F418260

General Info

Members Datasets Scaffolds Average Seq Length
350 243 288 357

Family's Representative Sequence

Representative Sequence 3300025909|Ga0207705_10142306|Ga0207705_101423062
Length 425
Sequence MTFGITRPRTLFEKIWDAHVVRPATAEEAGGDDWHDGSILRCASPGLRWTRSPGPAGLWWSMTAVNLGLPLRASAPAVVPGAVPELAGRPAHPGLIDRFGRVARDLRVSVTEKCSLRCTYCMPAEGLPAIPRDDLLSAAEIARLVGIGVRELGVREVRFTGGEPLMRADLAEIVGRSAAVAPGVDLSITTNGIGLDHRIHSLVEAGLTRVNVSLDTVDREHFARLTRRDRLPAVLAGIRAAHDAGLTPLKLNAVMMRETLHDAPSLLAWALENGCRLRFIEQMPLDADRSWLRENMVPADELLAVLGERFTLTEAGRDDPHAPAEEWLVDGWMLNGAPATVGIIASVTRSFCAACDRTRITAEGTVRSCLFGDDETDLRGLLRGGADDDEIAQWWRAAMWGKQAGHGMDAAGFAPPKRSMGAIGG

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2643221613 Oerskovia sp. Root22 Isolate Unclassified
6 2643221721 Oerskovia sp. Root918 Isolate Unclassified
7 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
8 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
9 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
12 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
13 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
14 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
15 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
16 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
17 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
18 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
19 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
20 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
21 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
22 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
23 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
24 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
25 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
26 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
27 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
28 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
29 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
30 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
31 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
32 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
33 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
34 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
35 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
36 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
37 2920879853 Kocuria salina CV6 Isolate Unclassified
38 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
39 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
40 2928153084 Leifsonia sp. 563 Isolate Unclassified
41 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
42 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
43 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
44 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
45 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
46 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
47 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
48 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
49 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
50 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
51 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
52 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
53 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
54 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
55 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
56 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
57 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
58 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
59 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
60 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
61 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
62 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
63 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
64 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
67 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
147 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
148 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
151 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
154 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
155 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
238 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
239 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
242 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
243 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.71
Metatranscriptomes 0.57
Isolates 17.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 8
Nodule 0
Rhizoplane 7.71
Rhizosphere 72.57
Stem 0
Stem Tuber 0
Unclassified 11.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10023795 3300003187 Bacteria 2516
2 Ga0055533_1000001 3300003756 Bacteria 1863437
3 Ga0055525_1000231 3300003759 Bacteria 59489
4 Ga0055527_1000005 3300003760 Bacteria 504776
5 Ga0055542_1000006 3300003762 Bacteria 504776
6 Ga0055529_1000334 3300003763 Bacteria 52660
7 Ga0055541_1001020 3300003841 Bacteria 6523
8 Ga0065714_10094882 3300005288 Bacteria 1803
9 Ga0070658_10068806 3300005327 Bacteria 2895
10 Ga0070670_100153049 3300005331 Bacteria 1996
11 Ga0070677_10080443 3300005333 Bacteria 1393
12 Ga0070666_10104898 3300005335 Bacteria 1952
13 Ga0068868_100230761 3300005338 Bacteria 1553
14 Ga0070661_100287255 3300005344 Bacteria 1277
15 Ga0070669_100007805 3300005353 Bacteria 7646
16 Ga0070675_100046770 3300005354 Bacteria 3545
17 Ga0070671_100017698 3300005355 Bacteria 5776
18 Ga0070674_100049682 3300005356 Bacteria 2885
19 Ga0070673_100058345 3300005364 Bacteria 3051
20 Ga0070659_100040518 3300005366 Bacteria 3640
21 Ga0070667_100015098 3300005367 Bacteria 6379
22 Ga0070667_100120518 3300005367 Bacteria 2281
23 Ga0070714_100163368 3300005435 Bacteria 2016
24 Ga0070672_100024157 3300005543 Bacteria 4487
25 Ga0070665_100334579 3300005548 Bacteria 1519
26 Ga0068855_100072194 3300005563 Bacteria 4013
27 Ga0068855_100189308 3300005563 Bacteria 2322
28 Ga0068859_100021225 3300005617 Bacteria 6517
29 Ga0068858_100001687 3300005842 Bacteria 22569
30 Ga0075432_10009526 3300006058 Bacteria 3309
31 Ga0075370_10034142 3300006353 Bacteria 2851
32 Ga0097620_100021225 3300006931 Bacteria 6517
33 Ga0105244_10004039 3300009036 Bacteria 10247
34 Ga0105243_10005694 3300009148 Bacteria 9691
35 Ga0105243_10046385 3300009148 Bacteria 3418
36 Ga0105248_10127188 3300009177 Bacteria 2874
37 Ga0105238_10119202 3300009551 Bacteria 2619
38 Ga0157369_10153616 3300013105 Bacteria 2432
39 Ga0157375_10270237 3300013308 Bacteria 1862
40 Ga0157375_10330523 3300013308 Bacteria 1689
41 Ga0157379_10005574 3300014968 Bacteria 10817
42 Ga0206354_10019886 3300020081 Bacteria 4525
43 Ga0206353_11171241 3300020082 Bacteria 3872
44 Ga0209566_100055 3300025225 Bacteria 210307
45 Ga0209674_100001 3300025226 Bacteria 4013750
46 Ga0209672_100003 3300025228 Bacteria 1560476
47 Ga0209563_100001 3300025230 Bacteria 4013775
48 Ga0207425_1003276 3300025245 Bacteria 5272
49 Ga0209677_100001 3300025253 Bacteria 4013787
50 Ga0209677_100673 3300025253 Bacteria 17620
51 Ga0209148_1000004 3300025254 Bacteria 1844481
52 Ga0209129_1000079 3300025258 Bacteria 187308
53 Ga0209233_1026154 3300025261 Bacteria 1431
54 Ga0209455_1000022 3300025272 Bacteria 688910
55 Ga0209455_1001707 3300025272 Bacteria 9400
56 Ga0209025_1000458 3300025294 Bacteria 79809
57 Ga0207655_1034329 3300025728 Bacteria 2282
58 Ga0207713_1052097 3300025735 Bacteria 1623
59 Ga0207645_10012935 3300025907 Bacteria 5645
60 Ga0207705_10017697 3300025909 Bacteria 5098
61 Ga0207705_10142306 3300025909 Bacteria 1792
62 Ga0207681_10040590 3300025923 Bacteria 3098
63 Ga0207659_10345546 3300025926 Bacteria 1233
64 Ga0207664_10140901 3300025929 Bacteria 2040
65 Ga0207644_10082726 3300025931 Bacteria 2376
66 Ga0207690_10011784 3300025932 Bacteria 5228
67 Ga0207709_10009117 3300025935 Bacteria 5468
68 Ga0207691_10004181 3300025940 Bacteria 14020
69 Ga0207667_10012146 3300025949 Bacteria 9946
70 Ga0207667_10059136 3300025949 Bacteria 4016
71 Ga0207651_10064828 3300025960 Bacteria 2559
72 Ga0207677_10046299 3300026023 Bacteria 2911
73 Ga0207703_10000168 3300026035 Bacteria 76234
74 Ga0207639_10001513 3300026041 Bacteria 15626
75 Ga0207683_10002349 3300026121 Bacteria 16575
76 Ga0207428_10002426 3300027907 Bacteria 18605
77 Ga0314311_1070805 3300030733 Bacteria 2054
78 Ga0307408_100053580 3300031548 Bacteria 2913
79 Ga0307408_100082559 3300031548 Bacteria 2405
80 Ga0307408_100112188 3300031548 Bacteria 2096
81 Ga0307408_100162964 3300031548 Bacteria 1772
82 Ga0307408_100265768 3300031548 Bacteria 1422
83 Ga0307408_100364081 3300031548 Bacteria 1231
84 Ga0307405_10031033 3300031731 Bacteria 3141
85 Ga0307405_10066356 3300031731 Bacteria 2300
86 Ga0307405_10086332 3300031731 Bacteria 2065
87 Ga0307405_10160480 3300031731 Bacteria 1592
88 Ga0307413_10059384 3300031824 Bacteria 2349
89 Ga0307413_10198776 3300031824 Bacteria 1446
90 Ga0307410_10014668 3300031852 Bacteria 4620
91 Ga0307410_10062105 3300031852 Bacteria 2558
92 Ga0307410_10103937 3300031852 Bacteria 2041
93 Ga0307410_10131425 3300031852 Bacteria 1839
94 Ga0307410_10231470 3300031852 Bacteria 1427
95 Ga0307410_10330937 3300031852 Bacteria 1211
96 Ga0307406_10098372 3300031901 Bacteria 1986
97 Ga0307407_10050675 3300031903 Bacteria 2376
98 Ga0307412_10020370 3300031911 Bacteria 4036
99 Ga0307412_10062391 3300031911 Bacteria 2509
100 Ga0307412_10332840 3300031911 Bacteria 1212
101 Ga0307409_100062998 3300031995 Bacteria 2906
102 Ga0307409_100073915 3300031995 Bacteria 2721
103 Ga0307409_100178665 3300031995 Bacteria 1876
104 Ga0307416_100007848 3300032002 Bacteria 6823
105 Ga0307416_100049591 3300032002 Bacteria 3339
106 Ga0307416_100051571 3300032002 Bacteria 3287
107 Ga0307416_100086893 3300032002 Bacteria 2667
108 Ga0307416_100096625 3300032002 Bacteria 2555
109 Ga0307416_100256475 3300032002 Bacteria 1706
110 Ga0307416_100269492 3300032002 Bacteria 1670
111 Ga0307416_100370287 3300032002 Bacteria 1458
112 Ga0307414_10045184 3300032004 Bacteria 3015
113 Ga0307414_10096370 3300032004 Bacteria 2213
114 Ga0307411_10016473 3300032005 Bacteria 4184
115 Ga0307411_10175753 3300032005 Bacteria 1620
116 Ga0307415_100006900 3300032126 Bacteria 6166
117 Ga0307415_100025474 3300032126 Bacteria 3713
118 Ga0307415_100046996 3300032126 Bacteria 2903
119 Ga0307415_100059996 3300032126 Bacteria 2626
120 Ga0307415_100122705 3300032126 Bacteria 1951
121 Ga0395899_0003594 3300037312 Bacteria 12264
122 Ga0395899_0178636 3300037312 Bacteria 1491
123 Ga0395900_0013120 3300037418 Bacteria 8467
124 Ga0395900_0019582 3300037418 Bacteria 6900
125 Ga0395900_0030021 3300037418 Bacteria 5580
126 Ga0395900_0040872 3300037418 Bacteria 4780
127 Ga0395900_0074651 3300037418 Bacteria 3486
128 Ga0395900_0096752 3300037418 Bacteria 3033
129 Ga0395898_0000246 3300037466 Bacteria 135487
130 Ga0395898_0031251 3300037466 Bacteria 5322
131 Ga0395898_0052083 3300037466 Bacteria 3999
132 Ga0395898_0089077 3300037466 Bacteria 2970
133 Ga0395898_0103680 3300037466 Bacteria 2728
134 Ga0395898_0310398 3300037466 Bacteria 1504
135 Ga0395905_0178567 3300037471 Bacteria 1993
136 Ga0395901_0047597 3300038443 Bacteria 4452
137 Ga0395901_0120171 3300038443 Bacteria 2761
138 Ga0395901_0136727 3300038443 Bacteria 2575
139 Ga0395901_0173814 3300038443 Bacteria 2260
140 Ga0439436_0012538 3300041404 Bacteria 2571
141 Ga0439436_0017751 3300041404 Bacteria 2129
142 Ga0439436_0029426 3300041404 Bacteria 1600
143 Ga0439436_0032986 3300041404 Bacteria 1500
144 Ga0439438_030070 3300041405 Bacteria 1450
145 Ga0439466_0007329 3300041411 Bacteria 4179
146 Ga0439466_0010672 3300041411 Bacteria 3413
147 Ga0439466_0039439 3300041411 Bacteria 1583
148 Ga0439465_0024869 3300041413 Bacteria 1888
149 Ga0439465_0109911 3300041413 Bacteria 959
150 Ga0439433_0006072 3300041999 Bacteria 2595
151 Ga0439442_000462 3300042002 Bacteria 9278
152 Ga0439442_001525 3300042002 Bacteria 4542
153 Ga0439442_023504 3300042002 Bacteria 1281
154 Ga0439449_0000825 3300042007 Bacteria 11992
155 Ga0439449_0003162 3300042007 Bacteria 6411
156 Ga0439449_0031246 3300042007 Bacteria 1985
157 Ga0439462_0009956 3300042015 Bacteria 2406
158 Ga0439462_0017359 3300042015 Bacteria 1864
159 Ga0450920_001133 3300042122 Bacteria 4370
160 Ga0450920_001563 3300042122 Bacteria 3809
161 Ga0450907_000350 3300042146 Bacteria 14354
162 Ga0439434_0001022 3300042435 Bacteria 8082
163 Ga0450918_009976 3300042531 Bacteria 1659
164 Ga0466972_0028378 3300044658 Bacteria 2761
165 Ga0466972_0030524 3300044658 Bacteria 2652
166 Ga0466972_0078352 3300044658 Bacteria 1574
167 Ga0466965_0028372 3300044683 Bacteria 2720
168 Ga0466966_0090180 3300044684 Bacteria 1903
169 Ga0466961_0179896 3300044693 Bacteria 1313
170 Ga0466971_0073057 3300044719 Bacteria 1559
171 Ga0466970_0019411 3300044765 Bacteria 3524
172 Ga0466970_0019712 3300044765 Bacteria 3498
173 Ga0466957_0044197 3300044842 Bacteria 2700
174 Ga0466960_0020401 3300044901 Bacteria 2935
175 Ga0466959_0023078 3300045049 Bacteria 4602
176 Ga0495627_009931 3300046453 Bacteria 3484
177 Ga0495629_0074668 3300046459 Bacteria 2367
178 Ga0495653_0004126 3300046463 Bacteria 11751
179 Ga0495580_0004189 3300046472 Bacteria 12137
180 Ga0495639_0011556 3300046475 Bacteria 3809
181 Ga0495662_0010092 3300046476 Bacteria 4632
182 Ga0495664_0030122 3300046477 Bacteria 3178
183 Ga0495594_0012865 3300046499 Bacteria 4364
184 Ga0495607_0027965 3300046501 Bacteria 3482
185 Ga0495630_0064153 3300046517 Bacteria 2759
186 Ga0495642_0004830 3300046528 Bacteria 5207
187 Ga0495665_0009676 3300046531 Bacteria 5219
188 Ga0495665_0017480 3300046531 Bacteria 3857
189 Ga0495587_0006004 3300046536 Bacteria 7915
190 Ga0495645_0020246 3300046543 Bacteria 4797
191 Ga0495656_0022608 3300046615 Bacteria 2465
192 Ga0495635_0040692 3300046663 Bacteria 3212
193 Ga0495588_0008681 3300046674 Bacteria 4669
194 Ga0495588_0019511 3300046674 Bacteria 3321
195 Ga0495657_0015836 3300046675 Bacteria 5507
196 Ga0495623_0011111 3300046679 Bacteria 5828
197 Ga0495670_0005585 3300046691 Bacteria 6170
198 Ga0495600_0000445 3300046809 Bacteria 21337
199 Ga0495581_0003897 3300047315 Bacteria 8583
200 Ga0495581_0080244 3300047315 Bacteria 1888
201 Ga0495604_0095551 3300047317 Bacteria 2195
202 Ga0495636_0008512 3300047318 Bacteria 4049
203 Ga0495636_0097197 3300047318 Bacteria 1284
204 Ga0495672_0035933 3300047320 Bacteria 3047
205 Ga0495680_0013588 3300047322 Bacteria 7094
206 Ga0495683_0000772 3300047323 Bacteria 23032
207 Ga0495675_0009083 3300047444 Bacteria 6177
208 Ga0495684_0040162 3300047471 Bacteria 3587
209 Ga0496100_0166392 3300048903 Bacteria 1584
210 Ga0496100_0382861 3300048903 Bacteria 1068
211 Ga0496101_0027393 3300048904 Bacteria 3970
212 Ga0496101_0038660 3300048904 Bacteria 3389
213 Ga0496101_0207547 3300048904 Bacteria 1516
214 Ga0496101_0409482 3300048904 Bacteria 1068
215 Ga0496102_0088316 3300048905 Bacteria 2865
216 Ga0496102_0117299 3300048905 Bacteria 2484
217 Ga0496102_0186602 3300048905 Bacteria 1954
218 Ga0496103_0055142 3300048906 Bacteria 2464
219 Ga0496104_0162141 3300048907 Bacteria 2144
220 Ga0496105_0100407 3300048908 Bacteria 2389
221 Ga0496105_0162685 3300048908 Bacteria 1832
222 Ga0496106_0024601 3300048909 Bacteria 4478
223 Ga0496106_0119035 3300048909 Bacteria 2063
224 Ga0496106_0197986 3300048909 Bacteria 1598
225 Ga0496107_0036954 3300048910 Bacteria 3504
226 Ga0496109_0351936 3300048912 Bacteria 1391
227 Ga0496110_0023136 3300048913 Bacteria 5284
228 Ga0496111_0052728 3300048914 Bacteria 2937
229 Ga0496111_0172812 3300048914 Bacteria 1605
230 Ga0496112_0020858 3300048915 Bacteria 6219
231 Ga0496113_0049487 3300048916 Bacteria 3129
232 Ga0496114_0038861 3300048917 Bacteria 3938
233 Ga0496114_0105938 3300048917 Bacteria 2405
234 Ga0496114_0246052 3300048917 Bacteria 1573
235 Ga0496115_0034085 3300048918 Bacteria 4023
236 Ga0496117_0008407 3300048920 Bacteria 9810
237 Ga0496117_0011773 3300048920 Bacteria 7796
238 Ga0496117_0062646 3300048920 Bacteria 2547
239 Ga0496118_0005994 3300048921 Bacteria 13564
240 Ga0496119_0004529 3300048922 Bacteria 13790
241 Ga0496120_0001093 3300048923 Bacteria 35422
242 Ga0496124_0123734 3300048927 Bacteria 2063
243 Ga0496125_0043406 3300048928 Bacteria 3816
244 Ga0496125_0147403 3300048928 Bacteria 1624
245 Ga0496126_0004562 3300048929 Bacteria 16454
246 Ga0496126_0350024 3300048929 Bacteria 1208
247 Ga0501031_0004323 3300049568 Bacteria 9194
248 Ga0501032_0000360 3300049569 Bacteria 37966
249 Ga0501032_0008920 3300049569 Bacteria 7291
250 Ga0501032_0012342 3300049569 Bacteria 6107
251 Ga0501033_0055356 3300049570 Bacteria 2932
252 Ga0501033_0067452 3300049570 Bacteria 2630
253 Ga0501034_0000015 3300049571 Bacteria 296163
254 Ga0501034_0036877 3300049571 Bacteria 4950
255 Ga0501036_0008708 3300049572 Bacteria 8322
256 Ga0501036_0212521 3300049572 Bacteria 1625
257 Ga0501037_0023258 3300049573 Bacteria 4582
258 Ga0501037_0037206 3300049573 Bacteria 3587
259 Ga0501038_0028087 3300049574 Bacteria 4999
260 Ga0501038_0055279 3300049574 Bacteria 3410
261 Ga0501038_0064109 3300049574 Bacteria 3134
262 Ga0501039_0058838 3300049575 Bacteria 2977
263 Ga0501042_0004516 3300049578 Bacteria 8880
264 Ga0501043_0002592 3300049579 Bacteria 15270
265 Ga0501043_0108657 3300049579 Bacteria 2178
266 Ga0501046_0001917 3300049580 Bacteria 19745
267 Ga0501047_0052131 3300049581 Bacteria 3954
268 Ga0501047_0090742 3300049581 Bacteria 2932
269 Ga0501048_0013751 3300049582 Bacteria 6004
270 Ga0501070_0102519 3300049586 Bacteria 2367
271 Ga0501083_0013892 3300049744 Bacteria 5630
272 Ga0501083_0091034 3300049744 Bacteria 2014
273 Ga0501035_0002180 3300049822 Bacteria 19423
274 Ga0501035_0060567 3300049822 Bacteria 3369
275 Ga0501044_0068539 3300049823 Bacteria 3613
276 Ga0501044_0176515 3300049823 Bacteria 2105
277 Ga0501044_0288377 3300049823 Bacteria 1573
278 Ga0501044_0384209 3300049823 Bacteria 1319
279 Ga0501045_0085312 3300049824 Bacteria 2330
280 nmdc:mga00v17_134739_c1 3300050491 Bacteria 1580
281 Ga0495655_0011422 3300053083 Bacteria 1784
282 Ga0500650_0108592 3300053098 Bacteria 1295
283 Ga0500556_0000001 3300053104 Bacteria 1135060
284 Ga0500568_0000003 3300053139 Bacteria 863587
285 Ga0500573_0028272 3300053140 Bacteria 3229
286 Ga0500573_0082409 3300053140 Bacteria 1827
287 Ga0500577_0001521 3300053142 Bacteria 5905
288 Ga0590075_008500 3300059424 Bacteria 2453

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0109911 Ga0439465_0109911_26_940 300
2 3300013105 Ga0157369_10153616 Ga0157369_101536162 316
3 3300037418 Ga0395900_0013120 Ga0395900_0013120_1597_2547 316
4 3300037418 Ga0395900_0040872 Ga0395900_0040872_2624_3574 316
5 3300037466 Ga0395898_0031251 Ga0395898_0031251_3973_4923 316
6 3300037466 Ga0395898_0089077 Ga0395898_0089077_296_1246 316
7 3300037466 Ga0395898_0310398 Ga0395898_0310398_106_1056 316
8 3300038443 Ga0395901_0047597 Ga0395901_0047597_1182_2132 316
9 3300038443 Ga0395901_0120171 Ga0395901_0120171_1246_2196 316
10 3300041404 Ga0439436_0012538 Ga0439436_0012538_1524_2474 316
11 3300041411 Ga0439466_0039439 Ga0439466_0039439_614_1564 316
12 3300042002 Ga0439442_000462 Ga0439442_000462_1672_2622 316
13 3300042007 Ga0439449_0031246 Ga0439449_0031246_580_1530 316
14 3300042122 Ga0450920_001133 Ga0450920_001133_2847_3797 316
15 3300042146 Ga0450907_000350 Ga0450907_000350_560_1510 316
16 3300042435 Ga0439434_0001022 Ga0439434_0001022_6545_7495 316
17 3300042531 Ga0450918_009976 Ga0450918_009976_217_1167 316
18 3300046472 Ga0495580_0004189 Ga0495580_0004189_2441_3391 316
19 3300046475 Ga0495639_0011556 Ga0495639_0011556_978_1928 316
20 3300046674 Ga0495588_0008681 Ga0495588_0008681_1499_2449 316
21 3300048904 Ga0496101_0409482 Ga0496101_0409482_81_1031 316
22 3300048905 Ga0496102_0186602 Ga0496102_0186602_601_1581 316
23 3300048909 Ga0496106_0119035 Ga0496106_0119035_316_1296 316
24 3300049574 Ga0501038_0064109 Ga0501038_0064109_1431_2381 316
25 3300049823 Ga0501044_0384209 Ga0501044_0384209_64_1014 316
26 3300044765 Ga0466970_0019411 Ga0466970_0019411_1473_2576 322
27 3300044901 Ga0466960_0020401 Ga0466960_0020401_1750_2853 322
28 3300046453 Ga0495627_009931 Ga0495627_009931_1895_2899 322
29 iso_pu_bacteria 2690315906 2691513443 328
30 3300003760 Ga0055527_1000005 Ga0055527_100000515 332
31 3300003762 Ga0055542_1000006 Ga0055542_100000615 332
32 3300003763 Ga0055529_1000334 Ga0055529_100033415 332
33 3300005335 Ga0070666_10104898 Ga0070666_101048982 332
34 3300005353 Ga0070669_100007805 Ga0070669_1000078057 332
35 3300005354 Ga0070675_100046770 Ga0070675_1000467705 332
36 3300005356 Ga0070674_100049682 Ga0070674_1000496823 332
37 3300005364 Ga0070673_100058345 Ga0070673_1000583454 332
38 3300009036 Ga0105244_10004039 Ga0105244_100040396 332
39 3300013308 Ga0157375_10330523 Ga0157375_103305232 332
40 3300025228 Ga0209672_100003 Ga0209672_100003359 332
41 3300025254 Ga0209148_1000004 Ga0209148_1000004654 332
42 3300025261 Ga0209233_1026154 Ga0209233_10261542 332
43 3300025272 Ga0209455_1000022 Ga0209455_1000022329 332
44 3300026121 Ga0207683_10002349 Ga0207683_100023496 332
45 3300031995 Ga0307409_100178665 Ga0307409_1001786652 332
46 3300032002 Ga0307416_100256475 Ga0307416_1002564752 332
47 3300032004 Ga0307414_10096370 Ga0307414_100963702 332
48 3300042015 Ga0439462_0017359 Ga0439462_0017359_629_1627 332
49 3300042122 Ga0450920_001563 Ga0450920_001563_267_1265 332
50 3300046476 Ga0495662_0010092 Ga0495662_0010092_3620_4618 332
51 3300048903 Ga0496100_0382861 Ga0496100_0382861_38_1036 332
52 3300048909 Ga0496106_0024601 Ga0496106_0024601_3395_4393 332
53 3300048912 Ga0496109_0351936 Ga0496109_0351936_303_1301 332
54 3300048928 Ga0496125_0147403 Ga0496125_0147403_391_1389 332
55 3300049569 Ga0501032_0008920 Ga0501032_0008920_2999_4012 332
56 3300049572 Ga0501036_0212521 Ga0501036_0212521_327_1340 332
57 3300037418 Ga0395900_0019582 Ga0395900_0019582_1962_3026 334
58 3300037466 Ga0395898_0000246 Ga0395898_0000246_27453_28517 334
59 3300048929 Ga0496126_0350024 Ga0496126_0350024_92_1177 336
60 3300053104 Ga0500556_0000001 Ga0500556_0000001_894294_895310 336
61 3300053139 Ga0500568_0000003 Ga0500568_0000003_725732_726748 336
62 3300048903 Ga0496100_0166392 Ga0496100_0166392_225_1310 338
63 3300048904 Ga0496101_0038660 Ga0496101_0038660_1044_2129 338
64 3300048905 Ga0496102_0117299 Ga0496102_0117299_196_1281 338
65 3300048908 Ga0496105_0100407 Ga0496105_0100407_908_1993 338
66 3300048917 Ga0496114_0105938 Ga0496114_0105938_425_1510 338
67 3300048918 Ga0496115_0034085 Ga0496115_0034085_2923_4008 338
68 3300009551 Ga0105238_10119202 Ga0105238_101192021 340
69 3300031911 Ga0307412_10332840 Ga0307412_103328401 340
70 3300032005 Ga0307411_10016473 Ga0307411_100164733 340
71 iso_pu_bacteria 2932398195 2932399870 341
72 3300048907 Ga0496104_0162141 Ga0496104_0162141_450_1478 342
73 iso_pu_bacteria 2547132424 2548694218 342
74 iso_pu_bacteria 2551306166 2552109768 342
75 iso_pu_bacteria 2738543011 2739239808 342
76 3300053098 Ga0500650_0108592 Ga0500650_0108592_96_1142 345
77 3300053142 Ga0500577_0001521 Ga0500577_0001521_3097_4143 345
78 3300005435 Ga0070714_100163368 Ga0070714_1001633683 346
79 3300009148 Ga0105243_10005694 Ga0105243_100056945 346
80 3300025929 Ga0207664_10140901 Ga0207664_101409013 346
81 3300025935 Ga0207709_10009117 Ga0207709_100091175 346
82 3300031824 Ga0307413_10198776 Ga0307413_101987761 346
83 3300032002 Ga0307416_100051571 Ga0307416_1000515714 346
84 3300032126 Ga0307415_100025474 Ga0307415_1000254744 346
85 3300037312 Ga0395899_0178636 Ga0395899_0178636_255_1364 346
86 3300038443 Ga0395901_0136727 Ga0395901_0136727_865_1974 346
87 3300041404 Ga0439436_0032986 Ga0439436_0032986_421_1464 347
88 3300041411 Ga0439466_0007329 Ga0439466_0007329_2010_3053 347
89 3300041413 Ga0439465_0024869 Ga0439465_0024869_791_1834 347
90 3300042007 Ga0439449_0000825 Ga0439449_0000825_5539_6582 347
91 3300042015 Ga0439462_0009956 Ga0439462_0009956_1240_2283 347
92 3300046674 Ga0495588_0019511 Ga0495588_0019511_247_1347 347
93 3300047320 Ga0495672_0035933 Ga0495672_0035933_1322_2374 347
94 iso_pu_bacteria 2565956761 2566994305 347
95 iso_pu_bacteria 2919713450 2919716406 347
96 iso_pu_bacteria 2974315732 2974317130 347
97 iso_pu_bacteria 2852643534 2852646128 348
98 iso_pu_bacteria 2857729791 2857730993 348
99 iso_pu_bacteria 2928121344 2928122446 348
100 iso_pu_bacteria 2939657138 2939660052 348
101 iso_pu_bacteria 2984523437 2984525336 348
102 iso_pu_bacteria 2984523437 2984527273 348
103 3300044719 Ga0466971_0073057 Ga0466971_0073057_103_1164 349
104 3300046531 Ga0495665_0017480 Ga0495665_0017480_2014_3069 349
105 3300049574 Ga0501038_0028087 Ga0501038_0028087_648_1718 349
106 iso_pu_bacteria 2744054611 2744958018 349
107 3300006353 Ga0075370_10034142 Ga0075370_100341423 350
108 3300031852 Ga0307410_10231470 Ga0307410_102314701 350
109 3300044693 Ga0466961_0179896 Ga0466961_0179896_164_1252 350
110 3300046501 Ga0495607_0027965 Ga0495607_0027965_1562_2629 350
111 3300047323 Ga0495683_0000772 Ga0495683_0000772_8755_9822 350
112 3300048928 Ga0496125_0043406 Ga0496125_0043406_2698_3756 350
113 iso_pu_bacteria 2643221613 2644082171 350
114 iso_pu_bacteria 2643221721 2644664730 350
115 iso_pu_bacteria 2738541308 2738887109 350
116 iso_pu_bacteria 2839986021 2839988433 350
117 iso_pu_bacteria 2889300758 2889300819 350
118 iso_pu_bacteria 2928142448 2928142638 350
119 iso_pu_bacteria 2932431166 2932432382 350
120 iso_pu_bacteria 2935890801 2935894297 350
121 iso_pu_bacteria 2939743619 2939744329 350
122 3300005338 Ga0068868_100230761 Ga0068868_1002307612 351
123 3300005355 Ga0070671_100017698 Ga0070671_1000176986 351
124 3300032005 Ga0307411_10175753 Ga0307411_101757532 351
125 3300048908 Ga0496105_0162685 Ga0496105_0162685_287_1354 351
126 3300048917 Ga0496114_0038861 Ga0496114_0038861_148_1215 351
127 3300048929 Ga0496126_0004562 Ga0496126_0004562_5771_6838 351
128 3300049568 Ga0501031_0004323 Ga0501031_0004323_5504_6571 351
129 3300049569 Ga0501032_0012342 Ga0501032_0012342_730_1797 351
130 3300049570 Ga0501033_0055356 Ga0501033_0055356_1364_2431 351
131 3300049570 Ga0501033_0067452 Ga0501033_0067452_587_1657 351
132 3300049571 Ga0501034_0036877 Ga0501034_0036877_1124_2191 351
133 3300049572 Ga0501036_0008708 Ga0501036_0008708_4471_5538 351
134 3300049573 Ga0501037_0037206 Ga0501037_0037206_439_1506 351
135 3300049574 Ga0501038_0055279 Ga0501038_0055279_1842_2909 351
136 3300049575 Ga0501039_0058838 Ga0501039_0058838_784_1851 351
137 3300049578 Ga0501042_0004516 Ga0501042_0004516_872_1939 351
138 3300049579 Ga0501043_0108657 Ga0501043_0108657_416_1483 351
139 3300049580 Ga0501046_0001917 Ga0501046_0001917_13714_14781 351
140 3300049581 Ga0501047_0052131 Ga0501047_0052131_2587_3657 351
141 3300049581 Ga0501047_0090742 Ga0501047_0090742_1364_2431 351
142 3300049582 Ga0501048_0013751 Ga0501048_0013751_4087_5154 351
143 3300049586 Ga0501070_0102519 Ga0501070_0102519_190_1257 351
144 3300049744 Ga0501083_0013892 Ga0501083_0013892_4247_5314 351
145 3300049744 Ga0501083_0091034 Ga0501083_0091034_345_1412 351
146 3300049822 Ga0501035_0002180 Ga0501035_0002180_3237_4301 351
147 3300049822 Ga0501035_0060567 Ga0501035_0060567_1594_2661 351
148 3300049823 Ga0501044_0068539 Ga0501044_0068539_2045_3112 351
149 3300049823 Ga0501044_0176515 Ga0501044_0176515_720_1790 351
150 3300049824 Ga0501045_0085312 Ga0501045_0085312_13_1080 351
151 3300050491 nmdc:mga00v17_134739_c1 nmdc:mga00v17_134739_c1_469_1536 351
152 3300053140 Ga0500573_0028272 Ga0500573_0028272_1925_2992 351
153 3300053140 Ga0500573_0082409 Ga0500573_0082409_730_1797 351
154 iso_pu_bacteria 2738543034 2739367284 351
155 iso_pu_bacteria 2808606366 2808879804 351
156 iso_pu_bacteria 2808606700 2810363469 352
157 iso_pu_bacteria 2905926851 2905930225 352
158 iso_pu_bacteria 2946003308 2946004012 352
159 3300005327 Ga0070658_10068806 Ga0070658_100688063 353
160 3300005344 Ga0070661_100287255 Ga0070661_1002872551 353
161 3300005366 Ga0070659_100040518 Ga0070659_1000405182 353
162 3300005367 Ga0070667_100015098 Ga0070667_1000150988 353
163 3300005563 Ga0068855_100072194 Ga0068855_1000721942 353
164 3300005563 Ga0068855_100189308 Ga0068855_1001893082 353
165 3300005617 Ga0068859_100021225 Ga0068859_1000212254 353
166 3300005842 Ga0068858_100001687 Ga0068858_10000168719 353
167 3300006931 Ga0097620_100021225 Ga0097620_1000212254 353
168 3300014968 Ga0157379_10005574 Ga0157379_100055746 353
169 3300025909 Ga0207705_10017697 Ga0207705_100176974 353
170 3300025932 Ga0207690_10011784 Ga0207690_100117842 353
171 3300025949 Ga0207667_10012146 Ga0207667_100121464 353
172 3300025949 Ga0207667_10059136 Ga0207667_100591362 353
173 3300026023 Ga0207677_10046299 Ga0207677_100462994 353
174 3300026035 Ga0207703_10000168 Ga0207703_1000016822 353
175 3300026041 Ga0207639_10001513 Ga0207639_100015136 353
176 3300048922 Ga0496119_0004529 Ga0496119_0004529_6596_7672 353
177 3300048923 Ga0496120_0001093 Ga0496120_0001093_33362_34438 353
178 3300048920 Ga0496117_0011773 Ga0496117_0011773_1895_2977 354
179 3300048920 Ga0496117_0062646 Ga0496117_0062646_756_1838 354
180 3300048921 Ga0496118_0005994 Ga0496118_0005994_7085_8167 354
181 iso_pu_bacteria 2844841374 2844841843 354
182 iso_pu_bacteria 2919055335 2919059032 354
183 iso_pu_bacteria 2928153084 2928153120 354
184 3300038443 Ga0395901_0173814 Ga0395901_0173814_884_1999 355
185 3300044658 Ga0466972_0028378 Ga0466972_0028378_85_1179 355
186 3300044683 Ga0466965_0028372 Ga0466965_0028372_439_1509 355
187 3300053083 Ga0495655_0011422 Ga0495655_0011422_372_1472 355
188 iso_pu_bacteria 2537561592 2537898607 355
189 iso_pu_bacteria 2738541272 2738693484 355
190 iso_pu_bacteria 2738543027 2739323100 355
191 iso_pu_bacteria 2739367654 2739607708 355
192 iso_pu_bacteria 2758568522 2760304272 355
193 iso_pu_bacteria 2919523602 2919523891 355
194 3300005331 Ga0070670_100153049 Ga0070670_1001530492 357
195 3300005333 Ga0070677_10080443 Ga0070677_100804432 357
196 3300005367 Ga0070667_100120518 Ga0070667_1001205183 357
197 3300005543 Ga0070672_100024157 Ga0070672_1000241573 357
198 3300009177 Ga0105248_10127188 Ga0105248_101271883 357
199 3300020081 Ga0206354_10019886 Ga0206354_100198863 357
200 3300020082 Ga0206353_11171241 Ga0206353_111712412 357
201 3300025253 Ga0209677_100673 Ga0209677_10067312 357
202 3300025272 Ga0209455_1001707 Ga0209455_10017076 357
203 3300025909 Ga0207705_10142306 Ga0207705_101423062 357
204 3300025940 Ga0207691_10004181 Ga0207691_1000418111 357
205 3300031852 Ga0307410_10131425 Ga0307410_101314252 357
206 3300031995 Ga0307409_100073915 Ga0307409_1000739153 357
207 3300032002 Ga0307416_100096625 Ga0307416_1000966253 357
208 3300037312 Ga0395899_0003594 Ga0395899_0003594_8214_9308 357
209 3300037418 Ga0395900_0074651 Ga0395900_0074651_43_1137 357
210 3300046691 Ga0495670_0005585 Ga0495670_0005585_2873_3955 357
211 3300047315 Ga0495581_0080244 Ga0495581_0080244_168_1250 357
212 3300047318 Ga0495636_0008512 Ga0495636_0008512_427_1509 357
213 3300048904 Ga0496101_0027393 Ga0496101_0027393_2300_3382 357
214 3300048904 Ga0496101_0207547 Ga0496101_0207547_226_1308 357
215 3300048905 Ga0496102_0088316 Ga0496102_0088316_748_1830 357
216 3300048906 Ga0496103_0055142 Ga0496103_0055142_943_2025 357
217 3300048909 Ga0496106_0197986 Ga0496106_0197986_226_1308 357
218 3300048910 Ga0496107_0036954 Ga0496107_0036954_2129_3211 357
219 3300048916 Ga0496113_0049487 Ga0496113_0049487_291_1373 357
220 3300048917 Ga0496114_0246052 Ga0496114_0246052_470_1552 357
221 3300048920 Ga0496117_0008407 Ga0496117_0008407_2211_3302 357
222 3300048927 Ga0496124_0123734 Ga0496124_0123734_369_1451 357
223 3300003756 Ga0055533_1000001 Ga0055533_1000001181 358
224 3300003759 Ga0055525_1000231 Ga0055525_100023120 358
225 3300003841 Ga0055541_1001020 Ga0055541_10010204 358
226 3300025225 Ga0209566_100055 Ga0209566_10005538 358
227 3300025226 Ga0209674_100001 Ga0209674_100001182 358
228 3300025230 Ga0209563_100001 Ga0209563_100001182 358
229 3300025253 Ga0209677_100001 Ga0209677_100001182 358
230 3300030733 Ga0314311_1070805 Ga0314311_10708052 358
231 3300044658 Ga0466972_0030524 Ga0466972_0030524_278_1384 358
232 3300044658 Ga0466972_0078352 Ga0466972_0078352_237_1346 358
233 3300044684 Ga0466966_0090180 Ga0466966_0090180_640_1746 358
234 3300044765 Ga0466970_0019712 Ga0466970_0019712_664_1773 358
235 3300044842 Ga0466957_0044197 Ga0466957_0044197_1269_2378 358
236 3300045049 Ga0466959_0023078 Ga0466959_0023078_1811_2920 358
237 3300046663 Ga0495635_0040692 Ga0495635_0040692_196_1335 358
238 iso_pu_bacteria 2758568621 2760621776 358
239 iso_pu_bacteria 2919051321 2919053234 358
240 3300031548 Ga0307408_100053580 Ga0307408_1000535802 359
241 3300031903 Ga0307407_10050675 Ga0307407_100506752 359
242 3300032126 Ga0307415_100059996 Ga0307415_1000599963 359
243 iso_pu_bacteria 2920879853 2920880642 359
244 3300027907 Ga0207428_10002426 Ga0207428_1000242610 361
245 3300037471 Ga0395905_0178567 Ga0395905_0178567_539_1633 361
246 3300037418 Ga0395900_0096752 Ga0395900_0096752_298_1401 362
247 3300037466 Ga0395898_0103680 Ga0395898_0103680_17_1120 362
248 3300046459 Ga0495629_0074668 Ga0495629_0074668_582_1682 362
249 3300046463 Ga0495653_0004126 Ga0495653_0004126_2526_3626 362
250 3300046477 Ga0495664_0030122 Ga0495664_0030122_156_1256 362
251 3300046499 Ga0495594_0012865 Ga0495594_0012865_2208_3308 362
252 3300046517 Ga0495630_0064153 Ga0495630_0064153_457_1557 362
253 3300046531 Ga0495665_0009676 Ga0495665_0009676_2231_3331 362
254 3300046536 Ga0495587_0006004 Ga0495587_0006004_3845_4945 362
255 3300046543 Ga0495645_0020246 Ga0495645_0020246_3299_4399 362
256 3300046675 Ga0495657_0015836 Ga0495657_0015836_2464_3564 362
257 3300046679 Ga0495623_0011111 Ga0495623_0011111_3745_4845 362
258 3300046809 Ga0495600_0000445 Ga0495600_0000445_4344_5444 362
259 3300047315 Ga0495581_0003897 Ga0495581_0003897_2062_3162 362
260 3300047317 Ga0495604_0095551 Ga0495604_0095551_839_1939 362
261 3300047322 Ga0495680_0013588 Ga0495680_0013588_3679_4779 362
262 3300047444 Ga0495675_0009083 Ga0495675_0009083_993_2093 362
263 3300047471 Ga0495684_0040162 Ga0495684_0040162_1867_2967 362
264 3300006058 Ga0075432_10009526 Ga0075432_100095263 363
265 3300031548 Ga0307408_100162964 Ga0307408_1001629643 363
266 3300031731 Ga0307405_10066356 Ga0307405_100663562 363
267 3300031852 Ga0307410_10014668 Ga0307410_100146685 363
268 3300032126 Ga0307415_100046996 Ga0307415_1000469961 363
269 3300037418 Ga0395900_0030021 Ga0395900_0030021_2138_3238 363
270 3300037466 Ga0395898_0052083 Ga0395898_0052083_581_1681 363
271 3300031548 Ga0307408_100112188 Ga0307408_1001121883 366
272 3300041404 Ga0439436_0017751 Ga0439436_0017751_1007_2116 366
273 3300041404 Ga0439436_0029426 Ga0439436_0029426_441_1550 366
274 3300048915 Ga0496112_0020858 Ga0496112_0020858_1046_2155 366
275 3300049573 Ga0501037_0023258 Ga0501037_0023258_2112_3236 366
276 3300049823 Ga0501044_0288377 Ga0501044_0288377_321_1445 366
277 iso_pu_bacteria 2808606370 2808894948 366
278 iso_pu_bacteria 2945920336 2945924467 366
279 iso_pu_bacteria 2946037020 2946039765 366
280 iso_pu_bacteria 2953998280 2954000990 366
281 3300032002 Ga0307416_100049591 Ga0307416_1000495913 367
282 3300046528 Ga0495642_0004830 Ga0495642_0004830_2872_3987 367
283 3300046615 Ga0495656_0022608 Ga0495656_0022608_111_1226 367
284 3300047318 Ga0495636_0097197 Ga0495636_0097197_99_1214 367
285 iso_pu_bacteria 2920879853 2920879974 367
286 iso_pu_bacteria 2920879853 2920883217 367
287 3300042002 Ga0439442_001525 Ga0439442_001525_3050_4168 368
288 iso_pu_bacteria 2808606357 2808830694 368
289 iso_pu_bacteria 2808606371 2808895901 368
290 iso_pu_bacteria 2939598168 2939600006 368
291 iso_pu_bacteria 2945916053 2945919622 368
292 iso_pu_bacteria 2946059875 2946063347 368
293 iso_pu_bacteria 2974302888 2974303269 368
294 3300009148 Ga0105243_10046385 Ga0105243_100463852 369
295 3300013308 Ga0157375_10270237 Ga0157375_102702372 369
296 3300048913 Ga0496110_0023136 Ga0496110_0023136_495_1616 369
297 3300048914 Ga0496111_0052728 Ga0496111_0052728_514_1635 369
298 3300048914 Ga0496111_0172812 Ga0496111_0172812_38_1159 369
299 iso_pu_bacteria 2939647034 2939647933 369
300 3300031548 Ga0307408_100364081 Ga0307408_1003640811 370
301 3300031824 Ga0307413_10059384 Ga0307413_100593843 370
302 3300031852 Ga0307410_10062105 Ga0307410_100621053 370
303 3300031901 Ga0307406_10098372 Ga0307406_100983722 370
304 3300032002 Ga0307416_100086893 Ga0307416_1000868933 370
305 3300032126 Ga0307415_100122705 Ga0307415_1001227052 370
306 3300031548 Ga0307408_100082559 Ga0307408_1000825593 371
307 3300031911 Ga0307412_10062391 Ga0307412_100623913 371
308 3300032002 Ga0307416_100370287 Ga0307416_1003702871 371
309 iso_pu_bacteria 2857740372 2857743738 371
310 iso_pu_bacteria 2904497146 2904499640 371
311 iso_pu_bacteria 2904776348 2904780296 371
312 iso_pu_bacteria 2910809715 2910811689 371
313 iso_pu_bacteria 2919034639 2919036090 371
314 iso_pu_bacteria 2932426870 2932431038 371
315 iso_pu_bacteria 2933418574 2933419120 371
316 iso_pu_bacteria 2939674588 2939678484 371
317 3300005288 Ga0065714_10094882 Ga0065714_100948821 372
318 3300031731 Ga0307405_10086332 Ga0307405_100863322 372
319 3300031731 Ga0307405_10160480 Ga0307405_101604802 372
320 3300031852 Ga0307410_10330937 Ga0307410_103309371 372
321 3300032002 Ga0307416_100269492 Ga0307416_1002694921 372
322 3300041999 Ga0439433_0006072 Ga0439433_0006072_230_1357 372
323 3300031731 Ga0307405_10031033 Ga0307405_100310334 373
324 3300031911 Ga0307412_10020370 Ga0307412_100203702 373
325 3300032002 Ga0307416_100007848 Ga0307416_1000078483 373
326 3300032004 Ga0307414_10045184 Ga0307414_100451842 373
327 3300032126 Ga0307415_100006900 Ga0307415_1000069003 373
328 3300041405 Ga0439438_030070 Ga0439438_030070_197_1390 374
329 3300041411 Ga0439466_0010672 Ga0439466_0010672_1685_2878 374
330 3300042007 Ga0439449_0003162 Ga0439449_0003162_3951_5144 374
331 3300059424 Ga0590075_008500 Ga0590075_008500_828_2030 374
332 3300005548 Ga0070665_100334579 Ga0070665_1003345791 375
333 3300025258 Ga0209129_1000079 Ga0209129_100007973 375
334 3300025728 Ga0207655_1034329 Ga0207655_10343294 375
335 3300025735 Ga0207713_1052097 Ga0207713_10520971 375
336 3300025907 Ga0207645_10012935 Ga0207645_100129351 375
337 3300025923 Ga0207681_10040590 Ga0207681_100405903 375
338 3300025926 Ga0207659_10345546 Ga0207659_103455461 375
339 3300025931 Ga0207644_10082726 Ga0207644_100827264 375
340 3300025960 Ga0207651_10064828 Ga0207651_100648284 375
341 3300031852 Ga0307410_10103937 Ga0307410_101039373 375
342 3300031995 Ga0307409_100062998 Ga0307409_1000629983 375
343 3300042002 Ga0439442_023504 Ga0439442_023504_124_1251 375
344 3300049569 Ga0501032_0000360 Ga0501032_0000360_17627_18754 375
345 3300049571 Ga0501034_0000015 Ga0501034_0000015_66165_67292 375
346 3300049579 Ga0501043_0002592 Ga0501043_0002592_6893_8020 375
347 3300031548 Ga0307408_100265768 Ga0307408_1002657682 380
348 3300003187 JGI25151J46595_10023795 JGI25151J46595_100237952 381
349 3300025245 Ga0207425_1003276 Ga0207425_10032764 381
350 3300025294 Ga0209025_1000458 Ga0209025_100045841 381

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

108

270

0.97

PF06463

Mob_synth_C

Molybdenum Cofactor Synthesis C

275

408

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.9017 33 351
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.9017 33 351
2fb2-assembly1.cif.gz_B structure of the moaa arg17/266/268/ala triple mutant 0.8433 33 351
1tv8-assembly1.cif.gz_A structure of moaa in complex with s-adenosylmethionine 0.8408 33 351
5v1t-assembly1.cif.gz_A crystal structure of streptococcus suis suib bound to precursor peptide suia 0.8217 37 247
ID Description Score Start End Superfamily
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9421 30 381 3.20.20.70
af_P9WJS1_27_360_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9394 30 381 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9174 33 381 3.20.20.70
af_I1KTQ5_72_400_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.904 33 381 3.20.20.70
1tv8A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9017 33 351 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2P7P2C6-F1-model_v4 deleted 0.9908 96 184
AF-A0A3D5GIT7-F1-model_v4 GTP 3',8-cyclase MoaA 0.9761 33 225 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A4R8H3R1-F1-model_v4 deleted 0.9729 33 205
AF-A0A3D5GIT7-F1-model_v4 GTP 3',8-cyclase MoaA 0.9711 33 225 GO:0006777
GO:0046872
GO:0051539
GO:0061798
GO:0061799
AF-A0A2P7P2C6-F1-model_v4 deleted 0.9692 96 184

Feature Viewer

pLDDT pTM Quality
82.47 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map