F418323

General Info

Members Datasets Scaffolds Average Seq Length
350 133 350 562

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0021255|Ga0395900_0021255_1740_3443
Length 554
Sequence VNDSKNLILAVVLSALVLLGWTFAANKYFPTSNPASTRVENGRQVAVPQPQAQPAPATPKTLQSVAQALGSTPRVKIETPSLEGSINLKGAQIDDLLLVRHEQTLAKNSPPVRLLSPLGTLDAYTTSFGWTAQGTQAPDLNTVWTADGNILSPGHPVTLSTQTPDDVRYQIKISVDDGYLFTVQQSVTNASGKPVTVRPIGLASRASKSADPSSWTNHVGPISVFGGKADYDVNWKDLDKEGTKAFSDVSGWLGFTDKYWLTALIPNGSVAADFRHSVAVAPGQAVMTQARLFAGAKEKAWLDRYEAAGVPLLSYAIDWGWFWFFARPIFDLLMFLFHAIGNFGLAIICLTLIVRVVMFPIAQKQFQSMAAMRKLQPKLKAIQERFKDDKPRQQQEIMKLYQAEKINPAAGCLPIVLQIPVFYALYKCLLVAVEMRHQPFILWIKDLSAPDPLTPVNLFGLLHFTPPAMLAIGVLPILVGATQWMSMKLNPQPMDPAQAQIFAIMPWFLVFIMAPFAAGLQLYWITNNLLTMAQQWWLYRKFGLHLSDTHPVHT

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
112 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
133 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 4.86
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1003115 3300001915 Bacteria 4069
2 JGI24737J22298_10000229 3300001990 Bacteria 18537
3 JGI24737J22298_10001469 3300001990 Bacteria 8398
4 JGI24737J22298_10005397 3300001990 Bacteria 4416
5 JGI24737J22298_10006449 3300001990 Bacteria 4008
6 JGI24735J21928_10000919 3300002067 Bacteria 10521
7 Ga0070658_10002803 3300005327 Bacteria 14482
8 Ga0070658_10039751 3300005327 Bacteria 3795
9 Ga0070658_10090038 3300005327 Bacteria 2527
10 Ga0070670_100024585 3300005331 Bacteria 5179
11 Ga0070670_100027175 3300005331 Bacteria 4923
12 Ga0068869_100004062 3300005334 Bacteria 9057
13 Ga0070666_10000630 3300005335 Bacteria 21198
14 Ga0068868_100000881 3300005338 Bacteria 20375
15 Ga0068868_100083093 3300005338 Bacteria 2570
16 Ga0070660_100001159 3300005339 Bacteria 17807
17 Ga0070660_100004955 3300005339 Bacteria 9209
18 Ga0070660_100007977 3300005339 Bacteria 7398
19 Ga0070660_100024417 3300005339 Bacteria 4483
20 Ga0070660_100030447 3300005339 Bacteria 4049
21 Ga0070660_100097077 3300005339 Bacteria 2331
22 Ga0070691_10031868 3300005341 Bacteria 2474
23 Ga0070661_100004337 3300005344 Bacteria 9786
24 Ga0070661_100034038 3300005344 Bacteria 3694
25 Ga0070661_100074397 3300005344 Bacteria 2502
26 Ga0070661_100109555 3300005344 Bacteria 2061
27 Ga0070692_10034057 3300005345 Bacteria 2570
28 Ga0070669_100038156 3300005353 Bacteria 3487
29 Ga0070671_100010200 3300005355 Bacteria 7541
30 Ga0070671_100022193 3300005355 Bacteria 5185
31 Ga0070671_100075982 3300005355 Bacteria 2806
32 Ga0070671_100076714 3300005355 Bacteria 2792
33 Ga0070671_100087303 3300005355 Bacteria 2610
34 Ga0070673_100000613 3300005364 Bacteria 19502
35 Ga0070673_100006064 3300005364 Bacteria 7829
36 Ga0070673_100027808 3300005364 Bacteria 4196
37 Ga0070659_100001497 3300005366 Bacteria 16828
38 Ga0070659_100001672 3300005366 Bacteria 15938
39 Ga0070659_100004174 3300005366 Bacteria 10299
40 Ga0070659_100006754 3300005366 Bacteria 8297
41 Ga0070659_100010044 3300005366 Bacteria 6968
42 Ga0070659_100050919 3300005366 Bacteria 3256
43 Ga0070659_100054143 3300005366 Bacteria 3160
44 Ga0070667_100003077 3300005367 Bacteria 14332
45 Ga0070667_100003302 3300005367 Bacteria 13792
46 Ga0070667_100025102 3300005367 Bacteria 4954
47 Ga0070713_100021196 3300005436 Bacteria 4993
48 Ga0070663_100002429 3300005455 Bacteria 10478
49 Ga0070663_100005583 3300005455 Bacteria 7487
50 Ga0070663_100033035 3300005455 Bacteria 3571
51 Ga0070678_100001960 3300005456 Bacteria 11113
52 Ga0070678_100006370 3300005456 Bacteria 6924
53 Ga0070662_100001014 3300005457 Bacteria 17175
54 Ga0070662_100001950 3300005457 Bacteria 12681
55 Ga0070662_100007201 3300005457 Bacteria 7206
56 Ga0070662_100036277 3300005457 Bacteria 3487
57 Ga0070681_10024034 3300005458 Bacteria 6135
58 Ga0068867_100005300 3300005459 Bacteria 9106
59 Ga0070679_100019105 3300005530 Bacteria 6659
60 Ga0070679_100102636 3300005530 Bacteria 2846
61 Ga0070684_100047718 3300005535 Bacteria 3712
62 Ga0070684_100136385 3300005535 Bacteria 2217
63 Ga0068853_100006858 3300005539 Bacteria 9083
64 Ga0068853_100015471 3300005539 Bacteria 6267
65 Ga0068853_100019243 3300005539 Bacteria 5659
66 Ga0070672_100001691 3300005543 Bacteria 13764
67 Ga0070672_100005149 3300005543 Bacteria 8635
68 Ga0068855_100026207 3300005563 Bacteria 6975
69 Ga0068855_100052153 3300005563 Bacteria 4816
70 Ga0070664_100000796 3300005564 Bacteria 24295
71 Ga0070664_100001230 3300005564 Bacteria 20486
72 Ga0070664_100006146 3300005564 Bacteria 9711
73 Ga0070664_100006440 3300005564 Bacteria 9468
74 Ga0070664_100026695 3300005564 Bacteria 4793
75 Ga0070664_100086816 3300005564 Bacteria 2703
76 Ga0070664_100091393 3300005564 Bacteria 2635
77 Ga0070664_100151513 3300005564 Bacteria 2047
78 Ga0068857_100003503 3300005577 Bacteria 13106
79 Ga0068857_100004732 3300005577 Bacteria 11531
80 Ga0068857_100004979 3300005577 Bacteria 11284
81 Ga0068857_100025428 3300005577 Bacteria 5213
82 Ga0068857_100054109 3300005577 Bacteria 3561
83 Ga0068854_100014647 3300005578 Bacteria 5173
84 Ga0068854_100027254 3300005578 Bacteria 3936
85 Ga0068854_100087339 3300005578 Bacteria 2313
86 Ga0068856_100160448 3300005614 Bacteria 2259
87 Ga0068852_100033057 3300005616 Bacteria 4290
88 Ga0068852_100040998 3300005616 Bacteria 3910
89 Ga0068859_100011725 3300005617 Bacteria 8807
90 Ga0068864_100002050 3300005618 Bacteria 16638
91 Ga0068864_100003062 3300005618 Bacteria 13803
92 Ga0068861_100024487 3300005719 Bacteria 4366
93 Ga0068863_100012542 3300005841 Bacteria 8178
94 Ga0068863_100025366 3300005841 Bacteria 5652
95 Ga0068863_100044232 3300005841 Bacteria 4227
96 Ga0068863_100105246 3300005841 Bacteria 2684
97 Ga0068858_100009043 3300005842 Bacteria 9524
98 Ga0068858_100023047 3300005842 Bacteria 5807
99 Ga0068858_100032745 3300005842 Bacteria 4827
100 Ga0068860_100007732 3300005843 Bacteria 10742
101 Ga0068862_100071393 3300005844 Bacteria 2998
102 Ga0075366_10073801 3300006195 Bacteria 2034
103 Ga0097621_100049163 3300006237 Bacteria 3425
104 Ga0097621_100089069 3300006237 Bacteria 2579
105 Ga0068871_100005970 3300006358 Bacteria 8574
106 Ga0097620_100011725 3300006931 Bacteria 8807
107 Ga0105240_10010767 3300009093 Bacteria 12824
108 Ga0105240_10023135 3300009093 Bacteria 8227
109 Ga0105245_10000285 3300009098 Bacteria 48237
110 Ga0105245_10011260 3300009098 Bacteria 7787
111 Ga0105241_10075249 3300009174 Bacteria 2631
112 Ga0105248_10004871 3300009177 Bacteria 14855
113 Ga0105248_10006610 3300009177 Bacteria 12705
114 Ga0105248_10008019 3300009177 Bacteria 11597
115 Ga0105237_10044364 3300009545 Bacteria 4476
116 Ga0105238_10014766 3300009551 Bacteria 7898
117 Ga0105249_10113495 3300009553 Bacteria 2564
118 Ga0157373_10003505 3300013100 Bacteria 11868
119 Ga0157373_10027556 3300013100 Bacteria 4099
120 Ga0157371_10006517 3300013102 Bacteria 9607
121 Ga0157371_10009211 3300013102 Bacteria 7792
122 Ga0157371_10012175 3300013102 Bacteria 6586
123 Ga0157371_10039194 3300013102 Bacteria 3388
124 Ga0157371_10052294 3300013102 Bacteria 2901
125 Ga0157371_10088500 3300013102 Bacteria 2192
126 Ga0157370_10002640 3300013104 Bacteria 21532
127 Ga0157369_10000106 3300013105 Bacteria 117964
128 Ga0157369_10011956 3300013105 Bacteria 9859
129 Ga0157369_10013407 3300013105 Bacteria 9269
130 Ga0157374_10029251 3300013296 Bacteria 4986
131 Ga0157378_10001258 3300013297 Bacteria 22842
132 Ga0163162_10003164 3300013306 Bacteria 15732
133 Ga0157375_10050841 3300013308 Bacteria 4067
134 Ga0163163_10003524 3300014325 Bacteria 13288
135 Ga0157377_10070074 3300014745 Bacteria 2025
136 Ga0213876_10002997 3300021384 Bacteria 9774
137 Ga0213876_10033616 3300021384 Bacteria 2703
138 Ga0207697_10000158 3300025315 Bacteria 33821
139 Ga0207688_10000924 3300025901 Bacteria 14835
140 Ga0207647_10000114 3300025904 Bacteria 62368
141 Ga0207647_10000253 3300025904 Bacteria 43758
142 Ga0207647_10012008 3300025904 Bacteria 6045
143 Ga0207647_10012561 3300025904 Bacteria 5890
144 Ga0207647_10043786 3300025904 Bacteria 2799
145 Ga0207647_10057227 3300025904 Bacteria 2391
146 Ga0207645_10003650 3300025907 Bacteria 11612
147 Ga0207705_10000929 3300025909 Bacteria 23915
148 Ga0207705_10002967 3300025909 Bacteria 12964
149 Ga0207705_10007878 3300025909 Bacteria 7822
150 Ga0207705_10024855 3300025909 Bacteria 4275
151 Ga0207705_10027473 3300025909 Bacteria 4058
152 Ga0207705_10029679 3300025909 Bacteria 3898
153 Ga0207705_10032252 3300025909 Bacteria 3743
154 Ga0207705_10063220 3300025909 Bacteria 2674
155 Ga0207705_10084720 3300025909 Bacteria 2314
156 Ga0207695_10019220 3300025913 Bacteria 7868
157 Ga0207657_10000498 3300025919 Bacteria 41427
158 Ga0207657_10000504 3300025919 Bacteria 41239
159 Ga0207657_10000806 3300025919 Bacteria 33100
160 Ga0207657_10000946 3300025919 Bacteria 30768
161 Ga0207657_10022778 3300025919 Bacteria 5850
162 Ga0207657_10023777 3300025919 Bacteria 5697
163 Ga0207657_10025765 3300025919 Bacteria 5416
164 Ga0207657_10058802 3300025919 Bacteria 3306
165 Ga0207657_10065537 3300025919 Bacteria 3096
166 Ga0207657_10067654 3300025919 Bacteria 3037
167 Ga0207649_10009705 3300025920 Bacteria 5272
168 Ga0207649_10021124 3300025920 Bacteria 3742
169 Ga0207652_10024932 3300025921 Bacteria 4966
170 Ga0207652_10143450 3300025921 Bacteria 2136
171 Ga0207694_10002217 3300025924 Bacteria 15949
172 Ga0207650_10005137 3300025925 Bacteria 8935
173 Ga0207650_10006767 3300025925 Bacteria 7816
174 Ga0207687_10012151 3300025927 Bacteria 5632
175 Ga0207687_10021225 3300025927 Bacteria 4313
176 Ga0207700_10016295 3300025928 Bacteria 4934
177 Ga0207664_10091243 3300025929 Bacteria 2498
178 Ga0207644_10007787 3300025931 Bacteria 6995
179 Ga0207644_10009397 3300025931 Bacteria 6422
180 Ga0207644_10026579 3300025931 Bacteria 3989
181 Ga0207644_10032260 3300025931 Bacteria 3653
182 Ga0207644_10057448 3300025931 Bacteria 2809
183 Ga0207644_10081508 3300025931 Bacteria 2391
184 Ga0207690_10001173 3300025932 Bacteria 16570
185 Ga0207690_10001468 3300025932 Bacteria 14742
186 Ga0207690_10005486 3300025932 Bacteria 7481
187 Ga0207690_10024433 3300025932 Bacteria 3785
188 Ga0207690_10078869 3300025932 Bacteria 2293
189 Ga0207706_10000643 3300025933 Bacteria 37034
190 Ga0207706_10001330 3300025933 Bacteria 24746
191 Ga0207706_10002629 3300025933 Bacteria 17488
192 Ga0207706_10004270 3300025933 Bacteria 13444
193 Ga0207706_10035781 3300025933 Bacteria 4412
194 Ga0207706_10048264 3300025933 Bacteria 3765
195 Ga0207706_10071112 3300025933 Bacteria 3060
196 Ga0207706_10077592 3300025933 Bacteria 2921
197 Ga0207706_10079656 3300025933 Bacteria 2880
198 Ga0207706_10086984 3300025933 Bacteria 2747
199 Ga0207691_10015876 3300025940 Bacteria 7156
200 Ga0207711_10005082 3300025941 Bacteria 11155
201 Ga0207711_10011332 3300025941 Bacteria 7407
202 Ga0207711_10103482 3300025941 Bacteria 2521
203 Ga0207689_10000017 3300025942 Bacteria 117159
204 Ga0207689_10019923 3300025942 Bacteria 5650
205 Ga0207679_10032415 3300025945 Bacteria 3668
206 Ga0207679_10034517 3300025945 Bacteria 3570
207 Ga0207667_10030495 3300025949 Bacteria 5833
208 Ga0207667_10038532 3300025949 Bacteria 5103
209 Ga0207667_10057674 3300025949 Bacteria 4075
210 Ga0207712_10000513 3300025961 Bacteria 32083
211 Ga0207668_10102099 3300025972 Bacteria 2133
212 Ga0207640_10000794 3300025981 Bacteria 17956
213 Ga0207640_10017254 3300025981 Bacteria 4221
214 Ga0207658_10003102 3300025986 Bacteria 11890
215 Ga0207658_10015187 3300025986 Bacteria 5282
216 Ga0207658_10069307 3300025986 Bacteria 2664
217 Ga0207658_10121347 3300025986 Bacteria 2084
218 Ga0207677_10056727 3300026023 Bacteria 2685
219 Ga0207703_10006790 3300026035 Bacteria 9122
220 Ga0207703_10029489 3300026035 Bacteria 4329
221 Ga0207703_10101164 3300026035 Bacteria 2443
222 Ga0207639_10000199 3300026041 Bacteria 45241
223 Ga0207639_10046980 3300026041 Bacteria 3260
224 Ga0207678_10001692 3300026067 Bacteria 20210
225 Ga0207678_10020008 3300026067 Bacteria 5882
226 Ga0207678_10025444 3300026067 Bacteria 5165
227 Ga0207678_10078740 3300026067 Bacteria 2822
228 Ga0207678_10102238 3300026067 Bacteria 2446
229 Ga0207702_10028286 3300026078 Bacteria 4658
230 Ga0207641_10017560 3300026088 Bacteria 5858
231 Ga0207641_10022398 3300026088 Bacteria 5201
232 Ga0207641_10040042 3300026088 Bacteria 3920
233 Ga0207641_10086736 3300026088 Bacteria 2730
234 Ga0207648_10015459 3300026089 Bacteria 7019
235 Ga0207648_10049998 3300026089 Bacteria 3656
236 Ga0207676_10003563 3300026095 Bacteria 10999
237 Ga0207676_10009112 3300026095 Bacteria 7069
238 Ga0207674_10000291 3300026116 Bacteria 63446
239 Ga0207674_10000527 3300026116 Bacteria 50282
240 Ga0207674_10005390 3300026116 Bacteria 15219
241 Ga0207674_10006708 3300026116 Bacteria 13516
242 Ga0207674_10011858 3300026116 Bacteria 9770
243 Ga0207674_10017349 3300026116 Bacteria 7855
244 Ga0207674_10023128 3300026116 Bacteria 6663
245 Ga0207674_10080925 3300026116 Bacteria 3251
246 Ga0207674_10205519 3300026116 Bacteria 1919
247 Ga0207698_10000388 3300026142 Bacteria 25382
248 Ga0207698_10003289 3300026142 Bacteria 9716
249 Ga0207698_10045186 3300026142 Bacteria 3316
250 Ga0268266_10014057 3300028379 Bacteria 6891
251 Ga0268266_10020692 3300028379 Bacteria 5608
252 Ga0307413_10016128 3300031824 Bacteria 3849
253 Ga0307416_100008789 3300032002 Bacteria 6550
254 Ga0307416_100043198 3300032002 Bacteria 3527
255 Ga0307414_10029208 3300032004 Bacteria 3586
256 Ga0307411_10006836 3300032005 Bacteria 5744
257 Ga0307411_10043863 3300032005 Bacteria 2864
258 Ga0307415_100015784 3300032126 Bacteria 4484
259 Ga0307415_100072678 3300032126 Bacteria 2423
260 Ga0307415_100081701 3300032126 Bacteria 2309
261 Ga0395899_0000225 3300037312 Bacteria 76673
262 Ga0395899_0000287 3300037312 Bacteria 64885
263 Ga0395899_0020496 3300037312 Bacteria 5011
264 Ga0395899_0027086 3300037312 Bacteria 4323
265 Ga0395899_0052649 3300037312 Bacteria 3016
266 Ga0395900_0000031 3300037418 Bacteria 262393
267 Ga0395900_0000667 3300037418 Bacteria 45770
268 Ga0395900_0009437 3300037418 Bacteria 10001
269 Ga0395900_0011349 3300037418 Bacteria 9114
270 Ga0395900_0016538 3300037418 Bacteria 7525
271 Ga0395900_0020351 3300037418 Bacteria 6773
272 Ga0395900_0021255 3300037418 Bacteria 6635
273 Ga0395900_0061033 3300037418 Bacteria 3877
274 Ga0395900_0170208 3300037418 Bacteria 2218
275 Ga0395900_0224126 3300037418 Bacteria 1893
276 Ga0395898_0000021 3300037466 Bacteria 393971
277 Ga0395898_0001423 3300037466 Bacteria 34055
278 Ga0395898_0003799 3300037466 Bacteria 16718
279 Ga0395898_0006374 3300037466 Bacteria 12605
280 Ga0395898_0008195 3300037466 Bacteria 11054
281 Ga0395898_0012131 3300037466 Bacteria 8917
282 Ga0395898_0014897 3300037466 Bacteria 7982
283 Ga0395898_0023568 3300037466 Bacteria 6218
284 Ga0395898_0085443 3300037466 Bacteria 3041
285 Ga0395905_0000006 3300037471 Bacteria 549428
286 Ga0395905_0002222 3300037471 Bacteria 21895
287 Ga0395905_0009030 3300037471 Bacteria 9780
288 Ga0395905_0011286 3300037471 Bacteria 8635
289 Ga0395905_0022515 3300037471 Bacteria 5960
290 Ga0395905_0024947 3300037471 Bacteria 5640
291 Ga0395905_0031240 3300037471 Bacteria 5015
292 Ga0395905_0039638 3300037471 Bacteria 4419
293 Ga0395905_0080026 3300037471 Bacteria 3062
294 Ga0395905_0088947 3300037471 Bacteria 2894
295 Ga0395905_0103755 3300037471 Bacteria 2669
296 Ga0395905_0106271 3300037471 Bacteria 2636
297 Ga0395905_0138540 3300037471 Bacteria 2289
298 Ga0395901_0000035 3300038443 Bacteria 223888
299 Ga0395901_0000329 3300038443 Bacteria 58460
300 Ga0395901_0006312 3300038443 Bacteria 12008
301 Ga0395901_0016918 3300038443 Bacteria 7433
302 Ga0395901_0053685 3300038443 Bacteria 4187
303 Ga0395901_0054288 3300038443 Bacteria 4164
304 Ga0395901_0066662 3300038443 Bacteria 3749
305 Ga0395901_0085473 3300038443 Bacteria 3298
306 Ga0395901_0091378 3300038443 Bacteria 3186
307 Ga0395901_0130307 3300038443 Bacteria 2642
308 Ga0395901_0167755 3300038443 Bacteria 2304
309 Ga0395901_0212835 3300038443 Bacteria 2022
310 Ga0436365_0963667 3300039437 Bacteria 3389
311 Ga0436365_1507661 3300039437 Bacteria 37687
312 Ga0439458_0000016 3300042157 Bacteria 26319
313 Ga0439464_0008394 3300042439 Bacteria 2707
314 Ga0466969_0003047 3300044656 Bacteria 8932
315 Ga0466966_0007715 3300044684 Bacteria 7125
316 Ga0466961_0013602 3300044693 Bacteria 5212
317 Ga0466961_0021897 3300044693 Bacteria 4113
318 Ga0466963_0000335 3300044694 Bacteria 21343
319 Ga0466963_0004259 3300044694 Bacteria 8302
320 Ga0466963_0144923 3300044694 Bacteria 1647
321 Ga0466971_0012140 3300044719 Bacteria 3774
322 Ga0466971_0013009 3300044719 Bacteria 3650
323 Ga0466957_0007713 3300044842 Bacteria 6087
324 Ga0466959_0024251 3300045049 Bacteria 4492
325 Ga0466958_0000295 3300045836 Bacteria 19538
326 Ga0466958_0002056 3300045836 Bacteria 9943
327 Ga0466958_0041459 3300045836 Bacteria 2769
328 Ga0466967_0020512 3300045976 Bacteria 5345
329 Ga0466967_0037476 3300045976 Bacteria 4150
330 Ga0466967_0058913 3300045976 Bacteria 3396
331 Ga0495669_0030883 3300046684 Bacteria 2351
332 Ga0496100_0019604 3300048903 Bacteria 4038
333 Ga0496102_0021682 3300048905 Bacteria 5683
334 Ga0496102_0031714 3300048905 Bacteria 4743
335 Ga0496102_0063086 3300048905 Bacteria 3393
336 Ga0496102_0090447 3300048905 Bacteria 2833
337 Ga0496107_0011337 3300048910 Bacteria 6204
338 Ga0496108_0001925 3300048911 Bacteria 16631
339 Ga0496108_0009632 3300048911 Bacteria 7832
340 Ga0496109_0023088 3300048912 Bacteria 5517
341 Ga0496111_0002477 3300048914 Bacteria 11134
342 Ga0496112_0002858 3300048915 Bacteria 14027
343 Ga0496112_0052739 3300048915 Bacteria 3992
344 Ga0496113_0012777 3300048916 Bacteria 5657
345 Ga0496113_0016617 3300048916 Bacteria 5087
346 Ga0496113_0067349 3300048916 Bacteria 2714
347 Ga0496115_0018686 3300048918 Bacteria 5328
348 Ga0496115_0080272 3300048918 Bacteria 2656
349 Ga0501257_006438 3300049686 Bacteria 2605
350 Ga0466962_0020090 3300061719 Bacteria 3210

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_0144923 Ga0466963_0144923_165_1622 485
2 3300038443 Ga0395901_0130307 Ga0395901_0130307_74_1600 497
3 3300025921 Ga0207652_10024932 Ga0207652_100249326 500
4 3300037471 Ga0395905_0022515 Ga0395905_0022515_3454_5148 532
5 3300038443 Ga0395901_0212835 Ga0395901_0212835_239_1933 532
6 3300026142 Ga0207698_10045186 Ga0207698_100451862 535
7 3300005366 Ga0070659_100054143 Ga0070659_1000541432 538
8 3300025919 Ga0207657_10000806 Ga0207657_1000080632 538
9 3300025919 Ga0207657_10067654 Ga0207657_100676542 538
10 3300037471 Ga0395905_0080026 Ga0395905_0080026_697_2427 538
11 3300025949 Ga0207667_10030495 Ga0207667_100304952 539
12 3300037418 Ga0395900_0016538 Ga0395900_0016538_5209_6897 539
13 3300037471 Ga0395905_0011286 Ga0395905_0011286_617_2317 539
14 3300038443 Ga0395901_0000329 Ga0395901_0000329_46948_48636 539
15 3300005339 Ga0070660_100001159 Ga0070660_10000115914 540
16 3300005341 Ga0070691_10031868 Ga0070691_100318681 540
17 3300005344 Ga0070661_100004337 Ga0070661_1000043376 540
18 3300005366 Ga0070659_100004174 Ga0070659_1000041749 540
19 3300005530 Ga0070679_100019105 Ga0070679_1000191054 540
20 3300005535 Ga0070684_100136385 Ga0070684_1001363851 540
21 3300005563 Ga0068855_100026207 Ga0068855_1000262077 540
22 3300005577 Ga0068857_100025428 Ga0068857_1000254285 540
23 3300009093 Ga0105240_10023135 Ga0105240_100231358 540
24 3300009551 Ga0105238_10014766 Ga0105238_100147665 540
25 3300013100 Ga0157373_10003505 Ga0157373_100035054 540
26 3300013104 Ga0157370_10002640 Ga0157370_100026403 540
27 3300025904 Ga0207647_10012008 Ga0207647_100120085 540
28 3300025909 Ga0207705_10027473 Ga0207705_100274734 540
29 3300025913 Ga0207695_10019220 Ga0207695_100192206 540
30 3300025919 Ga0207657_10000946 Ga0207657_1000094610 540
31 3300025920 Ga0207649_10009705 Ga0207649_100097053 540
32 3300025924 Ga0207694_10002217 Ga0207694_100022174 540
33 3300025932 Ga0207690_10005486 Ga0207690_100054866 540
34 3300025949 Ga0207667_10038532 Ga0207667_100385324 540
35 3300025981 Ga0207640_10017254 Ga0207640_100172545 540
36 3300026041 Ga0207639_10000199 Ga0207639_1000019944 540
37 3300026116 Ga0207674_10005390 Ga0207674_1000539010 540
38 3300026142 Ga0207698_10000388 Ga0207698_100003886 540
39 3300037418 Ga0395900_0170208 Ga0395900_0170208_12_1718 540
40 3300026089 Ga0207648_10049998 Ga0207648_100499983 541
41 3300037418 Ga0395900_0224126 Ga0395900_0224126_77_1783 541
42 3300037466 Ga0395898_0014897 Ga0395898_0014897_6200_7906 541
43 3300025929 Ga0207664_10091243 Ga0207664_100912432 542
44 3300044656 Ga0466969_0003047 Ga0466969_0003047_4924_6630 543
45 3300044684 Ga0466966_0007715 Ga0466966_0007715_2965_4671 543
46 3300044693 Ga0466961_0013602 Ga0466961_0013602_2332_4038 543
47 3300044719 Ga0466971_0012140 Ga0466971_0012140_1093_2799 543
48 3300045049 Ga0466959_0024251 Ga0466959_0024251_1175_2881 543
49 3300045836 Ga0466958_0002056 Ga0466958_0002056_1263_2969 543
50 3300045976 Ga0466967_0020512 Ga0466967_0020512_1551_3257 543
51 3300061719 Ga0466962_0020090 Ga0466962_0020090_1058_2764 543
52 3300005339 Ga0070660_100004955 Ga0070660_10000495510 544
53 3300009093 Ga0105240_10010767 Ga0105240_100107676 544
54 3300013102 Ga0157371_10006517 Ga0157371_100065172 544
55 3300013102 Ga0157371_10052294 Ga0157371_100522942 544
56 3300025909 Ga0207705_10000929 Ga0207705_1000092923 544
57 3300025919 Ga0207657_10000498 Ga0207657_1000049811 544
58 3300025949 Ga0207667_10057674 Ga0207667_100576745 544
59 3300025981 Ga0207640_10000794 Ga0207640_1000079423 544
60 3300009545 Ga0105237_10044364 Ga0105237_100443644 545
61 3300028379 Ga0268266_10014057 Ga0268266_100140575 545
62 3300044694 Ga0466963_0000335 Ga0466963_0000335_11083_12789 545
63 3300005539 Ga0068853_100019243 Ga0068853_1000192432 547
64 3300044719 Ga0466971_0013009 Ga0466971_0013009_292_1998 548
65 3300026078 Ga0207702_10028286 Ga0207702_100282863 549
66 3300044693 Ga0466961_0021897 Ga0466961_0021897_2003_3709 549
67 3300013105 Ga0157369_10000106 Ga0157369_1000010614 550
68 3300013105 Ga0157369_10013407 Ga0157369_100134073 550
69 3300025932 Ga0207690_10024433 Ga0207690_100244333 550
70 3300032002 Ga0307416_100008789 Ga0307416_1000087895 550
71 3300005455 Ga0070663_100005583 Ga0070663_1000055832 552
72 3300025904 Ga0207647_10057227 Ga0207647_100572271 552
73 3300037312 Ga0395899_0052649 Ga0395899_0052649_372_2078 552
74 3300046684 Ga0495669_0030883 Ga0495669_0030883_558_2261 552
75 3300039437 Ga0436365_1507661 Ga0436365_1507661_4616_6322 553
76 3300026116 Ga0207674_10011858 Ga0207674_100118585 554
77 3300037418 Ga0395900_0021255 Ga0395900_0021255_1740_3443 554
78 3300037471 Ga0395905_0039638 Ga0395905_0039638_1740_3443 554
79 3300005344 Ga0070661_100109555 Ga0070661_1001095552 555
80 3300005564 Ga0070664_100086816 Ga0070664_1000868162 555
81 3300025920 Ga0207649_10021124 Ga0207649_100211245 555
82 3300025932 Ga0207690_10078869 Ga0207690_100788692 555
83 3300037471 Ga0395905_0088947 Ga0395905_0088947_386_2092 555
84 3300038443 Ga0395901_0054288 Ga0395901_0054288_2285_3991 555
85 3300045836 Ga0466958_0041459 Ga0466958_0041459_241_1947 555
86 3300025909 Ga0207705_10029679 Ga0207705_100296793 556
87 3300037471 Ga0395905_0138540 Ga0395905_0138540_197_1903 556
88 3300042157 Ga0439458_0000016 Ga0439458_0000016_13715_15421 556
89 3300005345 Ga0070692_10034057 Ga0070692_100340572 557
90 3300005455 Ga0070663_100033035 Ga0070663_1000330355 557
91 3300021384 Ga0213876_10033616 Ga0213876_100336162 557
92 3300037418 Ga0395900_0020351 Ga0395900_0020351_2965_4671 557
93 3300037418 Ga0395900_0061033 Ga0395900_0061033_936_2645 557
94 3300037471 Ga0395905_0024947 Ga0395905_0024947_2237_3943 557
95 3300037471 Ga0395905_0106271 Ga0395905_0106271_413_2116 557
96 3300038443 Ga0395901_0053685 Ga0395901_0053685_1150_2859 557
97 3300026067 Ga0207678_10102238 Ga0207678_101022383 558
98 3300037466 Ga0395898_0023568 Ga0395898_0023568_1090_2823 558
99 3300038443 Ga0395901_0167755 Ga0395901_0167755_431_2137 558
100 3300048918 Ga0496115_0018686 Ga0496115_0018686_1259_2965 558
101 3300005564 Ga0070664_100000796 Ga0070664_10000079623 559
102 3300005841 Ga0068863_100025366 Ga0068863_1000253668 559
103 3300005842 Ga0068858_100009043 Ga0068858_1000090438 559
104 3300025933 Ga0207706_10077592 Ga0207706_100775923 559
105 3300025986 Ga0207658_10121347 Ga0207658_101213471 559
106 3300026035 Ga0207703_10101164 Ga0207703_101011642 559
107 3300037418 Ga0395900_0011349 Ga0395900_0011349_1043_2776 559
108 3300037466 Ga0395898_0006374 Ga0395898_0006374_3225_4931 559
109 3300038443 Ga0395901_0006312 Ga0395901_0006312_7745_9451 559
110 3300048905 Ga0496102_0021682 Ga0496102_0021682_3543_5258 559
111 3300048911 Ga0496108_0009632 Ga0496108_0009632_5660_7375 559
112 3300048912 Ga0496109_0023088 Ga0496109_0023088_3484_5199 559
113 3300048914 Ga0496111_0002477 Ga0496111_0002477_4731_6446 559
114 3300048916 Ga0496113_0012777 Ga0496113_0012777_197_1912 559
115 3300021384 Ga0213876_10002997 Ga0213876_100029976 560
116 3300032126 Ga0307415_100081701 Ga0307415_1000817012 560
117 3300049686 Ga0501257_006438 Ga0501257_006438_35_1741 560
118 3300005339 Ga0070660_100097077 Ga0070660_1000970773 561
119 3300005366 Ga0070659_100006754 Ga0070659_1000067545 561
120 3300005457 Ga0070662_100036277 Ga0070662_1000362776 561
121 3300005564 Ga0070664_100001230 Ga0070664_10000123017 561
122 3300013102 Ga0157371_10088500 Ga0157371_100885002 561
123 3300025919 Ga0207657_10065537 Ga0207657_100655372 561
124 3300025932 Ga0207690_10001173 Ga0207690_100011738 561
125 3300025933 Ga0207706_10071112 Ga0207706_100711124 561
126 3300025945 Ga0207679_10032415 Ga0207679_100324154 561
127 3300001990 JGI24737J22298_10005397 JGI24737J22298_100053975 562
128 3300005327 Ga0070658_10002803 Ga0070658_1000280312 562
129 3300005339 Ga0070660_100007977 Ga0070660_1000079774 562
130 3300005353 Ga0070669_100038156 Ga0070669_1000381566 562
131 3300005366 Ga0070659_100010044 Ga0070659_1000100444 562
132 3300005457 Ga0070662_100001014 Ga0070662_10000101419 562
133 3300005842 Ga0068858_100032745 Ga0068858_1000327454 562
134 3300009553 Ga0105249_10113495 Ga0105249_101134952 562
135 3300025904 Ga0207647_10000114 Ga0207647_1000011454 562
136 3300025909 Ga0207705_10063220 Ga0207705_100632202 562
137 3300025919 Ga0207657_10058802 Ga0207657_100588023 562
138 3300025932 Ga0207690_10001468 Ga0207690_100014685 562
139 3300025933 Ga0207706_10001330 Ga0207706_1000133019 562
140 3300025942 Ga0207689_10019923 Ga0207689_100199236 562
141 3300025961 Ga0207712_10000513 Ga0207712_1000051322 562
142 3300025972 Ga0207668_10102099 Ga0207668_101020992 562
143 3300026035 Ga0207703_10029489 Ga0207703_100294894 562
144 3300026041 Ga0207639_10046980 Ga0207639_100469803 562
145 3300026088 Ga0207641_10086736 Ga0207641_100867362 562
146 3300026116 Ga0207674_10023128 Ga0207674_100231286 562
147 3300026116 Ga0207674_10205519 Ga0207674_102055192 562
148 3300037312 Ga0395899_0000287 Ga0395899_0000287_47266_48960 562
149 3300037418 Ga0395900_0000031 Ga0395900_0000031_211551_213245 562
150 3300037466 Ga0395898_0012131 Ga0395898_0012131_4407_6101 562
151 3300038443 Ga0395901_0000035 Ga0395901_0000035_72667_74361 562
152 3300037471 Ga0395905_0103755 Ga0395905_0103755_134_1831 564
153 3300001990 JGI24737J22298_10000229 JGI24737J22298_1000022913 565
154 3300005334 Ga0068869_100004062 Ga0068869_1000040627 565
155 3300005338 Ga0068868_100000881 Ga0068868_10000088117 565
156 3300005339 Ga0070660_100030447 Ga0070660_1000304475 565
157 3300005355 Ga0070671_100010200 Ga0070671_1000102003 565
158 3300005364 Ga0070673_100006064 Ga0070673_1000060647 565
159 3300005366 Ga0070659_100001672 Ga0070659_10000167215 565
160 3300005367 Ga0070667_100003302 Ga0070667_10000330213 565
161 3300005367 Ga0070667_100025102 Ga0070667_1000251023 565
162 3300005457 Ga0070662_100007201 Ga0070662_1000072014 565
163 3300005459 Ga0068867_100005300 Ga0068867_1000053007 565
164 3300005539 Ga0068853_100006858 Ga0068853_10000685812 565
165 3300005543 Ga0070672_100005149 Ga0070672_10000514910 565
166 3300005564 Ga0070664_100026695 Ga0070664_1000266953 565
167 3300005577 Ga0068857_100003503 Ga0068857_10000350311 565
168 3300005578 Ga0068854_100014647 Ga0068854_1000146474 565
169 3300005616 Ga0068852_100040998 Ga0068852_1000409984 565
170 3300005617 Ga0068859_100011725 Ga0068859_1000117256 565
171 3300005618 Ga0068864_100002050 Ga0068864_1000020508 565
172 3300005719 Ga0068861_100024487 Ga0068861_1000244873 565
173 3300005841 Ga0068863_100044232 Ga0068863_1000442328 565
174 3300005842 Ga0068858_100023047 Ga0068858_1000230477 565
175 3300005843 Ga0068860_100007732 Ga0068860_1000077325 565
176 3300005844 Ga0068862_100071393 Ga0068862_1000713932 565
177 3300006237 Ga0097621_100049163 Ga0097621_1000491634 565
178 3300006931 Ga0097620_100011725 Ga0097620_1000117256 565
179 3300009098 Ga0105245_10000285 Ga0105245_1000028539 565
180 3300009174 Ga0105241_10075249 Ga0105241_100752493 565
181 3300009177 Ga0105248_10006610 Ga0105248_1000661012 565
182 3300013100 Ga0157373_10027556 Ga0157373_100275566 565
183 3300013102 Ga0157371_10009211 Ga0157371_100092114 565
184 3300013102 Ga0157371_10012175 Ga0157371_100121756 565
185 3300013297 Ga0157378_10001258 Ga0157378_1000125813 565
186 3300013308 Ga0157375_10050841 Ga0157375_100508414 565
187 3300014745 Ga0157377_10070074 Ga0157377_100700742 565
188 3300025315 Ga0207697_10000158 Ga0207697_1000015812 565
189 3300025901 Ga0207688_10000924 Ga0207688_1000092413 565
190 3300025904 Ga0207647_10000253 Ga0207647_1000025315 565
191 3300025925 Ga0207650_10005137 Ga0207650_100051373 565
192 3300025925 Ga0207650_10006767 Ga0207650_100067677 565
193 3300025927 Ga0207687_10012151 Ga0207687_100121518 565
194 3300025931 Ga0207644_10009397 Ga0207644_100093973 565
195 3300025933 Ga0207706_10000643 Ga0207706_1000064335 565
196 3300025933 Ga0207706_10004270 Ga0207706_1000427011 565
197 3300025940 Ga0207691_10015876 Ga0207691_1001587611 565
198 3300025941 Ga0207711_10005082 Ga0207711_1000508212 565
199 3300025942 Ga0207689_10000017 Ga0207689_1000001741 565
200 3300025986 Ga0207658_10003102 Ga0207658_100031025 565
201 3300026035 Ga0207703_10006790 Ga0207703_100067907 565
202 3300026067 Ga0207678_10001692 Ga0207678_1000169218 565
203 3300026088 Ga0207641_10022398 Ga0207641_100223983 565
204 3300026089 Ga0207648_10015459 Ga0207648_100154594 565
205 3300026116 Ga0207674_10017349 Ga0207674_100173497 565
206 3300026142 Ga0207698_10003289 Ga0207698_100032893 565
207 3300028379 Ga0268266_10020692 Ga0268266_100206925 565
208 3300032005 Ga0307411_10043863 Ga0307411_100438632 565
209 3300032126 Ga0307415_100072678 Ga0307415_1000726783 565
210 3300005577 Ga0068857_100004979 Ga0068857_10000497912 566
211 3300025907 Ga0207645_10003650 Ga0207645_100036505 566
212 3300025919 Ga0207657_10022778 Ga0207657_100227782 566
213 3300025933 Ga0207706_10086984 Ga0207706_100869843 566
214 3300026067 Ga0207678_10078740 Ga0207678_100787402 566
215 3300026116 Ga0207674_10000527 Ga0207674_1000052716 566
216 3300005327 Ga0070658_10039751 Ga0070658_100397513 567
217 3300005327 Ga0070658_10090038 Ga0070658_100900381 567
218 3300005344 Ga0070661_100034038 Ga0070661_1000340386 567
219 3300005366 Ga0070659_100001497 Ga0070659_10000149715 567
220 3300005366 Ga0070659_100050919 Ga0070659_1000509193 567
221 3300005455 Ga0070663_100002429 Ga0070663_10000242910 567
222 3300005539 Ga0068853_100015471 Ga0068853_1000154718 567
223 3300005564 Ga0070664_100091393 Ga0070664_1000913932 567
224 3300005578 Ga0068854_100027254 Ga0068854_1000272543 567
225 3300005616 Ga0068852_100033057 Ga0068852_1000330575 567
226 3300013105 Ga0157369_10011956 Ga0157369_100119569 567
227 3300013296 Ga0157374_10029251 Ga0157374_100292515 567
228 3300025909 Ga0207705_10007878 Ga0207705_100078783 567
229 3300025909 Ga0207705_10032252 Ga0207705_100322523 567
230 3300025909 Ga0207705_10084720 Ga0207705_100847203 567
231 3300025919 Ga0207657_10023777 Ga0207657_100237773 567
232 3300025919 Ga0207657_10025765 Ga0207657_100257656 567
233 3300025945 Ga0207679_10034517 Ga0207679_100345173 567
234 3300026067 Ga0207678_10020008 Ga0207678_100200084 567
235 3300026116 Ga0207674_10080925 Ga0207674_100809253 567
236 3300031824 Ga0307413_10016128 Ga0307413_100161283 567
237 3300032002 Ga0307416_100043198 Ga0307416_1000431983 567
238 3300032004 Ga0307414_10029208 Ga0307414_100292084 567
239 3300032005 Ga0307411_10006836 Ga0307411_100068366 567
240 3300032126 Ga0307415_100015784 Ga0307415_1000157846 567
241 3300037418 Ga0395900_0000667 Ga0395900_0000667_9709_11412 567
242 3300037466 Ga0395898_0001423 Ga0395898_0001423_25320_27023 567
243 3300038443 Ga0395901_0091378 Ga0395901_0091378_1150_2853 567
244 3300042439 Ga0439464_0008394 Ga0439464_0008394_179_1897 567
245 3300048916 Ga0496113_0016617 Ga0496113_0016617_1139_2842 567
246 3300001915 JGI24741J21665_1003115 JGI24741J21665_10031153 568
247 3300001990 JGI24737J22298_10001469 JGI24737J22298_100014696 568
248 3300001990 JGI24737J22298_10006449 JGI24737J22298_100064495 568
249 3300002067 JGI24735J21928_10000919 JGI24735J21928_1000091910 568
250 3300005331 Ga0070670_100024585 Ga0070670_1000245851 568
251 3300005331 Ga0070670_100027175 Ga0070670_1000271755 568
252 3300005335 Ga0070666_10000630 Ga0070666_1000063020 568
253 3300005338 Ga0068868_100083093 Ga0068868_1000830932 568
254 3300005339 Ga0070660_100024417 Ga0070660_1000244173 568
255 3300005344 Ga0070661_100074397 Ga0070661_1000743973 568
256 3300005355 Ga0070671_100022193 Ga0070671_1000221933 568
257 3300005355 Ga0070671_100075982 Ga0070671_1000759824 568
258 3300005355 Ga0070671_100076714 Ga0070671_1000767144 568
259 3300005355 Ga0070671_100087303 Ga0070671_1000873032 568
260 3300005364 Ga0070673_100000613 Ga0070673_10000061321 568
261 3300005364 Ga0070673_100027808 Ga0070673_1000278085 568
262 3300005367 Ga0070667_100003077 Ga0070667_1000030777 568
263 3300005436 Ga0070713_100021196 Ga0070713_1000211966 568
264 3300005456 Ga0070678_100001960 Ga0070678_1000019606 568
265 3300005456 Ga0070678_100006370 Ga0070678_1000063705 568
266 3300005457 Ga0070662_100001950 Ga0070662_1000019508 568
267 3300005458 Ga0070681_10024034 Ga0070681_100240345 568
268 3300005530 Ga0070679_100102636 Ga0070679_1001026362 568
269 3300005535 Ga0070684_100047718 Ga0070684_1000477183 568
270 3300005543 Ga0070672_100001691 Ga0070672_10000169110 568
271 3300005563 Ga0068855_100052153 Ga0068855_1000521535 568
272 3300005564 Ga0070664_100006146 Ga0070664_1000061468 568
273 3300005564 Ga0070664_100006440 Ga0070664_1000064407 568
274 3300005564 Ga0070664_100151513 Ga0070664_1001515132 568
275 3300005577 Ga0068857_100004732 Ga0068857_1000047327 568
276 3300005577 Ga0068857_100054109 Ga0068857_1000541095 568
277 3300005578 Ga0068854_100087339 Ga0068854_1000873392 568
278 3300005614 Ga0068856_100160448 Ga0068856_1001604481 568
279 3300005618 Ga0068864_100003062 Ga0068864_1000030626 568
280 3300005841 Ga0068863_100012542 Ga0068863_1000125422 568
281 3300005841 Ga0068863_100105246 Ga0068863_1001052462 568
282 3300006195 Ga0075366_10073801 Ga0075366_100738011 568
283 3300006237 Ga0097621_100089069 Ga0097621_1000890692 568
284 3300006358 Ga0068871_100005970 Ga0068871_1000059703 568
285 3300009098 Ga0105245_10011260 Ga0105245_100112607 568
286 3300009177 Ga0105248_10004871 Ga0105248_100048713 568
287 3300009177 Ga0105248_10008019 Ga0105248_100080194 568
288 3300013102 Ga0157371_10039194 Ga0157371_100391943 568
289 3300013306 Ga0163162_10003164 Ga0163162_100031643 568
290 3300014325 Ga0163163_10003524 Ga0163163_100035248 568
291 3300025904 Ga0207647_10012561 Ga0207647_100125617 568
292 3300025904 Ga0207647_10043786 Ga0207647_100437862 568
293 3300025909 Ga0207705_10002967 Ga0207705_100029675 568
294 3300025909 Ga0207705_10024855 Ga0207705_100248555 568
295 3300025919 Ga0207657_10000504 Ga0207657_1000050410 568
296 3300025921 Ga0207652_10143450 Ga0207652_101434502 568
297 3300025927 Ga0207687_10021225 Ga0207687_100212255 568
298 3300025928 Ga0207700_10016295 Ga0207700_100162956 568
299 3300025931 Ga0207644_10007787 Ga0207644_100077877 568
300 3300025931 Ga0207644_10026579 Ga0207644_100265793 568
301 3300025931 Ga0207644_10032260 Ga0207644_100322602 568
302 3300025931 Ga0207644_10057448 Ga0207644_100574482 568
303 3300025931 Ga0207644_10081508 Ga0207644_100815082 568
304 3300025933 Ga0207706_10002629 Ga0207706_1000262912 568
305 3300025933 Ga0207706_10035781 Ga0207706_100357811 568
306 3300025933 Ga0207706_10048264 Ga0207706_100482643 568
307 3300025933 Ga0207706_10079656 Ga0207706_100796561 568
308 3300025941 Ga0207711_10011332 Ga0207711_100113325 568
309 3300025941 Ga0207711_10103482 Ga0207711_101034822 568
310 3300025986 Ga0207658_10015187 Ga0207658_100151873 568
311 3300025986 Ga0207658_10069307 Ga0207658_100693073 568
312 3300026023 Ga0207677_10056727 Ga0207677_100567272 568
313 3300026067 Ga0207678_10025444 Ga0207678_100254446 568
314 3300026088 Ga0207641_10017560 Ga0207641_100175605 568
315 3300026088 Ga0207641_10040042 Ga0207641_100400423 568
316 3300026095 Ga0207676_10003563 Ga0207676_100035638 568
317 3300026095 Ga0207676_10009112 Ga0207676_100091126 568
318 3300026116 Ga0207674_10000291 Ga0207674_100002916 568
319 3300026116 Ga0207674_10006708 Ga0207674_100067086 568
320 3300037312 Ga0395899_0000225 Ga0395899_0000225_26116_27822 568
321 3300037312 Ga0395899_0020496 Ga0395899_0020496_454_2160 568
322 3300037312 Ga0395899_0027086 Ga0395899_0027086_2243_3949 568
323 3300037418 Ga0395900_0009437 Ga0395900_0009437_7829_9535 568
324 3300037466 Ga0395898_0000021 Ga0395898_0000021_151304_153010 568
325 3300037466 Ga0395898_0003799 Ga0395898_0003799_9017_10723 568
326 3300037466 Ga0395898_0008195 Ga0395898_0008195_5816_7624 568
327 3300037466 Ga0395898_0085443 Ga0395898_0085443_279_2027 568
328 3300037471 Ga0395905_0000006 Ga0395905_0000006_367556_369262 568
329 3300037471 Ga0395905_0002222 Ga0395905_0002222_2158_3864 568
330 3300037471 Ga0395905_0009030 Ga0395905_0009030_3154_4902 568
331 3300037471 Ga0395905_0031240 Ga0395905_0031240_2276_3982 568
332 3300038443 Ga0395901_0016918 Ga0395901_0016918_535_2241 568
333 3300038443 Ga0395901_0066662 Ga0395901_0066662_813_2519 568
334 3300038443 Ga0395901_0085473 Ga0395901_0085473_81_1829 568
335 3300039437 Ga0436365_0963667 Ga0436365_0963667_1083_2789 568
336 3300044694 Ga0466963_0004259 Ga0466963_0004259_5993_7699 568
337 3300044842 Ga0466957_0007713 Ga0466957_0007713_3732_5438 568
338 3300045836 Ga0466958_0000295 Ga0466958_0000295_10815_12521 568
339 3300045976 Ga0466967_0037476 Ga0466967_0037476_1860_3566 568
340 3300045976 Ga0466967_0058913 Ga0466967_0058913_1562_3268 568
341 3300048903 Ga0496100_0019604 Ga0496100_0019604_2242_3948 568
342 3300048905 Ga0496102_0031714 Ga0496102_0031714_111_1853 568
343 3300048905 Ga0496102_0063086 Ga0496102_0063086_515_2221 568
344 3300048905 Ga0496102_0090447 Ga0496102_0090447_734_2440 568
345 3300048910 Ga0496107_0011337 Ga0496107_0011337_413_2119 568
346 3300048911 Ga0496108_0001925 Ga0496108_0001925_4934_6640 568
347 3300048915 Ga0496112_0002858 Ga0496112_0002858_5594_7300 568
348 3300048915 Ga0496112_0052739 Ga0496112_0052739_27_1733 568
349 3300048916 Ga0496113_0067349 Ga0496113_0067349_416_2122 568
350 3300048918 Ga0496115_0080272 Ga0496115_0080272_384_2090 568

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02096

60KD_IMP

60Kd inner membrane protein

343

540

0.93

PF14849

YidC_periplas

YidC periplasmic domain

74

332

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3wo7-assembly1.cif.gz_A crystal structure of yidc from bacillus halodurans (form ii) 0.8422 335 551
3wo7-assembly2.cif.gz_B crystal structure of yidc from bacillus halodurans (form ii) 0.829 335 551
3wvf-assembly1.cif.gz_A crystal structure of yidc from escherichia coli 0.823 75 548
3wvf-assembly1.cif.gz_A crystal structure of yidc from escherichia coli 0.813 75 548
3bs6-assembly2.cif.gz_B 1.8 angstrom crystal structure of the periplasmic domain of the membrane insertase yidc 0.8086 73 332
ID Description Score Start End Superfamily
3bs6A00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7762 75 332 2.70.98.90
3bs6A00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.7706 75 332 2.70.98.90
af_Q7XPZ3_1_137_3.30.1460.20 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.6969 154 189 3.30.1460.20
4fmaB01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;EspG protein, N-terminal domain 0.6917 141 190 3.10.450.460
af_A0A1D6NGV4_102_355_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.6641 140 310 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A436V9F1-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) 0.9332 95 352 GO:0005886
GO:0015031
GO:0032977
AF-A0A258BK39-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) 0.93 64 416 GO:0005886
GO:0015031
GO:0032977
GO:0051205
AF-A0A526QJ89-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) 0.9297 92 308 GO:0005886
GO:0015031
AF-A0A258BK39-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) 0.9151 64 416 GO:0005886
GO:0015031
GO:0032977
GO:0051205
AF-A0A436V9F1-F1-model_v4 Membrane protein insertase YidC (Foldase YidC) (Membrane integrase YidC) 0.8967 95 352 GO:0005886
GO:0015031
GO:0032977

Feature Viewer

pLDDT pTM Quality
73.02 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map