacteria | 33100 |
| 160 | Ga0207657_10000946 | 3300025919 | Bacteria | 30768 |
| 161 | Ga0207657_10022778 | 3300025919 | Bacteria | 5850 |
| 162 | Ga0207657_10023777 | 3300025919 | Bacteria | 5697 |
| 163 | Ga0207657_10025765 | 3300025919 | Bacteria | 5416 |
| 164 | Ga0207657_10058802 | 3300025919 | Bacteria | 3306 |
| 165 | Ga0207657_10065537 | 3300025919 | Bacteria | 3096 |
| 166 | Ga0207657_10067654 | 3300025919 | Bacteria | 3037 |
| 167 | Ga0207649_10009705 | 3300025920 | Bacteria | 5272 |
| 168 | Ga0207649_10021124 | 3300025920 | Bacteria | 3742 |
| 169 | Ga0207652_10024932 | 3300025921 | Bacteria | 4966 |
| 170 | Ga0207652_10143450 | 3300025921 | Bacteria | 2136 |
| 171 | Ga0207694_10002217 | 3300025924 | Bacteria | 15949 |
| 172 | Ga0207650_10005137 | 3300025925 | Bacteria | 8935 |
| 173 | Ga0207650_10006767 | 3300025925 | Bacteria | 7816 |
| 174 | Ga0207687_10012151 | 3300025927 | Bacteria | 5632 |
| 175 | Ga0207687_10021225 | 3300025927 | Bacteria | 4313 |
| 176 | Ga0207700_10016295 | 3300025928 | Bacteria | 4934 |
| 177 | Ga0207664_10091243 | 3300025929 | Bacteria | 2498 |
| 178 | Ga0207644_10007787 | 3300025931 | Bacteria | 6995 |
| 179 | Ga0207644_10009397 | 3300025931 | Bacteria | 6422 |
| 180 | Ga0207644_10026579 | 3300025931 | Bacteria | 3989 |
| 181 | Ga0207644_10032260 | 3300025931 | Bacteria | 3653 |
| 182 | Ga0207644_10057448 | 3300025931 | Bacteria | 2809 |
| 183 | Ga0207644_10081508 | 3300025931 | Bacteria | 2391 |
| 184 | Ga0207690_10001173 | 3300025932 | Bacteria | 16570 |
| 185 | Ga0207690_10001468 | 3300025932 | Bacteria | 14742 |
| 186 | Ga0207690_10005486 | 3300025932 | Bacteria | 7481 |
| 187 | Ga0207690_10024433 | 3300025932 | Bacteria | 3785 |
| 188 | Ga0207690_10078869 | 3300025932 | Bacteria | 2293 |
| 189 | Ga0207706_10000643 | 3300025933 | Bacteria | 37034 |
| 190 | Ga0207706_10001330 | 3300025933 | Bacteria | 24746 |
| 191 | Ga0207706_10002629 | 3300025933 | Bacteria | 17488 |
| 192 | Ga0207706_10004270 | 3300025933 | Bacteria | 13444 |
| 193 | Ga0207706_10035781 | 3300025933 | Bacteria | 4412 |
| 194 | Ga0207706_10048264 | 3300025933 | Bacteria | 3765 |
| 195 | Ga0207706_10071112 | 3300025933 | Bacteria | 3060 |
| 196 | Ga0207706_10077592 | 3300025933 | Bacteria | 2921 |
| 197 | Ga0207706_10079656 | 3300025933 | Bacteria | 2880 |
| 198 | Ga0207706_10086984 | 3300025933 | Bacteria | 2747 |
| 199 | Ga0207691_10015876 | 3300025940 | Bacteria | 7156 |
| 200 | Ga0207711_10005082 | 3300025941 | Bacteria | 11155 |
| 201 | Ga0207711_10011332 | 3300025941 | Bacteria | 7407 |
| 202 | Ga0207711_10103482 | 3300025941 | Bacteria | 2521 |
| 203 | Ga0207689_10000017 | 3300025942 | Bacteria | 117159 |
| 204 | Ga0207689_10019923 | 3300025942 | Bacteria | 5650 |
| 205 | Ga0207679_10032415 | 3300025945 | Bacteria | 3668 |
| 206 | Ga0207679_10034517 | 3300025945 | Bacteria | 3570 |
| 207 | Ga0207667_10030495 | 3300025949 | Bacteria | 5833 |
| 208 | Ga0207667_10038532 | 3300025949 | Bacteria | 5103 |
| 209 | Ga0207667_10057674 | 3300025949 | Bacteria | 4075 |
| 210 | Ga0207712_10000513 | 3300025961 | Bacteria | 32083 |
| 211 | Ga0207668_10102099 | 3300025972 | Bacteria | 2133 |
| 212 | Ga0207640_10000794 | 3300025981 | Bacteria | 17956 |
| 213 | Ga0207640_10017254 | 3300025981 | Bacteria | 4221 |
| 214 | Ga0207658_10003102 | 3300025986 | Bacteria | 11890 |
| 215 | Ga0207658_10015187 | 3300025986 | Bacteria | 5282 |
| 216 | Ga0207658_10069307 | 3300025986 | Bacteria | 2664 |
| 217 | Ga0207658_10121347 | 3300025986 | Bacteria | 2084 |
| 218 | Ga0207677_10056727 | 3300026023 | Bacteria | 2685 |
| 219 | Ga0207703_10006790 | 3300026035 | Bacteria | 9122 |
| 220 | Ga0207703_10029489 | 3300026035 | Bacteria | 4329 |
| 221 | Ga0207703_10101164 | 3300026035 | Bacteria | 2443 |
| 222 | Ga0207639_10000199 | 3300026041 | Bacteria | 45241 |
| 223 | Ga0207639_10046980 | 3300026041 | Bacteria | 3260 |
| 224 | Ga0207678_10001692 | 3300026067 | Bacteria | 20210 |
| 225 | Ga0207678_10020008 | 3300026067 | Bacteria | 5882 |
| 226 | Ga0207678_10025444 | 3300026067 | Bacteria | 5165 |
| 227 | Ga0207678_10078740 | 3300026067 | Bacteria | 2822 |
| 228 | Ga0207678_10102238 | 3300026067 | Bacteria | 2446 |
| 229 | Ga0207702_10028286 | 3300026078 | Bacteria | 4658 |
| 230 | Ga0207641_10017560 | 3300026088 | Bacteria | 5858 |
| 231 | Ga0207641_10022398 | 3300026088 | Bacteria | 5201 |
| 232 | Ga0207641_10040042 | 3300026088 | Bacteria | 3920 |
| 233 | Ga0207641_10086736 | 3300026088 | Bacteria | 2730 |
| 234 | Ga0207648_10015459 | 3300026089 | Bacteria | 7019 |
| 235 | Ga0207648_10049998 | 3300026089 | Bacteria | 3656 |
| 236 | Ga0207676_10003563 | 3300026095 | Bacteria | 10999 |
| 237 | Ga0207676_10009112 | 3300026095 | Bacteria | 7069 |
| 238 | Ga0207674_10000291 | 3300026116 | Bacteria | 63446 |
| 239 | Ga0207674_10000527 | 3300026116 | Bacteria | 50282 |
| 240 | Ga0207674_10005390 | 3300026116 | Bacteria | 15219 |
| 241 | Ga0207674_10006708 | 3300026116 | Bacteria | 13516 |
| 242 | Ga0207674_10011858 | 3300026116 | Bacteria | 9770 |
| 243 | Ga0207674_10017349 | 3300026116 | Bacteria | 7855 |
| 244 | Ga0207674_10023128 | 3300026116 | Bacteria | 6663 |
| 245 | Ga0207674_10080925 | 3300026116 | Bacteria | 3251 |
| 246 | Ga0207674_10205519 | 3300026116 | Bacteria | 1919 |
| 247 | Ga0207698_10000388 | 3300026142 | Bacteria | 25382 |
| 248 | Ga0207698_10003289 | 3300026142 | Bacteria | 9716 |
| 249 | Ga0207698_10045186 | 3300026142 | Bacteria | 3316 |
| 250 | Ga0268266_10014057 | 3300028379 | Bacteria | 6891 |
| 251 | Ga0268266_10020692 | 3300028379 | Bacteria | 5608 |
| 252 | Ga0307413_10016128 | 3300031824 | Bacteria | 3849 |
| 253 | Ga0307416_100008789 | 3300032002 | Bacteria | 6550 |
| 254 | Ga0307416_100043198 | 3300032002 | Bacteria | 3527 |
| 255 | Ga0307414_10029208 | 3300032004 | Bacteria | 3586 |
| 256 | Ga0307411_10006836 | 3300032005 | Bacteria | 5744 |
| 257 | Ga0307411_10043863 | 3300032005 | Bacteria | 2864 |
| 258 | Ga0307415_100015784 | 3300032126 | Bacteria | 4484 |
| 259 | Ga0307415_100072678 | 3300032126 | Bacteria | 2423 |
| 260 | Ga0307415_100081701 | 3300032126 | Bacteria | 2309 |
| 261 | Ga0395899_0000225 | 3300037312 | Bacteria | 76673 |
| 262 | Ga0395899_0000287 | 3300037312 | Bacteria | 64885 |
| 263 | Ga0395899_0020496 | 3300037312 | Bacteria | 5011 |
| 264 | Ga0395899_0027086 | 3300037312 | Bacteria | 4323 |
| 265 | Ga0395899_0052649 | 3300037312 | Bacteria | 3016 |
| 266 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 267 | Ga0395900_0000667 | 3300037418 | Bacteria | 45770 |
| 268 | Ga0395900_0009437 | 3300037418 | Bacteria | 10001 |
| 269 | Ga0395900_0011349 | 3300037418 | Bacteria | 9114 |
| 270 | Ga0395900_0016538 | 3300037418 | Bacteria | 7525 |
| 271 | Ga0395900_0020351 | 3300037418 | Bacteria | 6773 |
| 272 | Ga0395900_0021255 | 3300037418 | Bacteria | 6635 |
| 273 | Ga0395900_0061033 | 3300037418 | Bacteria | 3877 |
| 274 | Ga0395900_0170208 | 3300037418 | Bacteria | 2218 |
| 275 | Ga0395900_0224126 | 3300037418 | Bacteria | 1893 |
| 276 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 277 | Ga0395898_0001423 | 3300037466 | Bacteria | 34055 |
| 278 | Ga0395898_0003799 | 3300037466 | Bacteria | 16718 |
| 279 | Ga0395898_0006374 | 3300037466 | Bacteria | 12605 |
| 280 | Ga0395898_0008195 | 3300037466 | Bacteria | 11054 |
| 281 | Ga0395898_0012131 | 3300037466 | Bacteria | 8917 |
| 282 | Ga0395898_0014897 | 3300037466 | Bacteria | 7982 |
| 283 | Ga0395898_0023568 | 3300037466 | Bacteria | 6218 |
| 284 | Ga0395898_0085443 | 3300037466 | Bacteria | 3041 |
| 285 | Ga0395905_0000006 | 3300037471 | Bacteria | 549428 |
| 286 | Ga0395905_0002222 | 3300037471 | Bacteria | 21895 |
| 287 | Ga0395905_0009030 | 3300037471 | Bacteria | 9780 |
| 288 | Ga0395905_0011286 | 3300037471 | Bacteria | 8635 |
| 289 | Ga0395905_0022515 | 3300037471 | Bacteria | 5960 |
| 290 | Ga0395905_0024947 | 3300037471 | Bacteria | 5640 |
| 291 | Ga0395905_0031240 | 3300037471 | Bacteria | 5015 |
| 292 | Ga0395905_0039638 | 3300037471 | Bacteria | 4419 |
| 293 | Ga0395905_0080026 | 3300037471 | Bacteria | 3062 |
| 294 | Ga0395905_0088947 | 3300037471 | Bacteria | 2894 |
| 295 | Ga0395905_0103755 | 3300037471 | Bacteria | 2669 |
| 296 | Ga0395905_0106271 | 3300037471 | Bacteria | 2636 |
| 297 | Ga0395905_0138540 | 3300037471 | Bacteria | 2289 |
| 298 | Ga0395901_0000035 | 3300038443 | Bacteria | 223888 |
| 299 | Ga0395901_0000329 | 3300038443 | Bacteria | 58460 |
| 300 | Ga0395901_0006312 | 3300038443 | Bacteria | 12008 |
| 301 | Ga0395901_0016918 | 3300038443 | Bacteria | 7433 |
| 302 | Ga0395901_0053685 | 3300038443 | Bacteria | 4187 |
| 303 | Ga0395901_0054288 | 3300038443 | Bacteria | 4164 |
| 304 | Ga0395901_0066662 | 3300038443 | Bacteria | 3749 |
| 305 | Ga0395901_0085473 | 3300038443 | Bacteria | 3298 |
| 306 | Ga0395901_0091378 | 3300038443 | Bacteria | 3186 |
| 307 | Ga0395901_0130307 | 3300038443 | Bacteria | 2642 |
| 308 | Ga0395901_0167755 | 3300038443 | Bacteria | 2304 |
| 309 | Ga0395901_0212835 | 3300038443 | Bacteria | 2022 |
| 310 | Ga0436365_0963667 | 3300039437 | Bacteria | 3389 |
| 311 | Ga0436365_1507661 | 3300039437 | Bacteria | 37687 |
| 312 | Ga0439458_0000016 | 3300042157 | Bacteria | 26319 |
| 313 | Ga0439464_0008394 | 3300042439 | Bacteria | 2707 |
| 314 | Ga0466969_0003047 | 3300044656 | Bacteria | 8932 |
| 315 | Ga0466966_0007715 | 3300044684 | Bacteria | 7125 |
| 316 | Ga0466961_0013602 | 3300044693 | Bacteria | 5212 |
| 317 | Ga0466961_0021897 | 3300044693 | Bacteria | 4113 |
| 318 | Ga0466963_0000335 | 3300044694 | Bacteria | 21343 |
| 319 | Ga0466963_0004259 | 3300044694 | Bacteria | 8302 |
| 320 | Ga0466963_0144923 | 3300044694 | Bacteria | 1647 |
| 321 | Ga0466971_0012140 | 3300044719 | Bacteria | 3774 |
| 322 | Ga0466971_0013009 | 3300044719 | Bacteria | 3650 |
| 323 | Ga0466957_0007713 | 3300044842 | Bacteria | 6087 |
| 324 | Ga0466959_0024251 | 3300045049 | Bacteria | 4492 |
| 325 | Ga0466958_0000295 | 3300045836 | Bacteria | 19538 |
| 326 | Ga0466958_0002056 | 3300045836 | Bacteria | 9943 |
| 327 | Ga0466958_0041459 | 3300045836 | Bacteria | 2769 |
| 328 | Ga0466967_0020512 | 3300045976 | Bacteria | 5345 |
| 329 | Ga0466967_0037476 | 3300045976 | Bacteria | 4150 |
| 330 | Ga0466967_0058913 | 3300045976 | Bacteria | 3396 |
| 331 | Ga0495669_0030883 | 3300046684 | Bacteria | 2351 |
| 332 | Ga0496100_0019604 | 3300048903 | Bacteria | 4038 |
| 333 | Ga0496102_0021682 | 3300048905 | Bacteria | 5683 |
| 334 | Ga0496102_0031714 | 3300048905 | Bacteria | 4743 |
| 335 | Ga0496102_0063086 | 3300048905 | Bacteria | 3393 |
| 336 | Ga0496102_0090447 | 3300048905 | Bacteria | 2833 |
| 337 | Ga0496107_0011337 | 3300048910 | Bacteria | 6204 |
| 338 | Ga0496108_0001925 | 3300048911 | Bacteria | 16631 |
| 339 | Ga0496108_0009632 | 3300048911 | Bacteria | 7832 |
| 340 | Ga0496109_0023088 | 3300048912 | Bacteria | 5517 |
| 341 | Ga0496111_0002477 | 3300048914 | Bacteria | 11134 |
| 342 | Ga0496112_0002858 | 3300048915 | Bacteria | 14027 |
| 343 | Ga0496112_0052739 | 3300048915 | Bacteria | 3992 |
| 344 | Ga0496113_0012777 | 3300048916 | Bacteria | 5657 |
| 345 | Ga0496113_0016617 | 3300048916 | Bacteria | 5087 |
| 346 | Ga0496113_0067349 | 3300048916 | Bacteria | 2714 |
| 347 | Ga0496115_0018686 | 3300048918 | Bacteria | 5328 |
| 348 | Ga0496115_0080272 | 3300048918 | Bacteria | 2656 |
| 349 | Ga0501257_006438 | 3300049686 | Bacteria | 2605 |
| 350 | Ga0466962_0020090 | 3300061719 | Bacteria | 3210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044694 | Ga0466963_0144923 | Ga0466963_0144923_165_1622 | 485 |
| 2 | 3300038443 | Ga0395901_0130307 | Ga0395901_0130307_74_1600 | 497 |
| 3 | 3300025921 | Ga0207652_10024932 | Ga0207652_100249326 | 500 |
| 4 | 3300037471 | Ga0395905_0022515 | Ga0395905_0022515_3454_5148 | 532 |
| 5 | 3300038443 | Ga0395901_0212835 | Ga0395901_0212835_239_1933 | 532 |
| 6 | 3300026142 | Ga0207698_10045186 | Ga0207698_100451862 | 535 |
| 7 | 3300005366 | Ga0070659_100054143 | Ga0070659_1000541432 | 538 |
| 8 | 3300025919 | Ga0207657_10000806 | Ga0207657_1000080632 | 538 |
| 9 | 3300025919 | Ga0207657_10067654 | Ga0207657_100676542 | 538 |
| 10 | 3300037471 | Ga0395905_0080026 | Ga0395905_0080026_697_2427 | 538 |
| 11 | 3300025949 | Ga0207667_10030495 | Ga0207667_100304952 | 539 |
| 12 | 3300037418 | Ga0395900_0016538 | Ga0395900_0016538_5209_6897 | 539 |
| 13 | 3300037471 | Ga0395905_0011286 | Ga0395905_0011286_617_2317 | 539 |
| 14 | 3300038443 | Ga0395901_0000329 | Ga0395901_0000329_46948_48636 | 539 |
| 15 | 3300005339 | Ga0070660_100001159 | Ga0070660_10000115914 | 540 |
| 16 | 3300005341 | Ga0070691_10031868 | Ga0070691_100318681 | 540 |
| 17 | 3300005344 | Ga0070661_100004337 | Ga0070661_1000043376 | 540 |
| 18 | 3300005366 | Ga0070659_100004174 | Ga0070659_1000041749 | 540 |
| 19 | 3300005530 | Ga0070679_100019105 | Ga0070679_1000191054 | 540 |
| 20 | 3300005535 | Ga0070684_100136385 | Ga0070684_1001363851 | 540 |
| 21 | 3300005563 | Ga0068855_100026207 | Ga0068855_1000262077 | 540 |
| 22 | 3300005577 | Ga0068857_100025428 | Ga0068857_1000254285 | 540 |
| 23 | 3300009093 | Ga0105240_10023135 | Ga0105240_100231358 | 540 |
| 24 | 3300009551 | Ga0105238_10014766 | Ga0105238_100147665 | 540 |
| 25 | 3300013100 | Ga0157373_10003505 | Ga0157373_100035054 | 540 |
| 26 | 3300013104 | Ga0157370_10002640 | Ga0157370_100026403 | 540 |
| 27 | 3300025904 | Ga0207647_10012008 | Ga0207647_100120085 | 540 |
| 28 | 3300025909 | Ga0207705_10027473 | Ga0207705_100274734 | 540 |
| 29 | 3300025913 | Ga0207695_10019220 | Ga0207695_100192206 | 540 |
| 30 | 3300025919 | Ga0207657_10000946 | Ga0207657_1000094610 | 540 |
| 31 | 3300025920 | Ga0207649_10009705 | Ga0207649_100097053 | 540 |
| 32 | 3300025924 | Ga0207694_10002217 | Ga0207694_100022174 | 540 |
| 33 | 3300025932 | Ga0207690_10005486 | Ga0207690_100054866 | 540 |
| 34 | 3300025949 | Ga0207667_10038532 | Ga0207667_100385324 | 540 |
| 35 | 3300025981 | Ga0207640_10017254 | Ga0207640_100172545 | 540 |
| 36 | 3300026041 | Ga0207639_10000199 | Ga0207639_1000019944 | 540 |
| 37 | 3300026116 | Ga0207674_10005390 | Ga0207674_1000539010 | 540 |
| 38 | 3300026142 | Ga0207698_10000388 | Ga0207698_100003886 | 540 |
| 39 | 3300037418 | Ga0395900_0170208 | Ga0395900_0170208_12_1718 | 540 |
| 40 | 3300026089 | Ga0207648_10049998 | Ga0207648_100499983 | 541 |
| 41 | 3300037418 | Ga0395900_0224126 | Ga0395900_0224126_77_1783 | 541 |
| 42 | 3300037466 | Ga0395898_0014897 | Ga0395898_0014897_6200_7906 | 541 |
| 43 | 3300025929 | Ga0207664_10091243 | Ga0207664_100912432 | 542 |
| 44 | 3300044656 | Ga0466969_0003047 | Ga0466969_0003047_4924_6630 | 543 |
| 45 | 3300044684 | Ga0466966_0007715 | Ga0466966_0007715_2965_4671 | 543 |
| 46 | 3300044693 | Ga0466961_0013602 | Ga0466961_0013602_2332_4038 | 543 |
| 47 | 3300044719 | Ga0466971_0012140 | Ga0466971_0012140_1093_2799 | 543 |
| 48 | 3300045049 | Ga0466959_0024251 | Ga0466959_0024251_1175_2881 | 543 |
| 49 | 3300045836 | Ga0466958_0002056 | Ga0466958_0002056_1263_2969 | 543 |
| 50 | 3300045976 | Ga0466967_0020512 | Ga0466967_0020512_1551_3257 | 543 |
| 51 | 3300061719 | Ga0466962_0020090 | Ga0466962_0020090_1058_2764 | 543 |
| 52 | 3300005339 | Ga0070660_100004955 | Ga0070660_10000495510 | 544 |
| 53 | 3300009093 | Ga0105240_10010767 | Ga0105240_100107676 | 544 |
| 54 | 3300013102 | Ga0157371_10006517 | Ga0157371_100065172 | 544 |
| 55 | 3300013102 | Ga0157371_10052294 | Ga0157371_100522942 | 544 |
| 56 | 3300025909 | Ga0207705_10000929 | Ga0207705_1000092923 | 544 |
| 57 | 3300025919 | Ga0207657_10000498 | Ga0207657_1000049811 | 544 |
| 58 | 3300025949 | Ga0207667_10057674 | Ga0207667_100576745 | 544 |
| 59 | 3300025981 | Ga0207640_10000794 | Ga0207640_1000079423 | 544 |
| 60 | 3300009545 | Ga0105237_10044364 | Ga0105237_100443644 | 545 |
| 61 | 3300028379 | Ga0268266_10014057 | Ga0268266_100140575 | 545 |
| 62 | 3300044694 | Ga0466963_0000335 | Ga0466963_0000335_11083_12789 | 545 |
| 63 | 3300005539 | Ga0068853_100019243 | Ga0068853_1000192432 | 547 |
| 64 | 3300044719 | Ga0466971_0013009 | Ga0466971_0013009_292_1998 | 548 |
| 65 | 3300026078 | Ga0207702_10028286 | Ga0207702_100282863 | 549 |
| 66 | 3300044693 | Ga0466961_0021897 | Ga0466961_0021897_2003_3709 | 549 |
| 67 | 3300013105 | Ga0157369_10000106 | Ga0157369_1000010614 | 550 |
| 68 | 3300013105 | Ga0157369_10013407 | Ga0157369_100134073 | 550 |
| 69 | 3300025932 | Ga0207690_10024433 | Ga0207690_100244333 | 550 |
| 70 | 3300032002 | Ga0307416_100008789 | Ga0307416_1000087895 | 550 |
| 71 | 3300005455 | Ga0070663_100005583 | Ga0070663_1000055832 | 552 |
| 72 | 3300025904 | Ga0207647_10057227 | Ga0207647_100572271 | 552 |
| 73 | 3300037312 | Ga0395899_0052649 | Ga0395899_0052649_372_2078 | 552 |
| 74 | 3300046684 | Ga0495669_0030883 | Ga0495669_0030883_558_2261 | 552 |
| 75 | 3300039437 | Ga0436365_1507661 | Ga0436365_1507661_4616_6322 | 553 |
| 76 | 3300026116 | Ga0207674_10011858 | Ga0207674_100118585 | 554 |
| 77 | 3300037418 | Ga0395900_0021255 | Ga0395900_0021255_1740_3443 | 554 |
| 78 | 3300037471 | Ga0395905_0039638 | Ga0395905_0039638_1740_3443 | 554 |
| 79 | 3300005344 | Ga0070661_100109555 | Ga0070661_1001095552 | 555 |
| 80 | 3300005564 | Ga0070664_100086816 | Ga0070664_1000868162 | 555 |
| 81 | 3300025920 | Ga0207649_10021124 | Ga0207649_100211245 | 555 |
| 82 | 3300025932 | Ga0207690_10078869 | Ga0207690_100788692 | 555 |
| 83 | 3300037471 | Ga0395905_0088947 | Ga0395905_0088947_386_2092 | 555 |
| 84 | 3300038443 | Ga0395901_0054288 | Ga0395901_0054288_2285_3991 | 555 |
| 85 | 3300045836 | Ga0466958_0041459 | Ga0466958_0041459_241_1947 | 555 |
| 86 | 3300025909 | Ga0207705_10029679 | Ga0207705_100296793 | 556 |
| 87 | 3300037471 | Ga0395905_0138540 | Ga0395905_0138540_197_1903 | 556 |
| 88 | 3300042157 | Ga0439458_0000016 | Ga0439458_0000016_13715_15421 | 556 |
| 89 | 3300005345 | Ga0070692_10034057 | Ga0070692_100340572 | 557 |
| 90 | 3300005455 | Ga0070663_100033035 | Ga0070663_1000330355 | 557 |
| 91 | 3300021384 | Ga0213876_10033616 | Ga0213876_100336162 | 557 |
| 92 | 3300037418 | Ga0395900_0020351 | Ga0395900_0020351_2965_4671 | 557 |
| 93 | 3300037418 | Ga0395900_0061033 | Ga0395900_0061033_936_2645 | 557 |
| 94 | 3300037471 | Ga0395905_0024947 | Ga0395905_0024947_2237_3943 | 557 |
| 95 | 3300037471 | Ga0395905_0106271 | Ga0395905_0106271_413_2116 | 557 |
| 96 | 3300038443 | Ga0395901_0053685 | Ga0395901_0053685_1150_2859 | 557 |
| 97 | 3300026067 | Ga0207678_10102238 | Ga0207678_101022383 | 558 |
| 98 | 3300037466 | Ga0395898_0023568 | Ga0395898_0023568_1090_2823 | 558 |
| 99 | 3300038443 | Ga0395901_0167755 | Ga0395901_0167755_431_2137 | 558 |
| 100 | 3300048918 | Ga0496115_0018686 | Ga0496115_0018686_1259_2965 | 558 |
| 101 | 3300005564 | Ga0070664_100000796 | Ga0070664_10000079623 | 559 |
| 102 | 3300005841 | Ga0068863_100025366 | Ga0068863_1000253668 | 559 |
| 103 | 3300005842 | Ga0068858_100009043 | Ga0068858_1000090438 | 559 |
| 104 | 3300025933 | Ga0207706_10077592 | Ga0207706_100775923 | 559 |
| 105 | 3300025986 | Ga0207658_10121347 | Ga0207658_101213471 | 559 |
| 106 | 3300026035 | Ga0207703_10101164 | Ga0207703_101011642 | 559 |
| 107 | 3300037418 | Ga0395900_0011349 | Ga0395900_0011349_1043_2776 | 559 |
| 108 | 3300037466 | Ga0395898_0006374 | Ga0395898_0006374_3225_4931 | 559 |
| 109 | 3300038443 | Ga0395901_0006312 | Ga0395901_0006312_7745_9451 | 559 |
| 110 | 3300048905 | Ga0496102_0021682 | Ga0496102_0021682_3543_5258 | 559 |
| 111 | 3300048911 | Ga0496108_0009632 | Ga0496108_0009632_5660_7375 | 559 |
| 112 | 3300048912 | Ga0496109_0023088 | Ga0496109_0023088_3484_5199 | 559 |
| 113 | 3300048914 | Ga0496111_0002477 | Ga0496111_0002477_4731_6446 | 559 |
| 114 | 3300048916 | Ga0496113_0012777 | Ga0496113_0012777_197_1912 | 559 |
| 115 | 3300021384 | Ga0213876_10002997 | Ga0213876_100029976 | 560 |
| 116 | 3300032126 | Ga0307415_100081701 | Ga0307415_1000817012 | 560 |
| 117 | 3300049686 | Ga0501257_006438 | Ga0501257_006438_35_1741 | 560 |
| 118 | 3300005339 | Ga0070660_100097077 | Ga0070660_1000970773 | 561 |
| 119 | 3300005366 | Ga0070659_100006754 | Ga0070659_1000067545 | 561 |
| 120 | 3300005457 | Ga0070662_100036277 | Ga0070662_1000362776 | 561 |
| 121 | 3300005564 | Ga0070664_100001230 | Ga0070664_10000123017 | 561 |
| 122 | 3300013102 | Ga0157371_10088500 | Ga0157371_100885002 | 561 |
| 123 | 3300025919 | Ga0207657_10065537 | Ga0207657_100655372 | 561 |
| 124 | 3300025932 | Ga0207690_10001173 | Ga0207690_100011738 | 561 |
| 125 | 3300025933 | Ga0207706_10071112 | Ga0207706_100711124 | 561 |
| 126 | 3300025945 | Ga0207679_10032415 | Ga0207679_100324154 | 561 |
| 127 | 3300001990 | JGI24737J22298_10005397 | JGI24737J22298_100053975 | 562 |
| 128 | 3300005327 | Ga0070658_10002803 | Ga0070658_1000280312 | 562 |
| 129 | 3300005339 | Ga0070660_100007977 | Ga0070660_1000079774 | 562 |
| 130 | 3300005353 | Ga0070669_100038156 | Ga0070669_1000381566 | 562 |
| 131 | 3300005366 | Ga0070659_100010044 | Ga0070659_1000100444 | 562 |
| 132 | 3300005457 | Ga0070662_100001014 | Ga0070662_10000101419 | 562 |
| 133 | 3300005842 | Ga0068858_100032745 | Ga0068858_1000327454 | 562 |
| 134 | 3300009553 | Ga0105249_10113495 | Ga0105249_101134952 | 562 |
| 135 | 3300025904 | Ga0207647_10000114 | Ga0207647_1000011454 | 562 |
| 136 | 3300025909 | Ga0207705_10063220 | Ga0207705_100632202 | 562 |
| 137 | 3300025919 | Ga0207657_10058802 | Ga0207657_100588023 | 562 |
| 138 | 3300025932 | Ga0207690_10001468 | Ga0207690_100014685 | 562 |
| 139 | 3300025933 | Ga0207706_10001330 | Ga0207706_1000133019 | 562 |
| 140 | 3300025942 | Ga0207689_10019923 | Ga0207689_100199236 | 562 |
| 141 | 3300025961 | Ga0207712_10000513 | Ga0207712_1000051322 | 562 |
| 142 | 3300025972 | Ga0207668_10102099 | Ga0207668_101020992 | 562 |
| 143 | 3300026035 | Ga0207703_10029489 | Ga0207703_100294894 | 562 |
| 144 | 3300026041 | Ga0207639_10046980 | Ga0207639_100469803 | 562 |
| 145 | 3300026088 | Ga0207641_10086736 | Ga0207641_100867362 | 562 |
| 146 | 3300026116 | Ga0207674_10023128 | Ga0207674_100231286 | 562 |
| 147 | 3300026116 | Ga0207674_10205519 | Ga0207674_102055192 | 562 |
| 148 | 3300037312 | Ga0395899_0000287 | Ga0395899_0000287_47266_48960 | 562 |
| 149 | 3300037418 | Ga0395900_0000031 | Ga0395900_0000031_211551_213245 | 562 |
| 150 | 3300037466 | Ga0395898_0012131 | Ga0395898_0012131_4407_6101 | 562 |
| 151 | 3300038443 | Ga0395901_0000035 | Ga0395901_0000035_72667_74361 | 562 |
| 152 | 3300037471 | Ga0395905_0103755 | Ga0395905_0103755_134_1831 | 564 |
| 153 | 3300001990 | JGI24737J22298_10000229 | JGI24737J22298_1000022913 | 565 |
| 154 | 3300005334 | Ga0068869_100004062 | Ga0068869_1000040627 | 565 |
| 155 | 3300005338 | Ga0068868_100000881 | Ga0068868_10000088117 | 565 |
| 156 | 3300005339 | Ga0070660_100030447 | Ga0070660_1000304475 | 565 |
| 157 | 3300005355 | Ga0070671_100010200 | Ga0070671_1000102003 | 565 |
| 158 | 3300005364 | Ga0070673_100006064 | Ga0070673_1000060647 | 565 |
| 159 | 3300005366 | Ga0070659_100001672 | Ga0070659_10000167215 | 565 |
| 160 | 3300005367 | Ga0070667_100003302 | Ga0070667_10000330213 | 565 |
| 161 | 3300005367 | Ga0070667_100025102 | Ga0070667_1000251023 | 565 |
| 162 | 3300005457 | Ga0070662_100007201 | Ga0070662_1000072014 | 565 |
| 163 | 3300005459 | Ga0068867_100005300 | Ga0068867_1000053007 | 565 |
| 164 | 3300005539 | Ga0068853_100006858 | Ga0068853_10000685812 | 565 |
| 165 | 3300005543 | Ga0070672_100005149 | Ga0070672_10000514910 | 565 |
| 166 | 3300005564 | Ga0070664_100026695 | Ga0070664_1000266953 | 565 |
| 167 | 3300005577 | Ga0068857_100003503 | Ga0068857_10000350311 | 565 |
| 168 | 3300005578 | Ga0068854_100014647 | Ga0068854_1000146474 | 565 |
| 169 | 3300005616 | Ga0068852_100040998 | Ga0068852_1000409984 | 565 |
| 170 | 3300005617 | Ga0068859_100011725 | Ga0068859_1000117256 | 565 |
| 171 | 3300005618 | Ga0068864_100002050 | Ga0068864_1000020508 | 565 |
| 172 | 3300005719 | Ga0068861_100024487 | Ga0068861_1000244873 | 565 |
| 173 | 3300005841 | Ga0068863_100044232 | Ga0068863_1000442328 | 565 |
| 174 | 3300005842 | Ga0068858_100023047 | Ga0068858_1000230477 | 565 |
| 175 | 3300005843 | Ga0068860_100007732 | Ga0068860_1000077325 | 565 |
| 176 | 3300005844 | Ga0068862_100071393 | Ga0068862_1000713932 | 565 |
| 177 | 3300006237 | Ga0097621_100049163 | Ga0097621_1000491634 | 565 |
| 178 | 3300006931 | Ga0097620_100011725 | Ga0097620_1000117256 | 565 |
| 179 | 3300009098 | Ga0105245_10000285 | Ga0105245_1000028539 | 565 |
| 180 | 3300009174 | Ga0105241_10075249 | Ga0105241_100752493 | 565 |
| 181 | 3300009177 | Ga0105248_10006610 | Ga0105248_1000661012 | 565 |
| 182 | 3300013100 | Ga0157373_10027556 | Ga0157373_100275566 | 565 |
| 183 | 3300013102 | Ga0157371_10009211 | Ga0157371_100092114 | 565 |
| 184 | 3300013102 | Ga0157371_10012175 | Ga0157371_100121756 | 565 |
| 185 | 3300013297 | Ga0157378_10001258 | Ga0157378_1000125813 | 565 |
| 186 | 3300013308 | Ga0157375_10050841 | Ga0157375_100508414 | 565 |
| 187 | 3300014745 | Ga0157377_10070074 | Ga0157377_100700742 | 565 |
| 188 | 3300025315 | Ga0207697_10000158 | Ga0207697_1000015812 | 565 |
| 189 | 3300025901 | Ga0207688_10000924 | Ga0207688_1000092413 | 565 |
| 190 | 3300025904 | Ga0207647_10000253 | Ga0207647_1000025315 | 565 |
| 191 | 3300025925 | Ga0207650_10005137 | Ga0207650_100051373 | 565 |
| 192 | 3300025925 | Ga0207650_10006767 | Ga0207650_100067677 | 565 |
| 193 | 3300025927 | Ga0207687_10012151 | Ga0207687_100121518 | 565 |
| 194 | 3300025931 | Ga0207644_10009397 | Ga0207644_100093973 | 565 |
| 195 | 3300025933 | Ga0207706_10000643 | Ga0207706_1000064335 | 565 |
| 196 | 3300025933 | Ga0207706_10004270 | Ga0207706_1000427011 | 565 |
| 197 | 3300025940 | Ga0207691_10015876 | Ga0207691_1001587611 | 565 |
| 198 | 3300025941 | Ga0207711_10005082 | Ga0207711_1000508212 | 565 |
| 199 | 3300025942 | Ga0207689_10000017 | Ga0207689_1000001741 | 565 |
| 200 | 3300025986 | Ga0207658_10003102 | Ga0207658_100031025 | 565 |
| 201 | 3300026035 | Ga0207703_10006790 | Ga0207703_100067907 | 565 |
| 202 | 3300026067 | Ga0207678_10001692 | Ga0207678_1000169218 | 565 |
| 203 | 3300026088 | Ga0207641_10022398 | Ga0207641_100223983 | 565 |
| 204 | 3300026089 | Ga0207648_10015459 | Ga0207648_100154594 | 565 |
| 205 | 3300026116 | Ga0207674_10017349 | Ga0207674_100173497 | 565 |
| 206 | 3300026142 | Ga0207698_10003289 | Ga0207698_100032893 | 565 |
| 207 | 3300028379 | Ga0268266_10020692 | Ga0268266_100206925 | 565 |
| 208 | 3300032005 | Ga0307411_10043863 | Ga0307411_100438632 | 565 |
| 209 | 3300032126 | Ga0307415_100072678 | Ga0307415_1000726783 | 565 |
| 210 | 3300005577 | Ga0068857_100004979 | Ga0068857_10000497912 | 566 |
| 211 | 3300025907 | Ga0207645_10003650 | Ga0207645_100036505 | 566 |
| 212 | 3300025919 | Ga0207657_10022778 | Ga0207657_100227782 | 566 |
| 213 | 3300025933 | Ga0207706_10086984 | Ga0207706_100869843 | 566 |
| 214 | 3300026067 | Ga0207678_10078740 | Ga0207678_100787402 | 566 |
| 215 | 3300026116 | Ga0207674_10000527 | Ga0207674_1000052716 | 566 |
| 216 | 3300005327 | Ga0070658_10039751 | Ga0070658_100397513 | 567 |
| 217 | 3300005327 | Ga0070658_10090038 | Ga0070658_100900381 | 567 |
| 218 | 3300005344 | Ga0070661_100034038 | Ga0070661_1000340386 | 567 |
| 219 | 3300005366 | Ga0070659_100001497 | Ga0070659_10000149715 | 567 |
| 220 | 3300005366 | Ga0070659_100050919 | Ga0070659_1000509193 | 567 |
| 221 | 3300005455 | Ga0070663_100002429 | Ga0070663_10000242910 | 567 |
| 222 | 3300005539 | Ga0068853_100015471 | Ga0068853_1000154718 | 567 |
| 223 | 3300005564 | Ga0070664_100091393 | Ga0070664_1000913932 | 567 |
| 224 | 3300005578 | Ga0068854_100027254 | Ga0068854_1000272543 | 567 |
| 225 | 3300005616 | Ga0068852_100033057 | Ga0068852_1000330575 | 567 |
| 226 | 3300013105 | Ga0157369_10011956 | Ga0157369_100119569 | 567 |
| 227 | 3300013296 | Ga0157374_10029251 | Ga0157374_100292515 | 567 |
| 228 | 3300025909 | Ga0207705_10007878 | Ga0207705_100078783 | 567 |
| 229 | 3300025909 | Ga0207705_10032252 | Ga0207705_100322523 | 567 |
| 230 | 3300025909 | Ga0207705_10084720 | Ga0207705_100847203 | 567 |
| 231 | 3300025919 | Ga0207657_10023777 | Ga0207657_100237773 | 567 |
| 232 | 3300025919 | Ga0207657_10025765 | Ga0207657_100257656 | 567 |
| 233 | 3300025945 | Ga0207679_10034517 | Ga0207679_100345173 | 567 |
| 234 | 3300026067 | Ga0207678_10020008 | Ga0207678_100200084 | 567 |
| 235 | 3300026116 | Ga0207674_10080925 | Ga0207674_100809253 | 567 |
| 236 | 3300031824 | Ga0307413_10016128 | Ga0307413_100161283 | 567 |
| 237 | 3300032002 | Ga0307416_100043198 | Ga0307416_1000431983 | 567 |
| 238 | 3300032004 | Ga0307414_10029208 | Ga0307414_100292084 | 567 |
| 239 | 3300032005 | Ga0307411_10006836 | Ga0307411_100068366 | 567 |
| 240 | 3300032126 | Ga0307415_100015784 | Ga0307415_1000157846 | 567 |
| 241 | 3300037418 | Ga0395900_0000667 | Ga0395900_0000667_9709_11412 | 567 |
| 242 | 3300037466 | Ga0395898_0001423 | Ga0395898_0001423_25320_27023 | 567 |
| 243 | 3300038443 | Ga0395901_0091378 | Ga0395901_0091378_1150_2853 | 567 |
| 244 | 3300042439 | Ga0439464_0008394 | Ga0439464_0008394_179_1897 | 567 |
| 245 | 3300048916 | Ga0496113_0016617 | Ga0496113_0016617_1139_2842 | 567 |
| 246 | 3300001915 | JGI24741J21665_1003115 | JGI24741J21665_10031153 | 568 |
| 247 | 3300001990 | JGI24737J22298_10001469 | JGI24737J22298_100014696 | 568 |
| 248 | 3300001990 | JGI24737J22298_10006449 | JGI24737J22298_100064495 | 568 |
| 249 | 3300002067 | JGI24735J21928_10000919 | JGI24735J21928_1000091910 | 568 |
| 250 | 3300005331 | Ga0070670_100024585 | Ga0070670_1000245851 | 568 |
| 251 | 3300005331 | Ga0070670_100027175 | Ga0070670_1000271755 | 568 |
| 252 | 3300005335 | Ga0070666_10000630 | Ga0070666_1000063020 | 568 |
| 253 | 3300005338 | Ga0068868_100083093 | Ga0068868_1000830932 | 568 |
| 254 | 3300005339 | Ga0070660_100024417 | Ga0070660_1000244173 | 568 |
| 255 | 3300005344 | Ga0070661_100074397 | Ga0070661_1000743973 | 568 |
| 256 | 3300005355 | Ga0070671_100022193 | Ga0070671_1000221933 | 568 |
| 257 | 3300005355 | Ga0070671_100075982 | Ga0070671_1000759824 | 568 |
| 258 | 3300005355 | Ga0070671_100076714 | Ga0070671_1000767144 | 568 |
| 259 | 3300005355 | Ga0070671_100087303 | Ga0070671_1000873032 | 568 |
| 260 | 3300005364 | Ga0070673_100000613 | Ga0070673_10000061321 | 568 |
| 261 | 3300005364 | Ga0070673_100027808 | Ga0070673_1000278085 | 568 |
| 262 | 3300005367 | Ga0070667_100003077 | Ga0070667_1000030777 | 568 |
| 263 | 3300005436 | Ga0070713_100021196 | Ga0070713_1000211966 | 568 |
| 264 | 3300005456 | Ga0070678_100001960 | Ga0070678_1000019606 | 568 |
| 265 | 3300005456 | Ga0070678_100006370 | Ga0070678_1000063705 | 568 |
| 266 | 3300005457 | Ga0070662_100001950 | Ga0070662_1000019508 | 568 |
| 267 | 3300005458 | Ga0070681_10024034 | Ga0070681_100240345 | 568 |
| 268 | 3300005530 | Ga0070679_100102636 | Ga0070679_1001026362 | 568 |
| 269 | 3300005535 | Ga0070684_100047718 | Ga0070684_1000477183 | 568 |
| 270 | 3300005543 | Ga0070672_100001691 | Ga0070672_10000169110 | 568 |
| 271 | 3300005563 | Ga0068855_100052153 | Ga0068855_1000521535 | 568 |
| 272 | 3300005564 | Ga0070664_100006146 | Ga0070664_1000061468 | 568 |
| 273 | 3300005564 | Ga0070664_100006440 | Ga0070664_1000064407 | 568 |
| 274 | 3300005564 | Ga0070664_100151513 | Ga0070664_1001515132 | 568 |
| 275 | 3300005577 | Ga0068857_100004732 | Ga0068857_1000047327 | 568 |
| 276 | 3300005577 | Ga0068857_100054109 | Ga0068857_1000541095 | 568 |
| 277 | 3300005578 | Ga0068854_100087339 | Ga0068854_1000873392 | 568 |
| 278 | 3300005614 | Ga0068856_100160448 | Ga0068856_1001604481 | 568 |
| 279 | 3300005618 | Ga0068864_100003062 | Ga0068864_1000030626 | 568 |
| 280 | 3300005841 | Ga0068863_100012542 | Ga0068863_1000125422 | 568 |
| 281 | 3300005841 | Ga0068863_100105246 | Ga0068863_1001052462 | 568 |
| 282 | 3300006195 | Ga0075366_10073801 | Ga0075366_100738011 | 568 |
| 283 | 3300006237 | Ga0097621_100089069 | Ga0097621_1000890692 | 568 |
| 284 | 3300006358 | Ga0068871_100005970 | Ga0068871_1000059703 | 568 |
| 285 | 3300009098 | Ga0105245_10011260 | Ga0105245_100112607 | 568 |
| 286 | 3300009177 | Ga0105248_10004871 | Ga0105248_100048713 | 568 |
| 287 | 3300009177 | Ga0105248_10008019 | Ga0105248_100080194 | 568 |
| 288 | 3300013102 | Ga0157371_10039194 | Ga0157371_100391943 | 568 |
| 289 | 3300013306 | Ga0163162_10003164 | Ga0163162_100031643 | 568 |
| 290 | 3300014325 | Ga0163163_10003524 | Ga0163163_100035248 | 568 |
| 291 | 3300025904 | Ga0207647_10012561 | Ga0207647_100125617 | 568 |
| 292 | 3300025904 | Ga0207647_10043786 | Ga0207647_100437862 | 568 |
| 293 | 3300025909 | Ga0207705_10002967 | Ga0207705_100029675 | 568 |
| 294 | 3300025909 | Ga0207705_10024855 | Ga0207705_100248555 | 568 |
| 295 | 3300025919 | Ga0207657_10000504 | Ga0207657_1000050410 | 568 |
| 296 | 3300025921 | Ga0207652_10143450 | Ga0207652_101434502 | 568 |
| 297 | 3300025927 | Ga0207687_10021225 | Ga0207687_100212255 | 568 |
| 298 | 3300025928 | Ga0207700_10016295 | Ga0207700_100162956 | 568 |
| 299 | 3300025931 | Ga0207644_10007787 | Ga0207644_100077877 | 568 |
| 300 | 3300025931 | Ga0207644_10026579 | Ga0207644_100265793 | 568 |
| 301 | 3300025931 | Ga0207644_10032260 | Ga0207644_100322602 | 568 |
| 302 | 3300025931 | Ga0207644_10057448 | Ga0207644_100574482 | 568 |
| 303 | 3300025931 | Ga0207644_10081508 | Ga0207644_100815082 | 568 |
| 304 | 3300025933 | Ga0207706_10002629 | Ga0207706_1000262912 | 568 |
| 305 | 3300025933 | Ga0207706_10035781 | Ga0207706_100357811 | 568 |
| 306 | 3300025933 | Ga0207706_10048264 | Ga0207706_100482643 | 568 |
| 307 | 3300025933 | Ga0207706_10079656 | Ga0207706_100796561 | 568 |
| 308 | 3300025941 | Ga0207711_10011332 | Ga0207711_100113325 | 568 |
| 309 | 3300025941 | Ga0207711_10103482 | Ga0207711_101034822 | 568 |
| 310 | 3300025986 | Ga0207658_10015187 | Ga0207658_100151873 | 568 |
| 311 | 3300025986 | Ga0207658_10069307 | Ga0207658_100693073 | 568 |
| 312 | 3300026023 | Ga0207677_10056727 | Ga0207677_100567272 | 568 |
| 313 | 3300026067 | Ga0207678_10025444 | Ga0207678_100254446 | 568 |
| 314 | 3300026088 | Ga0207641_10017560 | Ga0207641_100175605 | 568 |
| 315 | 3300026088 | Ga0207641_10040042 | Ga0207641_100400423 | 568 |
| 316 | 3300026095 | Ga0207676_10003563 | Ga0207676_100035638 | 568 |
| 317 | 3300026095 | Ga0207676_10009112 | Ga0207676_100091126 | 568 |
| 318 | 3300026116 | Ga0207674_10000291 | Ga0207674_100002916 | 568 |
| 319 | 3300026116 | Ga0207674_10006708 | Ga0207674_100067086 | 568 |
| 320 | 3300037312 | Ga0395899_0000225 | Ga0395899_0000225_26116_27822 | 568 |
| 321 | 3300037312 | Ga0395899_0020496 | Ga0395899_0020496_454_2160 | 568 |
| 322 | 3300037312 | Ga0395899_0027086 | Ga0395899_0027086_2243_3949 | 568 |
| 323 | 3300037418 | Ga0395900_0009437 | Ga0395900_0009437_7829_9535 | 568 |
| 324 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_151304_153010 | 568 |
| 325 | 3300037466 | Ga0395898_0003799 | Ga0395898_0003799_9017_10723 | 568 |
| 326 | 3300037466 | Ga0395898_0008195 | Ga0395898_0008195_5816_7624 | 568 |
| 327 | 3300037466 | Ga0395898_0085443 | Ga0395898_0085443_279_2027 | 568 |
| 328 | 3300037471 | Ga0395905_0000006 | Ga0395905_0000006_367556_369262 | 568 |
| 329 | 3300037471 | Ga0395905_0002222 | Ga0395905_0002222_2158_3864 | 568 |
| 330 | 3300037471 | Ga0395905_0009030 | Ga0395905_0009030_3154_4902 | 568 |
| 331 | 3300037471 | Ga0395905_0031240 | Ga0395905_0031240_2276_3982 | 568 |
| 332 | 3300038443 | Ga0395901_0016918 | Ga0395901_0016918_535_2241 | 568 |
| 333 | 3300038443 | Ga0395901_0066662 | Ga0395901_0066662_813_2519 | 568 |
| 334 | 3300038443 | Ga0395901_0085473 | Ga0395901_0085473_81_1829 | 568 |
| 335 | 3300039437 | Ga0436365_0963667 | Ga0436365_0963667_1083_2789 | 568 |
| 336 | 3300044694 | Ga0466963_0004259 | Ga0466963_0004259_5993_7699 | 568 |
| 337 | 3300044842 | Ga0466957_0007713 | Ga0466957_0007713_3732_5438 | 568 |
| 338 | 3300045836 | Ga0466958_0000295 | Ga0466958_0000295_10815_12521 | 568 |
| 339 | 3300045976 | Ga0466967_0037476 | Ga0466967_0037476_1860_3566 | 568 |
| 340 | 3300045976 | Ga0466967_0058913 | Ga0466967_0058913_1562_3268 | 568 |
| 341 | 3300048903 | Ga0496100_0019604 | Ga0496100_0019604_2242_3948 | 568 |
| 342 | 3300048905 | Ga0496102_0031714 | Ga0496102_0031714_111_1853 | 568 |
| 343 | 3300048905 | Ga0496102_0063086 | Ga0496102_0063086_515_2221 | 568 |
| 344 | 3300048905 | Ga0496102_0090447 | Ga0496102_0090447_734_2440 | 568 |
| 345 | 3300048910 | Ga0496107_0011337 | Ga0496107_0011337_413_2119 | 568 |
| 346 | 3300048911 | Ga0496108_0001925 | Ga0496108_0001925_4934_6640 | 568 |
| 347 | 3300048915 | Ga0496112_0002858 | Ga0496112_0002858_5594_7300 | 568 |
| 348 | 3300048915 | Ga0496112_0052739 | Ga0496112_0052739_27_1733 | 568 |
| 349 | 3300048916 | Ga0496113_0067349 | Ga0496113_0067349_416_2122 | 568 |
| 350 | 3300048918 | Ga0496115_0080272 | Ga0496115_0080272_384_2090 | 568 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3wo7-assembly1.cif.gz_A | crystal structure of yidc from bacillus halodurans (form ii) | 0.8422 | 335 | 551 |
| 3wo7-assembly2.cif.gz_B | crystal structure of yidc from bacillus halodurans (form ii) | 0.829 | 335 | 551 |
| 3wvf-assembly1.cif.gz_A | crystal structure of yidc from escherichia coli | 0.823 | 75 | 548 |
| 3wvf-assembly1.cif.gz_A | crystal structure of yidc from escherichia coli | 0.813 | 75 | 548 |
| 3bs6-assembly2.cif.gz_B | 1.8 angstrom crystal structure of the periplasmic domain of the membrane insertase yidc | 0.8086 | 73 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3bs6A00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.7762 | 75 | 332 | 2.70.98.90 |
| 3bs6A00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.7706 | 75 | 332 | 2.70.98.90 |
| af_Q7XPZ3_1_137_3.30.1460.20 | Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; | 0.6969 | 154 | 189 | 3.30.1460.20 |
| 4fmaB01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;EspG protein, N-terminal domain | 0.6917 | 141 | 190 | 3.10.450.460 |
| af_A0A1D6NGV4_102_355_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.6641 | 140 | 310 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436V9F1-F1-model_v4 | Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) | 0.9332 | 95 | 352 |
GO:0005886
GO:0015031 GO:0032977 |
| AF-A0A258BK39-F1-model_v4 | Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) | 0.93 | 64 | 416 |
GO:0005886
GO:0015031 GO:0032977 GO:0051205 |
| AF-A0A526QJ89-F1-model_v4 | Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) | 0.9297 | 92 | 308 |
GO:0005886
GO:0015031 |
| AF-A0A258BK39-F1-model_v4 | Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) | 0.9151 | 64 | 416 |
GO:0005886
GO:0015031 GO:0032977 GO:0051205 |
| AF-A0A436V9F1-F1-model_v4 | Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) | 0.8967 | 95 | 352 |
GO:0005886
GO:0015031 GO:0032977 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar