F418260
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 243 | 288 | 357 |
Family's Representative Sequence
| Representative Sequence | 3300025909|Ga0207705_10142306|Ga0207705_101423062 |
| Length | 425 |
| Sequence | MTFGITRPRTLFEKIWDAHVVRPATAEEAGGDDWHDGSILRCASPGLRWTRSPGPAGLWWSMTAVNLGLPLRASAPAVVPGAVPELAGRPAHPGLIDRFGRVARDLRVSVTEKCSLRCTYCMPAEGLPAIPRDDLLSAAEIARLVGIGVRELGVREVRFTGGEPLMRADLAEIVGRSAAVAPGVDLSITTNGIGLDHRIHSLVEAGLTRVNVSLDTVDREHFARLTRRDRLPAVLAGIRAAHDAGLTPLKLNAVMMRETLHDAPSLLAWALENGCRLRFIEQMPLDADRSWLRENMVPADELLAVLGERFTLTEAGRDDPHAPAEEWLVDGWMLNGAPATVGIIASVTRSFCAACDRTRITAEGTVRSCLFGDDETDLRGLLRGGADDDEIAQWWRAAMWGKQAGHGMDAAGFAPPKRSMGAIGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 3 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 4 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 5 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 6 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 7 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 8 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 9 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 10 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 11 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 12 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 13 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 14 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 15 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 16 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 17 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 18 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 19 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 20 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 21 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 22 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 23 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 24 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 25 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 26 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 27 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 28 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 29 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 30 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 31 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 32 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 33 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 34 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 35 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 36 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 37 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 38 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 39 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 40 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 41 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 42 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 43 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 44 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 45 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 46 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 47 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 48 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 49 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 50 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 51 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 52 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 53 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 54 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 55 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 56 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 57 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 58 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 59 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 60 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 61 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 62 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 128 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 132 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 135 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 136 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 137 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 138 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 139 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 142 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 143 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 144 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 147 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 148 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 149 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 150 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 151 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 152 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 153 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 154 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 155 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 156 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 157 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 158 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 159 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 160 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 161 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 162 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 163 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 164 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 165 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 166 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 167 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 208 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 209 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 210 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 214 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 215 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 216 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 239 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 240 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 242 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 243 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.71 |
| Metatranscriptomes | 0.57 |
| Isolates | 17.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.57 |
| Bulb | 0 |
| Endosphere | 8 |
| Nodule | 0 |
| Rhizoplane | 7.71 |
| Rhizosphere | 72.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10023795 | 3300003187 | Bacteria | 2516 |
| 2 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 3 | Ga0055525_1000231 | 3300003759 | Bacteria | 59489 |
| 4 | Ga0055527_1000005 | 3300003760 | Bacteria | 504776 |
| 5 | Ga0055542_1000006 | 3300003762 | Bacteria | 504776 |
| 6 | Ga0055529_1000334 | 3300003763 | Bacteria | 52660 |
| 7 | Ga0055541_1001020 | 3300003841 | Bacteria | 6523 |
| 8 | Ga0065714_10094882 | 3300005288 | Bacteria | 1803 |
| 9 | Ga0070658_10068806 | 3300005327 | Bacteria | 2895 |
| 10 | Ga0070670_100153049 | 3300005331 | Bacteria | 1996 |
| 11 | Ga0070677_10080443 | 3300005333 | Bacteria | 1393 |
| 12 | Ga0070666_10104898 | 3300005335 | Bacteria | 1952 |
| 13 | Ga0068868_100230761 | 3300005338 | Bacteria | 1553 |
| 14 | Ga0070661_100287255 | 3300005344 | Bacteria | 1277 |
| 15 | Ga0070669_100007805 | 3300005353 | Bacteria | 7646 |
| 16 | Ga0070675_100046770 | 3300005354 | Bacteria | 3545 |
| 17 | Ga0070671_100017698 | 3300005355 | Bacteria | 5776 |
| 18 | Ga0070674_100049682 | 3300005356 | Bacteria | 2885 |
| 19 | Ga0070673_100058345 | 3300005364 | Bacteria | 3051 |
| 20 | Ga0070659_100040518 | 3300005366 | Bacteria | 3640 |
| 21 | Ga0070667_100015098 | 3300005367 | Bacteria | 6379 |
| 22 | Ga0070667_100120518 | 3300005367 | Bacteria | 2281 |
| 23 | Ga0070714_100163368 | 3300005435 | Bacteria | 2016 |
| 24 | Ga0070672_100024157 | 3300005543 | Bacteria | 4487 |
| 25 | Ga0070665_100334579 | 3300005548 | Bacteria | 1519 |
| 26 | Ga0068855_100072194 | 3300005563 | Bacteria | 4013 |
| 27 | Ga0068855_100189308 | 3300005563 | Bacteria | 2322 |
| 28 | Ga0068859_100021225 | 3300005617 | Bacteria | 6517 |
| 29 | Ga0068858_100001687 | 3300005842 | Bacteria | 22569 |
| 30 | Ga0075432_10009526 | 3300006058 | Bacteria | 3309 |
| 31 | Ga0075370_10034142 | 3300006353 | Bacteria | 2851 |
| 32 | Ga0097620_100021225 | 3300006931 | Bacteria | 6517 |
| 33 | Ga0105244_10004039 | 3300009036 | Bacteria | 10247 |
| 34 | Ga0105243_10005694 | 3300009148 | Bacteria | 9691 |
| 35 | Ga0105243_10046385 | 3300009148 | Bacteria | 3418 |
| 36 | Ga0105248_10127188 | 3300009177 | Bacteria | 2874 |
| 37 | Ga0105238_10119202 | 3300009551 | Bacteria | 2619 |
| 38 | Ga0157369_10153616 | 3300013105 | Bacteria | 2432 |
| 39 | Ga0157375_10270237 | 3300013308 | Bacteria | 1862 |
| 40 | Ga0157375_10330523 | 3300013308 | Bacteria | 1689 |
| 41 | Ga0157379_10005574 | 3300014968 | Bacteria | 10817 |
| 42 | Ga0206354_10019886 | 3300020081 | Bacteria | 4525 |
| 43 | Ga0206353_11171241 | 3300020082 | Bacteria | 3872 |
| 44 | Ga0209566_100055 | 3300025225 | Bacteria | 210307 |
| 45 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 46 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 47 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 48 | Ga0207425_1003276 | 3300025245 | Bacteria | 5272 |
| 49 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 50 | Ga0209677_100673 | 3300025253 | Bacteria | 17620 |
| 51 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 52 | Ga0209129_1000079 | 3300025258 | Bacteria | 187308 |
| 53 | Ga0209233_1026154 | 3300025261 | Bacteria | 1431 |
| 54 | Ga0209455_1000022 | 3300025272 | Bacteria | 688910 |
| 55 | Ga0209455_1001707 | 3300025272 | Bacteria | 9400 |
| 56 | Ga0209025_1000458 | 3300025294 | Bacteria | 79809 |
| 57 | Ga0207655_1034329 | 3300025728 | Bacteria | 2282 |
| 58 | Ga0207713_1052097 | 3300025735 | Bacteria | 1623 |
| 59 | Ga0207645_10012935 | 3300025907 | Bacteria | 5645 |
| 60 | Ga0207705_10017697 | 3300025909 | Bacteria | 5098 |
| 61 | Ga0207705_10142306 | 3300025909 | Bacteria | 1792 |
| 62 | Ga0207681_10040590 | 3300025923 | Bacteria | 3098 |
| 63 | Ga0207659_10345546 | 3300025926 | Bacteria | 1233 |
| 64 | Ga0207664_10140901 | 3300025929 | Bacteria | 2040 |
| 65 | Ga0207644_10082726 | 3300025931 | Bacteria | 2376 |
| 66 | Ga0207690_10011784 | 3300025932 | Bacteria | 5228 |
| 67 | Ga0207709_10009117 | 3300025935 | Bacteria | 5468 |
| 68 | Ga0207691_10004181 | 3300025940 | Bacteria | 14020 |
| 69 | Ga0207667_10012146 | 3300025949 | Bacteria | 9946 |
| 70 | Ga0207667_10059136 | 3300025949 | Bacteria | 4016 |
| 71 | Ga0207651_10064828 | 3300025960 | Bacteria | 2559 |
| 72 | Ga0207677_10046299 | 3300026023 | Bacteria | 2911 |
| 73 | Ga0207703_10000168 | 3300026035 | Bacteria | 76234 |
| 74 | Ga0207639_10001513 | 3300026041 | Bacteria | 15626 |
| 75 | Ga0207683_10002349 | 3300026121 | Bacteria | 16575 |
| 76 | Ga0207428_10002426 | 3300027907 | Bacteria | 18605 |
| 77 | Ga0314311_1070805 | 3300030733 | Bacteria | 2054 |
| 78 | Ga0307408_100053580 | 3300031548 | Bacteria | 2913 |
| 79 | Ga0307408_100082559 | 3300031548 | Bacteria | 2405 |
| 80 | Ga0307408_100112188 | 3300031548 | Bacteria | 2096 |
| 81 | Ga0307408_100162964 | 3300031548 | Bacteria | 1772 |
| 82 | Ga0307408_100265768 | 3300031548 | Bacteria | 1422 |
| 83 | Ga0307408_100364081 | 3300031548 | Bacteria | 1231 |
| 84 | Ga0307405_10031033 | 3300031731 | Bacteria | 3141 |
| 85 | Ga0307405_10066356 | 3300031731 | Bacteria | 2300 |
| 86 | Ga0307405_10086332 | 3300031731 | Bacteria | 2065 |
| 87 | Ga0307405_10160480 | 3300031731 | Bacteria | 1592 |
| 88 | Ga0307413_10059384 | 3300031824 | Bacteria | 2349 |
| 89 | Ga0307413_10198776 | 3300031824 | Bacteria | 1446 |
| 90 | Ga0307410_10014668 | 3300031852 | Bacteria | 4620 |
| 91 | Ga0307410_10062105 | 3300031852 | Bacteria | 2558 |
| 92 | Ga0307410_10103937 | 3300031852 | Bacteria | 2041 |
| 93 | Ga0307410_10131425 | 3300031852 | Bacteria | 1839 |
| 94 | Ga0307410_10231470 | 3300031852 | Bacteria | 1427 |
| 95 | Ga0307410_10330937 | 3300031852 | Bacteria | 1211 |
| 96 | Ga0307406_10098372 | 3300031901 | Bacteria | 1986 |
| 97 | Ga0307407_10050675 | 3300031903 | Bacteria | 2376 |
| 98 | Ga0307412_10020370 | 3300031911 | Bacteria | 4036 |
| 99 | Ga0307412_10062391 | 3300031911 | Bacteria | 2509 |
| 100 | Ga0307412_10332840 | 3300031911 | Bacteria | 1212 |
| 101 | Ga0307409_100062998 | 3300031995 | Bacteria | 2906 |
| 102 | Ga0307409_100073915 | 3300031995 | Bacteria | 2721 |
| 103 | Ga0307409_100178665 | 3300031995 | Bacteria | 1876 |
| 104 | Ga0307416_100007848 | 3300032002 | Bacteria | 6823 |
| 105 | Ga0307416_100049591 | 3300032002 | Bacteria | 3339 |
| 106 | Ga0307416_100051571 | 3300032002 | Bacteria | 3287 |
| 107 | Ga0307416_100086893 | 3300032002 | Bacteria | 2667 |
| 108 | Ga0307416_100096625 | 3300032002 | Bacteria | 2555 |
| 109 | Ga0307416_100256475 | 3300032002 | Bacteria | 1706 |
| 110 | Ga0307416_100269492 | 3300032002 | Bacteria | 1670 |
| 111 | Ga0307416_100370287 | 3300032002 | Bacteria | 1458 |
| 112 | Ga0307414_10045184 | 3300032004 | Bacteria | 3015 |
| 113 | Ga0307414_10096370 | 3300032004 | Bacteria | 2213 |
| 114 | Ga0307411_10016473 | 3300032005 | Bacteria | 4184 |
| 115 | Ga0307411_10175753 | 3300032005 | Bacteria | 1620 |
| 116 | Ga0307415_100006900 | 3300032126 | Bacteria | 6166 |
| 117 | Ga0307415_100025474 | 3300032126 | Bacteria | 3713 |
| 118 | Ga0307415_100046996 | 3300032126 | Bacteria | 2903 |
| 119 | Ga0307415_100059996 | 3300032126 | Bacteria | 2626 |
| 120 | Ga0307415_100122705 | 3300032126 | Bacteria | 1951 |
| 121 | Ga0395899_0003594 | 3300037312 | Bacteria | 12264 |
| 122 | Ga0395899_0178636 | 3300037312 | Bacteria | 1491 |
| 123 | Ga0395900_0013120 | 3300037418 | Bacteria | 8467 |
| 124 | Ga0395900_0019582 | 3300037418 | Bacteria | 6900 |
| 125 | Ga0395900_0030021 | 3300037418 | Bacteria | 5580 |
| 126 | Ga0395900_0040872 | 3300037418 | Bacteria | 4780 |
| 127 | Ga0395900_0074651 | 3300037418 | Bacteria | 3486 |
| 128 | Ga0395900_0096752 | 3300037418 | Bacteria | 3033 |
| 129 | Ga0395898_0000246 | 3300037466 | Bacteria | 135487 |
| 130 | Ga0395898_0031251 | 3300037466 | Bacteria | 5322 |
| 131 | Ga0395898_0052083 | 3300037466 | Bacteria | 3999 |
| 132 | Ga0395898_0089077 | 3300037466 | Bacteria | 2970 |
| 133 | Ga0395898_0103680 | 3300037466 | Bacteria | 2728 |
| 134 | Ga0395898_0310398 | 3300037466 | Bacteria | 1504 |
| 135 | Ga0395905_0178567 | 3300037471 | Bacteria | 1993 |
| 136 | Ga0395901_0047597 | 3300038443 | Bacteria | 4452 |
| 137 | Ga0395901_0120171 | 3300038443 | Bacteria | 2761 |
| 138 | Ga0395901_0136727 | 3300038443 | Bacteria | 2575 |
| 139 | Ga0395901_0173814 | 3300038443 | Bacteria | 2260 |
| 140 | Ga0439436_0012538 | 3300041404 | Bacteria | 2571 |
| 141 | Ga0439436_0017751 | 3300041404 | Bacteria | 2129 |
| 142 | Ga0439436_0029426 | 3300041404 | Bacteria | 1600 |
| 143 | Ga0439436_0032986 | 3300041404 | Bacteria | 1500 |
| 144 | Ga0439438_030070 | 3300041405 | Bacteria | 1450 |
| 145 | Ga0439466_0007329 | 3300041411 | Bacteria | 4179 |
| 146 | Ga0439466_0010672 | 3300041411 | Bacteria | 3413 |
| 147 | Ga0439466_0039439 | 3300041411 | Bacteria | 1583 |
| 148 | Ga0439465_0024869 | 3300041413 | Bacteria | 1888 |
| 149 | Ga0439465_0109911 | 3300041413 | Bacteria | 959 |
| 150 | Ga0439433_0006072 | 3300041999 | Bacteria | 2595 |
| 151 | Ga0439442_000462 | 3300042002 | Bacteria | 9278 |
| 152 | Ga0439442_001525 | 3300042002 | Bacteria | 4542 |
| 153 | Ga0439442_023504 | 3300042002 | Bacteria | 1281 |
| 154 | Ga0439449_0000825 | 3300042007 | Bacteria | 11992 |
| 155 | Ga0439449_0003162 | 3300042007 | Bacteria | 6411 |
| 156 | Ga0439449_0031246 | 3300042007 | Bacteria | 1985 |
| 157 | Ga0439462_0009956 | 3300042015 | Bacteria | 2406 |
| 158 | Ga0439462_0017359 | 3300042015 | Bacteria | 1864 |
| 159 | Ga0450920_001133 | 3300042122 | Bacteria | 4370 |
| 160 | Ga0450920_001563 | 3300042122 | Bacteria | 3809 |
| 161 | Ga0450907_000350 | 3300042146 | Bacteria | 14354 |
| 162 | Ga0439434_0001022 | 3300042435 | Bacteria | 8082 |
| 163 | Ga0450918_009976 | 3300042531 | Bacteria | 1659 |
| 164 | Ga0466972_0028378 | 3300044658 | Bacteria | 2761 |
| 165 | Ga0466972_0030524 | 3300044658 | Bacteria | 2652 |
| 166 | Ga0466972_0078352 | 3300044658 | Bacteria | 1574 |
| 167 | Ga0466965_0028372 | 3300044683 | Bacteria | 2720 |
| 168 | Ga0466966_0090180 | 3300044684 | Bacteria | 1903 |
| 169 | Ga0466961_0179896 | 3300044693 | Bacteria | 1313 |
| 170 | Ga0466971_0073057 | 3300044719 | Bacteria | 1559 |
| 171 | Ga0466970_0019411 | 3300044765 | Bacteria | 3524 |
| 172 | Ga0466970_0019712 | 3300044765 | Bacteria | 3498 |
| 173 | Ga0466957_0044197 | 3300044842 | Bacteria | 2700 |
| 174 | Ga0466960_0020401 | 3300044901 | Bacteria | 2935 |
| 175 | Ga0466959_0023078 | 3300045049 | Bacteria | 4602 |
| 176 | Ga0495627_009931 | 3300046453 | Bacteria | 3484 |
| 177 | Ga0495629_0074668 | 3300046459 | Bacteria | 2367 |
| 178 | Ga0495653_0004126 | 3300046463 | Bacteria | 11751 |
| 179 | Ga0495580_0004189 | 3300046472 | Bacteria | 12137 |
| 180 | Ga0495639_0011556 | 3300046475 | Bacteria | 3809 |
| 181 | Ga0495662_0010092 | 3300046476 | Bacteria | 4632 |
| 182 | Ga0495664_0030122 | 3300046477 | Bacteria | 3178 |
| 183 | Ga0495594_0012865 | 3300046499 | Bacteria | 4364 |
| 184 | Ga0495607_0027965 | 3300046501 | Bacteria | 3482 |
| 185 | Ga0495630_0064153 | 3300046517 | Bacteria | 2759 |
| 186 | Ga0495642_0004830 | 3300046528 | Bacteria | 5207 |
| 187 | Ga0495665_0009676 | 3300046531 | Bacteria | 5219 |
| 188 | Ga0495665_0017480 | 3300046531 | Bacteria | 3857 |
| 189 | Ga0495587_0006004 | 3300046536 | Bacteria | 7915 |
| 190 | Ga0495645_0020246 | 3300046543 | Bacteria | 4797 |
| 191 | Ga0495656_0022608 | 3300046615 | Bacteria | 2465 |
| 192 | Ga0495635_0040692 | 3300046663 | Bacteria | 3212 |
| 193 | Ga0495588_0008681 | 3300046674 | Bacteria | 4669 |
| 194 | Ga0495588_0019511 | 3300046674 | Bacteria | 3321 |
| 195 | Ga0495657_0015836 | 3300046675 | Bacteria | 5507 |
| 196 | Ga0495623_0011111 | 3300046679 | Bacteria | 5828 |
| 197 | Ga0495670_0005585 | 3300046691 | Bacteria | 6170 |
| 198 | Ga0495600_0000445 | 3300046809 | Bacteria | 21337 |
| 199 | Ga0495581_0003897 | 3300047315 | Bacteria | 8583 |
| 200 | Ga0495581_0080244 | 3300047315 | Bacteria | 1888 |
| 201 | Ga0495604_0095551 | 3300047317 | Bacteria | 2195 |
| 202 | Ga0495636_0008512 | 3300047318 | Bacteria | 4049 |
| 203 | Ga0495636_0097197 | 3300047318 | Bacteria | 1284 |
| 204 | Ga0495672_0035933 | 3300047320 | Bacteria | 3047 |
| 205 | Ga0495680_0013588 | 3300047322 | Bacteria | 7094 |
| 206 | Ga0495683_0000772 | 3300047323 | Bacteria | 23032 |
| 207 | Ga0495675_0009083 | 3300047444 | Bacteria | 6177 |
| 208 | Ga0495684_0040162 | 3300047471 | Bacteria | 3587 |
| 209 | Ga0496100_0166392 | 3300048903 | Bacteria | 1584 |
| 210 | Ga0496100_0382861 | 3300048903 | Bacteria | 1068 |
| 211 | Ga0496101_0027393 | 3300048904 | Bacteria | 3970 |
| 212 | Ga0496101_0038660 | 3300048904 | Bacteria | 3389 |
| 213 | Ga0496101_0207547 | 3300048904 | Bacteria | 1516 |
| 214 | Ga0496101_0409482 | 3300048904 | Bacteria | 1068 |
| 215 | Ga0496102_0088316 | 3300048905 | Bacteria | 2865 |
| 216 | Ga0496102_0117299 | 3300048905 | Bacteria | 2484 |
| 217 | Ga0496102_0186602 | 3300048905 | Bacteria | 1954 |
| 218 | Ga0496103_0055142 | 3300048906 | Bacteria | 2464 |
| 219 | Ga0496104_0162141 | 3300048907 | Bacteria | 2144 |
| 220 | Ga0496105_0100407 | 3300048908 | Bacteria | 2389 |
| 221 | Ga0496105_0162685 | 3300048908 | Bacteria | 1832 |
| 222 | Ga0496106_0024601 | 3300048909 | Bacteria | 4478 |
| 223 | Ga0496106_0119035 | 3300048909 | Bacteria | 2063 |
| 224 | Ga0496106_0197986 | 3300048909 | Bacteria | 1598 |
| 225 | Ga0496107_0036954 | 3300048910 | Bacteria | 3504 |
| 226 | Ga0496109_0351936 | 3300048912 | Bacteria | 1391 |
| 227 | Ga0496110_0023136 | 3300048913 | Bacteria | 5284 |
| 228 | Ga0496111_0052728 | 3300048914 | Bacteria | 2937 |
| 229 | Ga0496111_0172812 | 3300048914 | Bacteria | 1605 |
| 230 | Ga0496112_0020858 | 3300048915 | Bacteria | 6219 |
| 231 | Ga0496113_0049487 | 3300048916 | Bacteria | 3129 |
| 232 | Ga0496114_0038861 | 3300048917 | Bacteria | 3938 |
| 233 | Ga0496114_0105938 | 3300048917 | Bacteria | 2405 |
| 234 | Ga0496114_0246052 | 3300048917 | Bacteria | 1573 |
| 235 | Ga0496115_0034085 | 3300048918 | Bacteria | 4023 |
| 236 | Ga0496117_0008407 | 3300048920 | Bacteria | 9810 |
| 237 | Ga0496117_0011773 | 3300048920 | Bacteria | 7796 |
| 238 | Ga0496117_0062646 | 3300048920 | Bacteria | 2547 |
| 239 | Ga0496118_0005994 | 3300048921 | Bacteria | 13564 |
| 240 | Ga0496119_0004529 | 3300048922 | Bacteria | 13790 |
| 241 | Ga0496120_0001093 | 3300048923 | Bacteria | 35422 |
| 242 | Ga0496124_0123734 | 3300048927 | Bacteria | 2063 |
| 243 | Ga0496125_0043406 | 3300048928 | Bacteria | 3816 |
| 244 | Ga0496125_0147403 | 3300048928 | Bacteria | 1624 |
| 245 | Ga0496126_0004562 | 3300048929 | Bacteria | 16454 |
| 246 | Ga0496126_0350024 | 3300048929 | Bacteria | 1208 |
| 247 | Ga0501031_0004323 | 3300049568 | Bacteria | 9194 |
| 248 | Ga0501032_0000360 | 3300049569 | Bacteria | 37966 |
| 249 | Ga0501032_0008920 | 3300049569 | Bacteria | 7291 |
| 250 | Ga0501032_0012342 | 3300049569 | Bacteria | 6107 |
| 251 | Ga0501033_0055356 | 3300049570 | Bacteria | 2932 |
| 252 | Ga0501033_0067452 | 3300049570 | Bacteria | 2630 |
| 253 | Ga0501034_0000015 | 3300049571 | Bacteria | 296163 |
| 254 | Ga0501034_0036877 | 3300049571 | Bacteria | 4950 |
| 255 | Ga0501036_0008708 | 3300049572 | Bacteria | 8322 |
| 256 | Ga0501036_0212521 | 3300049572 | Bacteria | 1625 |
| 257 | Ga0501037_0023258 | 3300049573 | Bacteria | 4582 |
| 258 | Ga0501037_0037206 | 3300049573 | Bacteria | 3587 |
| 259 | Ga0501038_0028087 | 3300049574 | Bacteria | 4999 |
| 260 | Ga0501038_0055279 | 3300049574 | Bacteria | 3410 |
| 261 | Ga0501038_0064109 | 3300049574 | Bacteria | 3134 |
| 262 | Ga0501039_0058838 | 3300049575 | Bacteria | 2977 |
| 263 | Ga0501042_0004516 | 3300049578 | Bacteria | 8880 |
| 264 | Ga0501043_0002592 | 3300049579 | Bacteria | 15270 |
| 265 | Ga0501043_0108657 | 3300049579 | Bacteria | 2178 |
| 266 | Ga0501046_0001917 | 3300049580 | Bacteria | 19745 |
| 267 | Ga0501047_0052131 | 3300049581 | Bacteria | 3954 |
| 268 | Ga0501047_0090742 | 3300049581 | Bacteria | 2932 |
| 269 | Ga0501048_0013751 | 3300049582 | Bacteria | 6004 |
| 270 | Ga0501070_0102519 | 3300049586 | Bacteria | 2367 |
| 271 | Ga0501083_0013892 | 3300049744 | Bacteria | 5630 |
| 272 | Ga0501083_0091034 | 3300049744 | Bacteria | 2014 |
| 273 | Ga0501035_0002180 | 3300049822 | Bacteria | 19423 |
| 274 | Ga0501035_0060567 | 3300049822 | Bacteria | 3369 |
| 275 | Ga0501044_0068539 | 3300049823 | Bacteria | 3613 |
| 276 | Ga0501044_0176515 | 3300049823 | Bacteria | 2105 |
| 277 | Ga0501044_0288377 | 3300049823 | Bacteria | 1573 |
| 278 | Ga0501044_0384209 | 3300049823 | Bacteria | 1319 |
| 279 | Ga0501045_0085312 | 3300049824 | Bacteria | 2330 |
| 280 | nmdc:mga00v17_134739_c1 | 3300050491 | Bacteria | 1580 |
| 281 | Ga0495655_0011422 | 3300053083 | Bacteria | 1784 |
| 282 | Ga0500650_0108592 | 3300053098 | Bacteria | 1295 |
| 283 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 284 | Ga0500568_0000003 | 3300053139 | Bacteria | 863587 |
| 285 | Ga0500573_0028272 | 3300053140 | Bacteria | 3229 |
| 286 | Ga0500573_0082409 | 3300053140 | Bacteria | 1827 |
| 287 | Ga0500577_0001521 | 3300053142 | Bacteria | 5905 |
| 288 | Ga0590075_008500 | 3300059424 | Bacteria | 2453 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041413 | Ga0439465_0109911 | Ga0439465_0109911_26_940 | 300 |
| 2 | 3300013105 | Ga0157369_10153616 | Ga0157369_101536162 | 316 |
| 3 | 3300037418 | Ga0395900_0013120 | Ga0395900_0013120_1597_2547 | 316 |
| 4 | 3300037418 | Ga0395900_0040872 | Ga0395900_0040872_2624_3574 | 316 |
| 5 | 3300037466 | Ga0395898_0031251 | Ga0395898_0031251_3973_4923 | 316 |
| 6 | 3300037466 | Ga0395898_0089077 | Ga0395898_0089077_296_1246 | 316 |
| 7 | 3300037466 | Ga0395898_0310398 | Ga0395898_0310398_106_1056 | 316 |
| 8 | 3300038443 | Ga0395901_0047597 | Ga0395901_0047597_1182_2132 | 316 |
| 9 | 3300038443 | Ga0395901_0120171 | Ga0395901_0120171_1246_2196 | 316 |
| 10 | 3300041404 | Ga0439436_0012538 | Ga0439436_0012538_1524_2474 | 316 |
| 11 | 3300041411 | Ga0439466_0039439 | Ga0439466_0039439_614_1564 | 316 |
| 12 | 3300042002 | Ga0439442_000462 | Ga0439442_000462_1672_2622 | 316 |
| 13 | 3300042007 | Ga0439449_0031246 | Ga0439449_0031246_580_1530 | 316 |
| 14 | 3300042122 | Ga0450920_001133 | Ga0450920_001133_2847_3797 | 316 |
| 15 | 3300042146 | Ga0450907_000350 | Ga0450907_000350_560_1510 | 316 |
| 16 | 3300042435 | Ga0439434_0001022 | Ga0439434_0001022_6545_7495 | 316 |
| 17 | 3300042531 | Ga0450918_009976 | Ga0450918_009976_217_1167 | 316 |
| 18 | 3300046472 | Ga0495580_0004189 | Ga0495580_0004189_2441_3391 | 316 |
| 19 | 3300046475 | Ga0495639_0011556 | Ga0495639_0011556_978_1928 | 316 |
| 20 | 3300046674 | Ga0495588_0008681 | Ga0495588_0008681_1499_2449 | 316 |
| 21 | 3300048904 | Ga0496101_0409482 | Ga0496101_0409482_81_1031 | 316 |
| 22 | 3300048905 | Ga0496102_0186602 | Ga0496102_0186602_601_1581 | 316 |
| 23 | 3300048909 | Ga0496106_0119035 | Ga0496106_0119035_316_1296 | 316 |
| 24 | 3300049574 | Ga0501038_0064109 | Ga0501038_0064109_1431_2381 | 316 |
| 25 | 3300049823 | Ga0501044_0384209 | Ga0501044_0384209_64_1014 | 316 |
| 26 | 3300044765 | Ga0466970_0019411 | Ga0466970_0019411_1473_2576 | 322 |
| 27 | 3300044901 | Ga0466960_0020401 | Ga0466960_0020401_1750_2853 | 322 |
| 28 | 3300046453 | Ga0495627_009931 | Ga0495627_009931_1895_2899 | 322 |
| 29 | iso_pu_bacteria | 2690315906 | 2691513443 | 328 |
| 30 | 3300003760 | Ga0055527_1000005 | Ga0055527_100000515 | 332 |
| 31 | 3300003762 | Ga0055542_1000006 | Ga0055542_100000615 | 332 |
| 32 | 3300003763 | Ga0055529_1000334 | Ga0055529_100033415 | 332 |
| 33 | 3300005335 | Ga0070666_10104898 | Ga0070666_101048982 | 332 |
| 34 | 3300005353 | Ga0070669_100007805 | Ga0070669_1000078057 | 332 |
| 35 | 3300005354 | Ga0070675_100046770 | Ga0070675_1000467705 | 332 |
| 36 | 3300005356 | Ga0070674_100049682 | Ga0070674_1000496823 | 332 |
| 37 | 3300005364 | Ga0070673_100058345 | Ga0070673_1000583454 | 332 |
| 38 | 3300009036 | Ga0105244_10004039 | Ga0105244_100040396 | 332 |
| 39 | 3300013308 | Ga0157375_10330523 | Ga0157375_103305232 | 332 |
| 40 | 3300025228 | Ga0209672_100003 | Ga0209672_100003359 | 332 |
| 41 | 3300025254 | Ga0209148_1000004 | Ga0209148_1000004654 | 332 |
| 42 | 3300025261 | Ga0209233_1026154 | Ga0209233_10261542 | 332 |
| 43 | 3300025272 | Ga0209455_1000022 | Ga0209455_1000022329 | 332 |
| 44 | 3300026121 | Ga0207683_10002349 | Ga0207683_100023496 | 332 |
| 45 | 3300031995 | Ga0307409_100178665 | Ga0307409_1001786652 | 332 |
| 46 | 3300032002 | Ga0307416_100256475 | Ga0307416_1002564752 | 332 |
| 47 | 3300032004 | Ga0307414_10096370 | Ga0307414_100963702 | 332 |
| 48 | 3300042015 | Ga0439462_0017359 | Ga0439462_0017359_629_1627 | 332 |
| 49 | 3300042122 | Ga0450920_001563 | Ga0450920_001563_267_1265 | 332 |
| 50 | 3300046476 | Ga0495662_0010092 | Ga0495662_0010092_3620_4618 | 332 |
| 51 | 3300048903 | Ga0496100_0382861 | Ga0496100_0382861_38_1036 | 332 |
| 52 | 3300048909 | Ga0496106_0024601 | Ga0496106_0024601_3395_4393 | 332 |
| 53 | 3300048912 | Ga0496109_0351936 | Ga0496109_0351936_303_1301 | 332 |
| 54 | 3300048928 | Ga0496125_0147403 | Ga0496125_0147403_391_1389 | 332 |
| 55 | 3300049569 | Ga0501032_0008920 | Ga0501032_0008920_2999_4012 | 332 |
| 56 | 3300049572 | Ga0501036_0212521 | Ga0501036_0212521_327_1340 | 332 |
| 57 | 3300037418 | Ga0395900_0019582 | Ga0395900_0019582_1962_3026 | 334 |
| 58 | 3300037466 | Ga0395898_0000246 | Ga0395898_0000246_27453_28517 | 334 |
| 59 | 3300048929 | Ga0496126_0350024 | Ga0496126_0350024_92_1177 | 336 |
| 60 | 3300053104 | Ga0500556_0000001 | Ga0500556_0000001_894294_895310 | 336 |
| 61 | 3300053139 | Ga0500568_0000003 | Ga0500568_0000003_725732_726748 | 336 |
| 62 | 3300048903 | Ga0496100_0166392 | Ga0496100_0166392_225_1310 | 338 |
| 63 | 3300048904 | Ga0496101_0038660 | Ga0496101_0038660_1044_2129 | 338 |
| 64 | 3300048905 | Ga0496102_0117299 | Ga0496102_0117299_196_1281 | 338 |
| 65 | 3300048908 | Ga0496105_0100407 | Ga0496105_0100407_908_1993 | 338 |
| 66 | 3300048917 | Ga0496114_0105938 | Ga0496114_0105938_425_1510 | 338 |
| 67 | 3300048918 | Ga0496115_0034085 | Ga0496115_0034085_2923_4008 | 338 |
| 68 | 3300009551 | Ga0105238_10119202 | Ga0105238_101192021 | 340 |
| 69 | 3300031911 | Ga0307412_10332840 | Ga0307412_103328401 | 340 |
| 70 | 3300032005 | Ga0307411_10016473 | Ga0307411_100164733 | 340 |
| 71 | iso_pu_bacteria | 2932398195 | 2932399870 | 341 |
| 72 | 3300048907 | Ga0496104_0162141 | Ga0496104_0162141_450_1478 | 342 |
| 73 | iso_pu_bacteria | 2547132424 | 2548694218 | 342 |
| 74 | iso_pu_bacteria | 2551306166 | 2552109768 | 342 |
| 75 | iso_pu_bacteria | 2738543011 | 2739239808 | 342 |
| 76 | 3300053098 | Ga0500650_0108592 | Ga0500650_0108592_96_1142 | 345 |
| 77 | 3300053142 | Ga0500577_0001521 | Ga0500577_0001521_3097_4143 | 345 |
| 78 | 3300005435 | Ga0070714_100163368 | Ga0070714_1001633683 | 346 |
| 79 | 3300009148 | Ga0105243_10005694 | Ga0105243_100056945 | 346 |
| 80 | 3300025929 | Ga0207664_10140901 | Ga0207664_101409013 | 346 |
| 81 | 3300025935 | Ga0207709_10009117 | Ga0207709_100091175 | 346 |
| 82 | 3300031824 | Ga0307413_10198776 | Ga0307413_101987761 | 346 |
| 83 | 3300032002 | Ga0307416_100051571 | Ga0307416_1000515714 | 346 |
| 84 | 3300032126 | Ga0307415_100025474 | Ga0307415_1000254744 | 346 |
| 85 | 3300037312 | Ga0395899_0178636 | Ga0395899_0178636_255_1364 | 346 |
| 86 | 3300038443 | Ga0395901_0136727 | Ga0395901_0136727_865_1974 | 346 |
| 87 | 3300041404 | Ga0439436_0032986 | Ga0439436_0032986_421_1464 | 347 |
| 88 | 3300041411 | Ga0439466_0007329 | Ga0439466_0007329_2010_3053 | 347 |
| 89 | 3300041413 | Ga0439465_0024869 | Ga0439465_0024869_791_1834 | 347 |
| 90 | 3300042007 | Ga0439449_0000825 | Ga0439449_0000825_5539_6582 | 347 |
| 91 | 3300042015 | Ga0439462_0009956 | Ga0439462_0009956_1240_2283 | 347 |
| 92 | 3300046674 | Ga0495588_0019511 | Ga0495588_0019511_247_1347 | 347 |
| 93 | 3300047320 | Ga0495672_0035933 | Ga0495672_0035933_1322_2374 | 347 |
| 94 | iso_pu_bacteria | 2565956761 | 2566994305 | 347 |
| 95 | iso_pu_bacteria | 2919713450 | 2919716406 | 347 |
| 96 | iso_pu_bacteria | 2974315732 | 2974317130 | 347 |
| 97 | iso_pu_bacteria | 2852643534 | 2852646128 | 348 |
| 98 | iso_pu_bacteria | 2857729791 | 2857730993 | 348 |
| 99 | iso_pu_bacteria | 2928121344 | 2928122446 | 348 |
| 100 | iso_pu_bacteria | 2939657138 | 2939660052 | 348 |
| 101 | iso_pu_bacteria | 2984523437 | 2984525336 | 348 |
| 102 | iso_pu_bacteria | 2984523437 | 2984527273 | 348 |
| 103 | 3300044719 | Ga0466971_0073057 | Ga0466971_0073057_103_1164 | 349 |
| 104 | 3300046531 | Ga0495665_0017480 | Ga0495665_0017480_2014_3069 | 349 |
| 105 | 3300049574 | Ga0501038_0028087 | Ga0501038_0028087_648_1718 | 349 |
| 106 | iso_pu_bacteria | 2744054611 | 2744958018 | 349 |
| 107 | 3300006353 | Ga0075370_10034142 | Ga0075370_100341423 | 350 |
| 108 | 3300031852 | Ga0307410_10231470 | Ga0307410_102314701 | 350 |
| 109 | 3300044693 | Ga0466961_0179896 | Ga0466961_0179896_164_1252 | 350 |
| 110 | 3300046501 | Ga0495607_0027965 | Ga0495607_0027965_1562_2629 | 350 |
| 111 | 3300047323 | Ga0495683_0000772 | Ga0495683_0000772_8755_9822 | 350 |
| 112 | 3300048928 | Ga0496125_0043406 | Ga0496125_0043406_2698_3756 | 350 |
| 113 | iso_pu_bacteria | 2643221613 | 2644082171 | 350 |
| 114 | iso_pu_bacteria | 2643221721 | 2644664730 | 350 |
| 115 | iso_pu_bacteria | 2738541308 | 2738887109 | 350 |
| 116 | iso_pu_bacteria | 2839986021 | 2839988433 | 350 |
| 117 | iso_pu_bacteria | 2889300758 | 2889300819 | 350 |
| 118 | iso_pu_bacteria | 2928142448 | 2928142638 | 350 |
| 119 | iso_pu_bacteria | 2932431166 | 2932432382 | 350 |
| 120 | iso_pu_bacteria | 2935890801 | 2935894297 | 350 |
| 121 | iso_pu_bacteria | 2939743619 | 2939744329 | 350 |
| 122 | 3300005338 | Ga0068868_100230761 | Ga0068868_1002307612 | 351 |
| 123 | 3300005355 | Ga0070671_100017698 | Ga0070671_1000176986 | 351 |
| 124 | 3300032005 | Ga0307411_10175753 | Ga0307411_101757532 | 351 |
| 125 | 3300048908 | Ga0496105_0162685 | Ga0496105_0162685_287_1354 | 351 |
| 126 | 3300048917 | Ga0496114_0038861 | Ga0496114_0038861_148_1215 | 351 |
| 127 | 3300048929 | Ga0496126_0004562 | Ga0496126_0004562_5771_6838 | 351 |
| 128 | 3300049568 | Ga0501031_0004323 | Ga0501031_0004323_5504_6571 | 351 |
| 129 | 3300049569 | Ga0501032_0012342 | Ga0501032_0012342_730_1797 | 351 |
| 130 | 3300049570 | Ga0501033_0055356 | Ga0501033_0055356_1364_2431 | 351 |
| 131 | 3300049570 | Ga0501033_0067452 | Ga0501033_0067452_587_1657 | 351 |
| 132 | 3300049571 | Ga0501034_0036877 | Ga0501034_0036877_1124_2191 | 351 |
| 133 | 3300049572 | Ga0501036_0008708 | Ga0501036_0008708_4471_5538 | 351 |
| 134 | 3300049573 | Ga0501037_0037206 | Ga0501037_0037206_439_1506 | 351 |
| 135 | 3300049574 | Ga0501038_0055279 | Ga0501038_0055279_1842_2909 | 351 |
| 136 | 3300049575 | Ga0501039_0058838 | Ga0501039_0058838_784_1851 | 351 |
| 137 | 3300049578 | Ga0501042_0004516 | Ga0501042_0004516_872_1939 | 351 |
| 138 | 3300049579 | Ga0501043_0108657 | Ga0501043_0108657_416_1483 | 351 |
| 139 | 3300049580 | Ga0501046_0001917 | Ga0501046_0001917_13714_14781 | 351 |
| 140 | 3300049581 | Ga0501047_0052131 | Ga0501047_0052131_2587_3657 | 351 |
| 141 | 3300049581 | Ga0501047_0090742 | Ga0501047_0090742_1364_2431 | 351 |
| 142 | 3300049582 | Ga0501048_0013751 | Ga0501048_0013751_4087_5154 | 351 |
| 143 | 3300049586 | Ga0501070_0102519 | Ga0501070_0102519_190_1257 | 351 |
| 144 | 3300049744 | Ga0501083_0013892 | Ga0501083_0013892_4247_5314 | 351 |
| 145 | 3300049744 | Ga0501083_0091034 | Ga0501083_0091034_345_1412 | 351 |
| 146 | 3300049822 | Ga0501035_0002180 | Ga0501035_0002180_3237_4301 | 351 |
| 147 | 3300049822 | Ga0501035_0060567 | Ga0501035_0060567_1594_2661 | 351 |
| 148 | 3300049823 | Ga0501044_0068539 | Ga0501044_0068539_2045_3112 | 351 |
| 149 | 3300049823 | Ga0501044_0176515 | Ga0501044_0176515_720_1790 | 351 |
| 150 | 3300049824 | Ga0501045_0085312 | Ga0501045_0085312_13_1080 | 351 |
| 151 | 3300050491 | nmdc:mga00v17_134739_c1 | nmdc:mga00v17_134739_c1_469_1536 | 351 |
| 152 | 3300053140 | Ga0500573_0028272 | Ga0500573_0028272_1925_2992 | 351 |
| 153 | 3300053140 | Ga0500573_0082409 | Ga0500573_0082409_730_1797 | 351 |
| 154 | iso_pu_bacteria | 2738543034 | 2739367284 | 351 |
| 155 | iso_pu_bacteria | 2808606366 | 2808879804 | 351 |
| 156 | iso_pu_bacteria | 2808606700 | 2810363469 | 352 |
| 157 | iso_pu_bacteria | 2905926851 | 2905930225 | 352 |
| 158 | iso_pu_bacteria | 2946003308 | 2946004012 | 352 |
| 159 | 3300005327 | Ga0070658_10068806 | Ga0070658_100688063 | 353 |
| 160 | 3300005344 | Ga0070661_100287255 | Ga0070661_1002872551 | 353 |
| 161 | 3300005366 | Ga0070659_100040518 | Ga0070659_1000405182 | 353 |
| 162 | 3300005367 | Ga0070667_100015098 | Ga0070667_1000150988 | 353 |
| 163 | 3300005563 | Ga0068855_100072194 | Ga0068855_1000721942 | 353 |
| 164 | 3300005563 | Ga0068855_100189308 | Ga0068855_1001893082 | 353 |
| 165 | 3300005617 | Ga0068859_100021225 | Ga0068859_1000212254 | 353 |
| 166 | 3300005842 | Ga0068858_100001687 | Ga0068858_10000168719 | 353 |
| 167 | 3300006931 | Ga0097620_100021225 | Ga0097620_1000212254 | 353 |
| 168 | 3300014968 | Ga0157379_10005574 | Ga0157379_100055746 | 353 |
| 169 | 3300025909 | Ga0207705_10017697 | Ga0207705_100176974 | 353 |
| 170 | 3300025932 | Ga0207690_10011784 | Ga0207690_100117842 | 353 |
| 171 | 3300025949 | Ga0207667_10012146 | Ga0207667_100121464 | 353 |
| 172 | 3300025949 | Ga0207667_10059136 | Ga0207667_100591362 | 353 |
| 173 | 3300026023 | Ga0207677_10046299 | Ga0207677_100462994 | 353 |
| 174 | 3300026035 | Ga0207703_10000168 | Ga0207703_1000016822 | 353 |
| 175 | 3300026041 | Ga0207639_10001513 | Ga0207639_100015136 | 353 |
| 176 | 3300048922 | Ga0496119_0004529 | Ga0496119_0004529_6596_7672 | 353 |
| 177 | 3300048923 | Ga0496120_0001093 | Ga0496120_0001093_33362_34438 | 353 |
| 178 | 3300048920 | Ga0496117_0011773 | Ga0496117_0011773_1895_2977 | 354 |
| 179 | 3300048920 | Ga0496117_0062646 | Ga0496117_0062646_756_1838 | 354 |
| 180 | 3300048921 | Ga0496118_0005994 | Ga0496118_0005994_7085_8167 | 354 |
| 181 | iso_pu_bacteria | 2844841374 | 2844841843 | 354 |
| 182 | iso_pu_bacteria | 2919055335 | 2919059032 | 354 |
| 183 | iso_pu_bacteria | 2928153084 | 2928153120 | 354 |
| 184 | 3300038443 | Ga0395901_0173814 | Ga0395901_0173814_884_1999 | 355 |
| 185 | 3300044658 | Ga0466972_0028378 | Ga0466972_0028378_85_1179 | 355 |
| 186 | 3300044683 | Ga0466965_0028372 | Ga0466965_0028372_439_1509 | 355 |
| 187 | 3300053083 | Ga0495655_0011422 | Ga0495655_0011422_372_1472 | 355 |
| 188 | iso_pu_bacteria | 2537561592 | 2537898607 | 355 |
| 189 | iso_pu_bacteria | 2738541272 | 2738693484 | 355 |
| 190 | iso_pu_bacteria | 2738543027 | 2739323100 | 355 |
| 191 | iso_pu_bacteria | 2739367654 | 2739607708 | 355 |
| 192 | iso_pu_bacteria | 2758568522 | 2760304272 | 355 |
| 193 | iso_pu_bacteria | 2919523602 | 2919523891 | 355 |
| 194 | 3300005331 | Ga0070670_100153049 | Ga0070670_1001530492 | 357 |
| 195 | 3300005333 | Ga0070677_10080443 | Ga0070677_100804432 | 357 |
| 196 | 3300005367 | Ga0070667_100120518 | Ga0070667_1001205183 | 357 |
| 197 | 3300005543 | Ga0070672_100024157 | Ga0070672_1000241573 | 357 |
| 198 | 3300009177 | Ga0105248_10127188 | Ga0105248_101271883 | 357 |
| 199 | 3300020081 | Ga0206354_10019886 | Ga0206354_100198863 | 357 |
| 200 | 3300020082 | Ga0206353_11171241 | Ga0206353_111712412 | 357 |
| 201 | 3300025253 | Ga0209677_100673 | Ga0209677_10067312 | 357 |
| 202 | 3300025272 | Ga0209455_1001707 | Ga0209455_10017076 | 357 |
| 203 | 3300025909 | Ga0207705_10142306 | Ga0207705_101423062 | 357 |
| 204 | 3300025940 | Ga0207691_10004181 | Ga0207691_1000418111 | 357 |
| 205 | 3300031852 | Ga0307410_10131425 | Ga0307410_101314252 | 357 |
| 206 | 3300031995 | Ga0307409_100073915 | Ga0307409_1000739153 | 357 |
| 207 | 3300032002 | Ga0307416_100096625 | Ga0307416_1000966253 | 357 |
| 208 | 3300037312 | Ga0395899_0003594 | Ga0395899_0003594_8214_9308 | 357 |
| 209 | 3300037418 | Ga0395900_0074651 | Ga0395900_0074651_43_1137 | 357 |
| 210 | 3300046691 | Ga0495670_0005585 | Ga0495670_0005585_2873_3955 | 357 |
| 211 | 3300047315 | Ga0495581_0080244 | Ga0495581_0080244_168_1250 | 357 |
| 212 | 3300047318 | Ga0495636_0008512 | Ga0495636_0008512_427_1509 | 357 |
| 213 | 3300048904 | Ga0496101_0027393 | Ga0496101_0027393_2300_3382 | 357 |
| 214 | 3300048904 | Ga0496101_0207547 | Ga0496101_0207547_226_1308 | 357 |
| 215 | 3300048905 | Ga0496102_0088316 | Ga0496102_0088316_748_1830 | 357 |
| 216 | 3300048906 | Ga0496103_0055142 | Ga0496103_0055142_943_2025 | 357 |
| 217 | 3300048909 | Ga0496106_0197986 | Ga0496106_0197986_226_1308 | 357 |
| 218 | 3300048910 | Ga0496107_0036954 | Ga0496107_0036954_2129_3211 | 357 |
| 219 | 3300048916 | Ga0496113_0049487 | Ga0496113_0049487_291_1373 | 357 |
| 220 | 3300048917 | Ga0496114_0246052 | Ga0496114_0246052_470_1552 | 357 |
| 221 | 3300048920 | Ga0496117_0008407 | Ga0496117_0008407_2211_3302 | 357 |
| 222 | 3300048927 | Ga0496124_0123734 | Ga0496124_0123734_369_1451 | 357 |
| 223 | 3300003756 | Ga0055533_1000001 | Ga0055533_1000001181 | 358 |
| 224 | 3300003759 | Ga0055525_1000231 | Ga0055525_100023120 | 358 |
| 225 | 3300003841 | Ga0055541_1001020 | Ga0055541_10010204 | 358 |
| 226 | 3300025225 | Ga0209566_100055 | Ga0209566_10005538 | 358 |
| 227 | 3300025226 | Ga0209674_100001 | Ga0209674_100001182 | 358 |
| 228 | 3300025230 | Ga0209563_100001 | Ga0209563_100001182 | 358 |
| 229 | 3300025253 | Ga0209677_100001 | Ga0209677_100001182 | 358 |
| 230 | 3300030733 | Ga0314311_1070805 | Ga0314311_10708052 | 358 |
| 231 | 3300044658 | Ga0466972_0030524 | Ga0466972_0030524_278_1384 | 358 |
| 232 | 3300044658 | Ga0466972_0078352 | Ga0466972_0078352_237_1346 | 358 |
| 233 | 3300044684 | Ga0466966_0090180 | Ga0466966_0090180_640_1746 | 358 |
| 234 | 3300044765 | Ga0466970_0019712 | Ga0466970_0019712_664_1773 | 358 |
| 235 | 3300044842 | Ga0466957_0044197 | Ga0466957_0044197_1269_2378 | 358 |
| 236 | 3300045049 | Ga0466959_0023078 | Ga0466959_0023078_1811_2920 | 358 |
| 237 | 3300046663 | Ga0495635_0040692 | Ga0495635_0040692_196_1335 | 358 |
| 238 | iso_pu_bacteria | 2758568621 | 2760621776 | 358 |
| 239 | iso_pu_bacteria | 2919051321 | 2919053234 | 358 |
| 240 | 3300031548 | Ga0307408_100053580 | Ga0307408_1000535802 | 359 |
| 241 | 3300031903 | Ga0307407_10050675 | Ga0307407_100506752 | 359 |
| 242 | 3300032126 | Ga0307415_100059996 | Ga0307415_1000599963 | 359 |
| 243 | iso_pu_bacteria | 2920879853 | 2920880642 | 359 |
| 244 | 3300027907 | Ga0207428_10002426 | Ga0207428_1000242610 | 361 |
| 245 | 3300037471 | Ga0395905_0178567 | Ga0395905_0178567_539_1633 | 361 |
| 246 | 3300037418 | Ga0395900_0096752 | Ga0395900_0096752_298_1401 | 362 |
| 247 | 3300037466 | Ga0395898_0103680 | Ga0395898_0103680_17_1120 | 362 |
| 248 | 3300046459 | Ga0495629_0074668 | Ga0495629_0074668_582_1682 | 362 |
| 249 | 3300046463 | Ga0495653_0004126 | Ga0495653_0004126_2526_3626 | 362 |
| 250 | 3300046477 | Ga0495664_0030122 | Ga0495664_0030122_156_1256 | 362 |
| 251 | 3300046499 | Ga0495594_0012865 | Ga0495594_0012865_2208_3308 | 362 |
| 252 | 3300046517 | Ga0495630_0064153 | Ga0495630_0064153_457_1557 | 362 |
| 253 | 3300046531 | Ga0495665_0009676 | Ga0495665_0009676_2231_3331 | 362 |
| 254 | 3300046536 | Ga0495587_0006004 | Ga0495587_0006004_3845_4945 | 362 |
| 255 | 3300046543 | Ga0495645_0020246 | Ga0495645_0020246_3299_4399 | 362 |
| 256 | 3300046675 | Ga0495657_0015836 | Ga0495657_0015836_2464_3564 | 362 |
| 257 | 3300046679 | Ga0495623_0011111 | Ga0495623_0011111_3745_4845 | 362 |
| 258 | 3300046809 | Ga0495600_0000445 | Ga0495600_0000445_4344_5444 | 362 |
| 259 | 3300047315 | Ga0495581_0003897 | Ga0495581_0003897_2062_3162 | 362 |
| 260 | 3300047317 | Ga0495604_0095551 | Ga0495604_0095551_839_1939 | 362 |
| 261 | 3300047322 | Ga0495680_0013588 | Ga0495680_0013588_3679_4779 | 362 |
| 262 | 3300047444 | Ga0495675_0009083 | Ga0495675_0009083_993_2093 | 362 |
| 263 | 3300047471 | Ga0495684_0040162 | Ga0495684_0040162_1867_2967 | 362 |
| 264 | 3300006058 | Ga0075432_10009526 | Ga0075432_100095263 | 363 |
| 265 | 3300031548 | Ga0307408_100162964 | Ga0307408_1001629643 | 363 |
| 266 | 3300031731 | Ga0307405_10066356 | Ga0307405_100663562 | 363 |
| 267 | 3300031852 | Ga0307410_10014668 | Ga0307410_100146685 | 363 |
| 268 | 3300032126 | Ga0307415_100046996 | Ga0307415_1000469961 | 363 |
| 269 | 3300037418 | Ga0395900_0030021 | Ga0395900_0030021_2138_3238 | 363 |
| 270 | 3300037466 | Ga0395898_0052083 | Ga0395898_0052083_581_1681 | 363 |
| 271 | 3300031548 | Ga0307408_100112188 | Ga0307408_1001121883 | 366 |
| 272 | 3300041404 | Ga0439436_0017751 | Ga0439436_0017751_1007_2116 | 366 |
| 273 | 3300041404 | Ga0439436_0029426 | Ga0439436_0029426_441_1550 | 366 |
| 274 | 3300048915 | Ga0496112_0020858 | Ga0496112_0020858_1046_2155 | 366 |
| 275 | 3300049573 | Ga0501037_0023258 | Ga0501037_0023258_2112_3236 | 366 |
| 276 | 3300049823 | Ga0501044_0288377 | Ga0501044_0288377_321_1445 | 366 |
| 277 | iso_pu_bacteria | 2808606370 | 2808894948 | 366 |
| 278 | iso_pu_bacteria | 2945920336 | 2945924467 | 366 |
| 279 | iso_pu_bacteria | 2946037020 | 2946039765 | 366 |
| 280 | iso_pu_bacteria | 2953998280 | 2954000990 | 366 |
| 281 | 3300032002 | Ga0307416_100049591 | Ga0307416_1000495913 | 367 |
| 282 | 3300046528 | Ga0495642_0004830 | Ga0495642_0004830_2872_3987 | 367 |
| 283 | 3300046615 | Ga0495656_0022608 | Ga0495656_0022608_111_1226 | 367 |
| 284 | 3300047318 | Ga0495636_0097197 | Ga0495636_0097197_99_1214 | 367 |
| 285 | iso_pu_bacteria | 2920879853 | 2920879974 | 367 |
| 286 | iso_pu_bacteria | 2920879853 | 2920883217 | 367 |
| 287 | 3300042002 | Ga0439442_001525 | Ga0439442_001525_3050_4168 | 368 |
| 288 | iso_pu_bacteria | 2808606357 | 2808830694 | 368 |
| 289 | iso_pu_bacteria | 2808606371 | 2808895901 | 368 |
| 290 | iso_pu_bacteria | 2939598168 | 2939600006 | 368 |
| 291 | iso_pu_bacteria | 2945916053 | 2945919622 | 368 |
| 292 | iso_pu_bacteria | 2946059875 | 2946063347 | 368 |
| 293 | iso_pu_bacteria | 2974302888 | 2974303269 | 368 |
| 294 | 3300009148 | Ga0105243_10046385 | Ga0105243_100463852 | 369 |
| 295 | 3300013308 | Ga0157375_10270237 | Ga0157375_102702372 | 369 |
| 296 | 3300048913 | Ga0496110_0023136 | Ga0496110_0023136_495_1616 | 369 |
| 297 | 3300048914 | Ga0496111_0052728 | Ga0496111_0052728_514_1635 | 369 |
| 298 | 3300048914 | Ga0496111_0172812 | Ga0496111_0172812_38_1159 | 369 |
| 299 | iso_pu_bacteria | 2939647034 | 2939647933 | 369 |
| 300 | 3300031548 | Ga0307408_100364081 | Ga0307408_1003640811 | 370 |
| 301 | 3300031824 | Ga0307413_10059384 | Ga0307413_100593843 | 370 |
| 302 | 3300031852 | Ga0307410_10062105 | Ga0307410_100621053 | 370 |
| 303 | 3300031901 | Ga0307406_10098372 | Ga0307406_100983722 | 370 |
| 304 | 3300032002 | Ga0307416_100086893 | Ga0307416_1000868933 | 370 |
| 305 | 3300032126 | Ga0307415_100122705 | Ga0307415_1001227052 | 370 |
| 306 | 3300031548 | Ga0307408_100082559 | Ga0307408_1000825593 | 371 |
| 307 | 3300031911 | Ga0307412_10062391 | Ga0307412_100623913 | 371 |
| 308 | 3300032002 | Ga0307416_100370287 | Ga0307416_1003702871 | 371 |
| 309 | iso_pu_bacteria | 2857740372 | 2857743738 | 371 |
| 310 | iso_pu_bacteria | 2904497146 | 2904499640 | 371 |
| 311 | iso_pu_bacteria | 2904776348 | 2904780296 | 371 |
| 312 | iso_pu_bacteria | 2910809715 | 2910811689 | 371 |
| 313 | iso_pu_bacteria | 2919034639 | 2919036090 | 371 |
| 314 | iso_pu_bacteria | 2932426870 | 2932431038 | 371 |
| 315 | iso_pu_bacteria | 2933418574 | 2933419120 | 371 |
| 316 | iso_pu_bacteria | 2939674588 | 2939678484 | 371 |
| 317 | 3300005288 | Ga0065714_10094882 | Ga0065714_100948821 | 372 |
| 318 | 3300031731 | Ga0307405_10086332 | Ga0307405_100863322 | 372 |
| 319 | 3300031731 | Ga0307405_10160480 | Ga0307405_101604802 | 372 |
| 320 | 3300031852 | Ga0307410_10330937 | Ga0307410_103309371 | 372 |
| 321 | 3300032002 | Ga0307416_100269492 | Ga0307416_1002694921 | 372 |
| 322 | 3300041999 | Ga0439433_0006072 | Ga0439433_0006072_230_1357 | 372 |
| 323 | 3300031731 | Ga0307405_10031033 | Ga0307405_100310334 | 373 |
| 324 | 3300031911 | Ga0307412_10020370 | Ga0307412_100203702 | 373 |
| 325 | 3300032002 | Ga0307416_100007848 | Ga0307416_1000078483 | 373 |
| 326 | 3300032004 | Ga0307414_10045184 | Ga0307414_100451842 | 373 |
| 327 | 3300032126 | Ga0307415_100006900 | Ga0307415_1000069003 | 373 |
| 328 | 3300041405 | Ga0439438_030070 | Ga0439438_030070_197_1390 | 374 |
| 329 | 3300041411 | Ga0439466_0010672 | Ga0439466_0010672_1685_2878 | 374 |
| 330 | 3300042007 | Ga0439449_0003162 | Ga0439449_0003162_3951_5144 | 374 |
| 331 | 3300059424 | Ga0590075_008500 | Ga0590075_008500_828_2030 | 374 |
| 332 | 3300005548 | Ga0070665_100334579 | Ga0070665_1003345791 | 375 |
| 333 | 3300025258 | Ga0209129_1000079 | Ga0209129_100007973 | 375 |
| 334 | 3300025728 | Ga0207655_1034329 | Ga0207655_10343294 | 375 |
| 335 | 3300025735 | Ga0207713_1052097 | Ga0207713_10520971 | 375 |
| 336 | 3300025907 | Ga0207645_10012935 | Ga0207645_100129351 | 375 |
| 337 | 3300025923 | Ga0207681_10040590 | Ga0207681_100405903 | 375 |
| 338 | 3300025926 | Ga0207659_10345546 | Ga0207659_103455461 | 375 |
| 339 | 3300025931 | Ga0207644_10082726 | Ga0207644_100827264 | 375 |
| 340 | 3300025960 | Ga0207651_10064828 | Ga0207651_100648284 | 375 |
| 341 | 3300031852 | Ga0307410_10103937 | Ga0307410_101039373 | 375 |
| 342 | 3300031995 | Ga0307409_100062998 | Ga0307409_1000629983 | 375 |
| 343 | 3300042002 | Ga0439442_023504 | Ga0439442_023504_124_1251 | 375 |
| 344 | 3300049569 | Ga0501032_0000360 | Ga0501032_0000360_17627_18754 | 375 |
| 345 | 3300049571 | Ga0501034_0000015 | Ga0501034_0000015_66165_67292 | 375 |
| 346 | 3300049579 | Ga0501043_0002592 | Ga0501043_0002592_6893_8020 | 375 |
| 347 | 3300031548 | Ga0307408_100265768 | Ga0307408_1002657682 | 380 |
| 348 | 3300003187 | JGI25151J46595_10023795 | JGI25151J46595_100237952 | 381 |
| 349 | 3300025245 | Ga0207425_1003276 | Ga0207425_10032764 | 381 |
| 350 | 3300025294 | Ga0209025_1000458 | Ga0209025_100045841 | 381 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.9017 | 33 | 351 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.9017 | 33 | 351 |
| 2fb2-assembly1.cif.gz_B | structure of the moaa arg17/266/268/ala triple mutant | 0.8433 | 33 | 351 |
| 1tv8-assembly1.cif.gz_A | structure of moaa in complex with s-adenosylmethionine | 0.8408 | 33 | 351 |
| 5v1t-assembly1.cif.gz_A | crystal structure of streptococcus suis suib bound to precursor peptide suia | 0.8217 | 37 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJS1_27_360_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9421 | 30 | 381 | 3.20.20.70 |
| af_P9WJS1_27_360_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9394 | 30 | 381 | 3.20.20.70 |
| af_I1KTQ5_72_400_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9174 | 33 | 381 | 3.20.20.70 |
| af_I1KTQ5_72_400_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.904 | 33 | 381 | 3.20.20.70 |
| 1tv8A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9017 | 33 | 351 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2P7P2C6-F1-model_v4 | deleted | 0.9908 | 96 | 184 |
|
| AF-A0A3D5GIT7-F1-model_v4 | GTP 3',8-cyclase MoaA | 0.9761 | 33 | 225 |
GO:0006777
GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-A0A4R8H3R1-F1-model_v4 | deleted | 0.9729 | 33 | 205 |
|
| AF-A0A3D5GIT7-F1-model_v4 | GTP 3',8-cyclase MoaA | 0.9711 | 33 | 225 |
GO:0006777
GO:0046872 GO:0051539 GO:0061798 GO:0061799 |
| AF-A0A2P7P2C6-F1-model_v4 | deleted | 0.9692 | 96 | 184 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar