F418168

General Info

Members Datasets Scaffolds Average Seq Length
350 179 696 215

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10073902|Ga0070681_100739022
Length 246
Sequence MIRVAFRQGLRHKGEIVATRKHPLASPRGSREEMSKKNNTLGSLIRGLRRQKSWTLRQMSDKVGIPLSTLAKVEQDKLSLTYDKLQQFTSRLGLTMTEFLAHAEAPSSDPPKVVTARRSLTRDGNSIQVSTPNYDYEYLCADLREKRMVPILTRIRAHDIAEFGEPVRHQGEEFVFVLEGTVEVHLQFYTSVVLQAGQGIYLDSTMGHAYVAKDCDSALVLGICSSEDPNLAGELITLAGKAEKVA

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
166 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
167 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
168 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
173 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
174 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
175 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
176 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
177 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
178 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
179 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0.86
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.14
Nodule 0
Rhizoplane 3.71
Rhizosphere 77.43
Stem 0
Stem Tuber 0
Unclassified 17.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10073902 3300005458 Bacteria 3371
2 rootH2_10153096 3300003320 Bacteria 1177
3 rootL2_10077857 3300003322 Unclassified 2977
4 rootL2_10277747 3300003322 Bacteria 1112
5 rootH1_10386929 3300003323 Bacteria 2143
6 Ga0065712_10095868 3300005290 Unclassified 2204
7 Ga0065712_10390553 3300005290 Unclassified 742
8 Ga0065715_10160543 3300005293 Unclassified 1634
9 Ga0070658_10401067 3300005327 Bacteria 1178
10 Ga0070690_100136347 3300005330 Bacteria 1662
11 Ga0070670_100096007 3300005331 Bacteria 2550
12 Ga0070670_100131221 3300005331 Unclassified 2163
13 Ga0070670_100303556 3300005331 Bacteria 1397
14 Ga0070666_10008191 3300005335 Bacteria 6477
15 Ga0070666_10022492 3300005335 Bacteria 4093
16 Ga0070682_100236039 3300005337 Bacteria 1310
17 Ga0068868_100046538 3300005338 Bacteria 3396
18 Ga0068868_100415501 3300005338 Bacteria 1164
19 Ga0070661_100286559 3300005344 Bacteria 1279
20 Ga0070675_100042061 3300005354 Bacteria 3733
21 Ga0070671_100035563 3300005355 Bacteria 4126
22 Ga0070671_100081015 3300005355 Bacteria 2714
23 Ga0070673_100549131 3300005364 Bacteria 1049
24 Ga0070673_100783448 3300005364 Bacteria 879
25 Ga0070667_100030513 3300005367 Bacteria 4496
26 Ga0070667_100043382 3300005367 Plasmid 3774
27 Ga0070667_100186096 3300005367 Bacteria 1838
28 Ga0070667_100411014 3300005367 Bacteria 1233
29 Ga0070709_10128057 3300005434 Bacteria 1730
30 Ga0070714_100152018 3300005435 Bacteria 2087
31 Ga0070713_100133643 3300005436 Bacteria 2190
32 Ga0070713_100694468 3300005436 Unclassified 971
33 Ga0070710_10108263 3300005437 Bacteria 1666
34 Ga0070711_100003598 3300005439 Bacteria 9041
35 Ga0070705_100061913 3300005440 Bacteria 2226
36 Ga0070663_100200141 3300005455 Bacteria 1558
37 Ga0070663_100307207 3300005455 Unclassified 1271
38 Ga0070663_100905851 3300005455 Bacteria 762
39 Ga0070662_100225199 3300005457 Unclassified 1498
40 Ga0068853_100042349 3300005539 Unclassified 3893
41 Ga0068853_100050495 3300005539 Bacteria 3578
42 Ga0070672_100297746 3300005543 Unclassified 1367
43 Ga0070672_100570561 3300005543 Bacteria 984
44 Ga0070693_100040244 3300005547 Bacteria 2623
45 Ga0070665_100010244 3300005548 Bacteria 9486
46 Ga0070665_100037462 3300005548 Bacteria 4877
47 Ga0070665_100060446 3300005548 Bacteria 3798
48 Ga0070665_100103540 3300005548 Bacteria 2849
49 Ga0068855_100519754 3300005563 Unclassified 1291
50 Ga0068855_100624792 3300005563 Bacteria 1159
51 Ga0070664_100630126 3300005564 Unclassified 996
52 Ga0068854_100180068 3300005578 Bacteria 1650
53 Ga0068854_100288728 3300005578 Unclassified 1323
54 Ga0068856_100067340 3300005614 Plasmid 3538
55 Ga0068856_100115190 3300005614 Bacteria 2687
56 Ga0068856_100448700 3300005614 Bacteria 1310
57 Ga0070702_100078528 3300005615 Unclassified 1970
58 Ga0068852_100817236 3300005616 Unclassified 947
59 Ga0068859_100058967 3300005617 Bacteria 3867
60 Ga0068859_100564823 3300005617 Bacteria 1232
61 Ga0068861_100019213 3300005719 Bacteria 4882
62 Ga0068851_10157986 3300005834 Bacteria 1243
63 Ga0068863_100008471 3300005841 Bacteria 10043
64 Ga0068863_100047609 3300005841 Bacteria 4067
65 Ga0068863_100206959 3300005841 Bacteria 1888
66 Ga0068858_100003274 3300005842 Bacteria 16136
67 Ga0068858_100009797 3300005842 Bacteria 9120
68 Ga0068858_100029839 3300005842 Bacteria 5066
69 Ga0068858_100179568 3300005842 Bacteria 1998
70 Ga0068858_100333844 3300005842 Unclassified 1450
71 Ga0068860_100000371 3300005843 Bacteria 59118
72 Ga0068860_100004395 3300005843 Bacteria 14397
73 Ga0068860_100008888 3300005843 Bacteria 10008
74 Ga0068860_100047589 3300005843 Bacteria 4087
75 Ga0068862_100008583 3300005844 Bacteria 8455
76 Ga0068862_100086803 3300005844 Bacteria 2721
77 Ga0068862_100206020 3300005844 Bacteria 1775
78 Ga0068862_100375243 3300005844 Unclassified 1325
79 Ga0070715_10002148 3300006163 Bacteria 5974
80 Ga0070712_100892315 3300006175 Unclassified 766
81 Ga0097621_100026619 3300006237 Bacteria 4539
82 Ga0097621_100235689 3300006237 Bacteria 1598
83 Ga0068871_100033392 3300006358 Bacteria 4074
84 Ga0068871_100330826 3300006358 Bacteria 1344
85 Ga0068871_100460968 3300006358 Unclassified 1141
86 Ga0068871_100800216 3300006358 Unclassified 869
87 Ga0068865_100012227 3300006881 Bacteria 5398
88 Ga0097620_100058966 3300006931 Bacteria 3867
89 Ga0097620_100564807 3300006931 Bacteria 1232
90 Ga0105240_10009834 3300009093 Bacteria 13500
91 Ga0105240_10011492 3300009093 Bacteria 12328
92 Ga0105240_10017129 3300009093 Bacteria 9780
93 Ga0105240_10036471 3300009093 Bacteria 6324
94 Ga0105240_10042367 3300009093 Bacteria 5802
95 Ga0105240_10076634 3300009093 Bacteria 4122
96 Ga0105240_10123362 3300009093 Bacteria 3117
97 Ga0105240_10152837 3300009093 Bacteria 2747
98 Ga0105240_10279128 3300009093 Unclassified 1920
99 Ga0105240_10283878 3300009093 Bacteria 1901
100 Ga0105240_10394456 3300009093 Bacteria 1560
101 Ga0105240_10397792 3300009093 Bacteria 1552
102 Ga0105240_10640470 3300009093 Bacteria 1166
103 Ga0105245_10077222 3300009098 Bacteria 3036
104 Ga0105247_10014012 3300009101 Bacteria 4808
105 Ga0105247_10082303 3300009101 Bacteria 2031
106 Ga0105247_10096742 3300009101 Unclassified 1882
107 Ga0105241_10015842 3300009174 Bacteria 5522
108 Ga0105241_10135503 3300009174 Bacteria 1999
109 Ga0105241_10191316 3300009174 Bacteria 1704
110 Ga0105242_10059233 3300009176 Bacteria 3141
111 Ga0105248_10090674 3300009177 Bacteria 3442
112 Ga0105248_10138030 3300009177 Bacteria 2751
113 Ga0105248_10149575 3300009177 Bacteria 2634
114 Ga0105237_10042247 3300009545 Bacteria 4598
115 Ga0105237_10044319 3300009545 Bacteria 4479
116 Ga0105237_10056865 3300009545 Bacteria 3915
117 Ga0105237_10087823 3300009545 Bacteria 3099
118 Ga0105237_10196637 3300009545 Bacteria 2016
119 Ga0105238_10056305 3300009551 Bacteria 3945
120 Ga0105238_10062920 3300009551 Bacteria 3711
121 Ga0105238_10404689 3300009551 Bacteria 1358
122 Ga0105238_10603331 3300009551 Bacteria 1106
123 Ga0105249_10011853 3300009553 Bacteria 7664
124 Ga0105249_10376359 3300009553 Bacteria 1445
125 Ga0105249_10674501 3300009553 Bacteria 1092
126 Ga0105249_10888823 3300009553 Bacteria 957
127 Ga0105239_10052364 3300010375 Bacteria 4477
128 Ga0105239_10076536 3300010375 Bacteria 3680
129 Ga0105239_10271907 3300010375 Unclassified 1906
130 Ga0157374_10013276 3300013296 Bacteria 7186
131 Ga0157374_10260095 3300013296 Bacteria 1709
132 Ga0163162_10032179 3300013306 Bacteria 5207
133 Ga0163162_10038576 3300013306 Bacteria 4767
134 Ga0157372_10781387 3300013307 Bacteria 1110
135 Ga0157372_10867198 3300013307 Bacteria 1048
136 Ga0157375_11484671 3300013308 Bacteria 800
137 Ga0163163_10099043 3300014325 Bacteria 2937
138 Ga0163163_10411991 3300014325 Bacteria 1410
139 Ga0163163_10424800 3300014325 Bacteria 1388
140 Ga0157379_10043469 3300014968 Bacteria 4011
141 Ga0157379_10100187 3300014968 Bacteria 2601
142 Ga0157379_10185291 3300014968 Bacteria 1881
143 Ga0157379_10678038 3300014968 Bacteria 966
144 Ga0157376_10191245 3300014969 Bacteria 1877
145 Ga0157376_10263078 3300014969 Bacteria 1617
146 Ga0207656_10051197 3300025321 Bacteria 1785
147 Ga0207680_10070826 3300025903 Bacteria 2159
148 Ga0207680_10080145 3300025903 Bacteria 2050
149 Ga0207680_10392089 3300025903 Bacteria 980
150 Ga0207699_10079771 3300025906 Bacteria 2026
151 Ga0207707_10026084 3300025912 Bacteria 5110
152 Ga0207695_10051873 3300025913 Bacteria 4303
153 Ga0207695_10056064 3300025913 Bacteria 4103
154 Ga0207695_10098681 3300025913 Bacteria 2920
155 Ga0207695_10103075 3300025913 Unclassified 2845
156 Ga0207695_10169450 3300025913 Bacteria 2110
157 Ga0207695_10200488 3300025913 Bacteria 1910
158 Ga0207695_10247635 3300025913 Bacteria 1682
159 Ga0207695_10510737 3300025913 Bacteria 1084
160 Ga0207671_10063001 3300025914 Bacteria 2755
161 Ga0207671_10245800 3300025914 Bacteria 1406
162 Ga0207671_10256309 3300025914 Bacteria 1376
163 Ga0207693_10001796 3300025915 Bacteria 18812
164 Ga0207681_10282567 3300025923 Bacteria 1307
165 Ga0207694_10044207 3300025924 Bacteria 3440
166 Ga0207694_10331311 3300025924 Bacteria 1258
167 Ga0207694_10427397 3300025924 Bacteria 1104
168 Ga0207687_10133951 3300025927 Bacteria 1872
169 Ga0207644_10054179 3300025931 Bacteria 2888
170 Ga0207644_10089468 3300025931 Bacteria 2291
171 Ga0207644_10136947 3300025931 Bacteria 1881
172 Ga0207706_10434692 3300025933 Bacteria 1136
173 Ga0207706_10514537 3300025933 Unclassified 1032
174 Ga0207686_10032053 3300025934 Bacteria 3125
175 Ga0207665_10016735 3300025939 Bacteria 4816
176 Ga0207691_10098831 3300025940 Bacteria 2606
177 Ga0207711_10112842 3300025941 Bacteria 2419
178 Ga0207711_10164286 3300025941 Bacteria 2011
179 Ga0207689_10522142 3300025942 Unclassified 996
180 Ga0207679_10392802 3300025945 Bacteria 1219
181 Ga0207679_10562307 3300025945 Unclassified 1024
182 Ga0207667_10060979 3300025949 Bacteria 3948
183 Ga0207667_10093487 3300025949 Bacteria 3105
184 Ga0207651_10463711 3300025960 Bacteria 1089
185 Ga0207651_10774499 3300025960 Bacteria 849
186 Ga0207712_10082220 3300025961 Bacteria 2347
187 Ga0207712_10717970 3300025961 Bacteria 873
188 Ga0207712_10755979 3300025961 Unclassified 852
189 Ga0207640_10033128 3300025981 Bacteria 3211
190 Ga0207658_10040062 3300025986 Unclassified 3384
191 Ga0207658_10095994 3300025986 Bacteria 2311
192 Ga0207658_10201878 3300025986 Bacteria 1660
193 Ga0207703_10001680 3300026035 Bacteria 19905
194 Ga0207703_10002243 3300026035 Bacteria 16902
195 Ga0207703_10098601 3300026035 Bacteria 2471
196 Ga0207639_10264823 3300026041 Bacteria 1505
197 Ga0207639_11059020 3300026041 Unclassified 760
198 Ga0207678_10095430 3300026067 Bacteria 2542
199 Ga0207678_10231009 3300026067 Unclassified 1584
200 Ga0207702_10061398 3300026078 Bacteria 3206
201 Ga0207702_10102552 3300026078 Bacteria 2529
202 Ga0207702_11038494 3300026078 Unclassified 813
203 Ga0207641_10000273 3300026088 Bacteria 65757
204 Ga0207641_10000289 3300026088 Bacteria 62844
205 Ga0207641_10186500 3300026088 Bacteria 1903
206 Ga0207676_10389051 3300026095 Bacteria 1300
207 Ga0207675_100045070 3300026118 Bacteria 4120
208 Ga0207683_10035582 3300026121 Bacteria 4332
209 Ga0207698_10504602 3300026142 Bacteria 1178
210 Ga0207698_10655021 3300026142 Bacteria 1041
211 Ga0265356_1001441 3300028017 Unclassified 3531
212 Ga0268266_10001894 3300028379 Bacteria 23577
213 Ga0268266_10004135 3300028379 Bacteria 14017
214 Ga0268266_10010095 3300028379 Bacteria 8280
215 Ga0268266_10021295 3300028379 Bacteria 5524
216 Ga0268266_10050611 3300028379 Bacteria 3565
217 Ga0268266_10123684 3300028379 Bacteria 2305
218 Ga0268265_10010614 3300028380 Bacteria 6221
219 Ga0268265_10039699 3300028380 Bacteria 3471
220 Ga0268265_10671886 3300028380 Unclassified 998
221 Ga0268264_10000151 3300028381 Bacteria 158241
222 Ga0268264_10000499 3300028381 Bacteria 51388
223 Ga0268264_10035296 3300028381 Bacteria 4116
224 Ga0268264_10068291 3300028381 Bacteria 3003
225 Ga0265770_1002469 3300030878 Bacteria 2512
226 Ga0265765_1008426 3300030879 Bacteria 1124
227 Ga0265760_10000245 3300031090 Bacteria 14861
228 Ga0265320_10050231 3300031240 Bacteria 2028
229 Ga0265340_10181669 3300031247 Bacteria 951
230 Ga0307509_10000028 3300031507 Bacteria 223572
231 Ga0307414_10206030 3300032004 Unclassified 1604
232 Ga0307510_10000003 3300033180 Bacteria 756654
233 Ga0307510_10000010 3300033180 Bacteria 377457
234 Ga0307510_10003055 3300033180 Bacteria 19328
235 Ga0307510_10015386 3300033180 Bacteria 9045
236 Ga0373934_0098785 3300035086 Unclassified 1180
237 Ga0373936_0006460 3300035113 Bacteria 4423
238 Ga0373936_0011512 3300035113 Unclassified 3350
239 Ga0373953_0183041 3300035117 Unclassified 904
240 Ga0373954_0012182 3300035118 Bacteria 3824
241 Ga0373943_0161621 3300035170 Unclassified 1220
242 Ga0373946_0145391 3300035171 Unclassified 1102
243 Ga0373955_0043713 3300035172 Bacteria 2411
244 Ga0373931_0454228 3300035691 Unclassified 820
245 Ga0373927_0085053 3300035695 Bacteria 2052
246 Ga0373933_0117426 3300035724 Bacteria 1664
247 Ga0373933_0269194 3300035724 Unclassified 1099
248 Ga0373947_0028383 3300035725 Bacteria 3281
249 Ga0373937_0314558 3300036401 Bacteria 1481
250 Ga0373937_0437145 3300036401 Unclassified 1242
251 Ga0373925_0074628 3300037068 Bacteria 2569
252 Ga0436364_0509912 3300037853 Bacteria 3628
253 Ga0436365_0612073 3300039437 Unclassified 1254
254 Ga0451577_0009257 3300042876 Bacteria 9492
255 Ga0453683_0009059 3300044673 Bacteria 6647
256 Ga0453684_0991739 3300044712 Unclassified 894
257 Ga0466959_0001312 3300045049 Bacteria 15090
258 Ga0466959_0036663 3300045049 Bacteria 3623
259 Ga0495629_0081101 3300046459 Bacteria 2265
260 Ga0495651_0201170 3300046462 Bacteria 1394
261 Ga0495580_0001376 3300046472 Bacteria 21326
262 Ga0495580_0060431 3300046472 Bacteria 2662
263 Ga0495580_0064900 3300046472 Unclassified 2558
264 Ga0495606_0105459 3300046507 Unclassified 1708
265 Ga0495606_0112254 3300046507 Bacteria 1643
266 Ga0495606_0152307 3300046507 Unclassified 1356
267 Ga0495628_0130106 3300046516 Bacteria 1926
268 Ga0495643_0081692 3300046522 Unclassified 1680
269 Ga0495648_0185651 3300046524 Bacteria 1053
270 Ga0495586_0147915 3300046535 Bacteria 1321
271 Ga0495587_0067540 3300046536 Bacteria 2084
272 Ga0495645_0231493 3300046543 Unclassified 1238
273 Ga0495668_0226449 3300046616 Unclassified 1024
274 Ga0495668_0507743 3300046616 Bacteria 665
275 Ga0495625_0161178 3300046660 Unclassified 1502
276 Ga0495623_0095545 3300046679 Bacteria 1817
277 Ga0495613_0343293 3300046689 Bacteria 1027
278 Ga0495624_0157530 3300046690 Bacteria 1388
279 Ga0495687_029098 3300047443 Bacteria 2562
280 Ga0495687_135326 3300047443 Unclassified 866
281 Ga0495593_0164526 3300047673 Bacteria 1119
282 Ga0495602_0038884 3300048088 Bacteria 4390
283 Ga0496101_0042968 3300048904 Bacteria 3228
284 Ga0496102_0009669 3300048905 Bacteria 8293
285 Ga0496102_0023699 3300048905 Bacteria 5454
286 Ga0496102_0073373 3300048905 Bacteria 3145
287 Ga0496102_0080852 3300048905 Bacteria 2995
288 Ga0496103_0066476 3300048906 Bacteria 2250
289 Ga0496106_0011603 3300048909 Bacteria 6512
290 Ga0496106_0062660 3300048909 Bacteria 2824
291 Ga0496107_0000149 3300048910 Bacteria 35123
292 Ga0496109_0129176 3300048912 Bacteria 2358
293 Ga0496115_0011159 3300048918 Bacteria 6731
294 Ga0496115_0279876 3300048918 Bacteria 1370
295 Ga0496116_0008010 3300048919 Bacteria 9249
296 Ga0496116_0015218 3300048919 Bacteria 6093
297 Ga0496117_0000152 3300048920 Bacteria 147897
298 Ga0496117_0000186 3300048920 Bacteria 127231
299 Ga0496118_0000003 3300048921 Bacteria 773148
300 Ga0496118_0000052 3300048921 Bacteria 237465
301 Ga0496119_0000151 3300048922 Bacteria 96860
302 Ga0496119_0001275 3300048922 Bacteria 31240
303 Ga0496119_0005689 3300048922 Bacteria 11822
304 Ga0496119_0107431 3300048922 Bacteria 1556
305 Ga0496119_0130447 3300048922 Bacteria 1370
306 Ga0496120_0000286 3300048923 Bacteria 84869
307 Ga0496120_0132063 3300048923 Unclassified 1277
308 Ga0496121_0000653 3300048924 Bacteria 64947
309 Ga0496121_0001775 3300048924 Bacteria 35033
310 Ga0496121_0015797 3300048924 Bacteria 7861
311 Ga0496121_0057153 3300048924 Unclassified 3235
312 Ga0496121_0103137 3300048924 Bacteria 2195
313 Ga0496121_0202147 3300048924 Unclassified 1415
314 Ga0496121_0255715 3300048924 Unclassified 1212
315 Ga0496124_0010417 3300048927 Bacteria 9411
316 Ga0496125_0001409 3300048928 Bacteria 35088
317 Ga0496125_0001701 3300048928 Bacteria 30700
318 Ga0496125_0036056 3300048928 Bacteria 4326
319 Ga0496125_0051555 3300048928 Unclassified 3392
320 Ga0496125_0134703 3300048928 Bacteria 1730
321 Ga0496126_0035136 3300048929 Unclassified 4700
322 Ga0496126_0078186 3300048929 Bacteria 2932
323 Ga0496126_0168555 3300048929 Bacteria 1867
324 Ga0496126_0195501 3300048929 Bacteria 1711
325 Ga0500583_0010235 3300053092 Bacteria 3471
326 Ga0500583_0067540 3300053092 Bacteria 1704
327 Ga0500566_0209693 3300053094 Bacteria 977
328 Ga0500648_201108 3300053097 Bacteria 1001
329 Ga0500569_007134 3300053109 Unclassified 2494
330 Ga0500608_000719 3300053122 Bacteria 12153
331 Ga0500614_005901 3300053123 Bacteria 2572
332 Ga0500559_0138083 3300053136 Bacteria 1141
333 Ga0500559_0151813 3300053136 Bacteria 1087
334 Ga0500590_036562 3300053148 Bacteria 2539
335 Ga0500590_167192 3300053148 Bacteria 972
336 Ga0500616_0000053 3300053153 Bacteria 291841
337 Ga0500639_154899 3300053163 Bacteria 1051
338 Ga0500637_0223793 3300053178 Bacteria 1062
339 Ga0500576_124082 3300053725 Unclassified 1012
340 Ga0500625_080456 3300053729 Bacteria 1424
341 Ga0500596_001815 3300053735 Bacteria 4292
342 Ga0500596_024755 3300053735 Bacteria 914
343 2643728809 2643221541 Bacteria 5498788
344 2643731042 2643221541 Bacteria 5498788
345 2644044306 2643221606 Bacteria 5588032
346 2644044824 2643221606 Bacteria 5588032
347 2644390997 2643221671 Bacteria 5496681
348 2644391770 2643221671 Bacteria 5496681
349 Ga0070681_10073902
350 rootH2_10153096
351 rootL2_10077857
352 rootL2_10277747
353 rootH1_10386929
354 Ga0065712_10095868
355 Ga0065712_10390553
356 Ga0065715_10160543
357 Ga0070658_10401067
358 Ga0070690_100136347
359 Ga0070670_100096007
360 Ga0070670_100131221
361 Ga0070670_100303556
362 Ga0070666_10008191
363 Ga0070666_10022492
364 Ga0070682_100236039
365 Ga0068868_100046538
366 Ga0068868_100415501
367 Ga0070661_100286559
368 Ga0070675_100042061
369 Ga0070671_100035563
370 Ga0070671_100081015
371 Ga0070673_100549131
372 Ga0070673_100783448
373 Ga0070667_100030513
374 Ga0070667_100043382
375 Ga0070667_100186096
376 Ga0070667_100411014
377 Ga0070709_10128057
378 Ga0070714_100152018
379 Ga0070713_100133643
380 Ga0070713_100694468
381 Ga0070710_10108263
382 Ga0070711_100003598
383 Ga0070705_100061913
384 Ga0070663_100200141
385 Ga0070663_100307207
386 Ga0070663_100905851
387 Ga0070662_100225199
388 Ga0068853_100042349
389 Ga0068853_100050495
390 Ga0070672_100297746
391 Ga0070672_100570561
392 Ga0070693_100040244
393 Ga0070665_100010244
394 Ga0070665_100037462
395 Ga0070665_100060446
396 Ga0070665_100103540
397 Ga0068855_100519754
398 Ga0068855_100624792
399 Ga0070664_100630126
400 Ga0068854_100180068
401 Ga0068854_100288728
402 Ga0068856_100067340
403 Ga0068856_100115190
404 Ga0068856_100448700
405 Ga0070702_100078528
406 Ga0068852_100817236
407 Ga0068859_100058967
408 Ga0068859_100564823
409 Ga0068861_100019213
410 Ga0068851_10157986
411 Ga0068863_100008471
412 Ga0068863_100047609
413 Ga0068863_100206959
414 Ga0068858_100003274
415 Ga0068858_100009797
416 Ga0068858_100029839
417 Ga0068858_100179568
418 Ga0068858_100333844
419 Ga0068860_100000371
420 Ga0068860_100004395
421 Ga0068860_100008888
422 Ga0068860_100047589
423 Ga0068862_100008583
424 Ga0068862_100086803
425 Ga0068862_100206020
426 Ga0068862_100375243
427 Ga0070715_10002148
428 Ga0070712_100892315
429 Ga0097621_100026619
430 Ga0097621_100235689
431 Ga0068871_100033392
432 Ga0068871_100330826
433 Ga0068871_100460968
434 Ga0068871_100800216
435 Ga0068865_100012227
436 Ga0097620_100058966
437 Ga0097620_100564807
438 Ga0105240_10009834
439 Ga0105240_10011492
440 Ga0105240_10017129
441 Ga0105240_10036471
442 Ga0105240_10042367
443 Ga0105240_10076634
444 Ga0105240_10123362
445 Ga0105240_10152837
446 Ga0105240_10279128
447 Ga0105240_10283878
448 Ga0105240_10394456
449 Ga0105240_10397792
450 Ga0105240_10640470
451 Ga0105245_10077222
452 Ga0105247_10014012
453 Ga0105247_10082303
454 Ga0105247_10096742
455 Ga0105241_10015842
456 Ga0105241_10135503
457 Ga0105241_10191316
458 Ga0105242_10059233
459 Ga0105248_10090674
460 Ga0105248_10138030
461 Ga0105248_10149575
462 Ga0105237_10042247
463 Ga0105237_10044319
464 Ga0105237_10056865
465 Ga0105237_10087823
466 Ga0105237_10196637
467 Ga0105238_10056305
468 Ga0105238_10062920
469 Ga0105238_10404689
470 Ga0105238_10603331
471 Ga0105249_10011853
472 Ga0105249_10376359
473 Ga0105249_10674501
474 Ga0105249_10888823
475 Ga0105239_10052364
476 Ga0105239_10076536
477 Ga0105239_10271907
478 Ga0157374_10013276
479 Ga0157374_10260095
480 Ga0163162_10032179
481 Ga0163162_10038576
482 Ga0157372_10781387
483 Ga0157372_10867198
484 Ga0157375_11484671
485 Ga0163163_10099043
486 Ga0163163_10411991
487 Ga0163163_10424800
488 Ga0157379_10043469
489 Ga0157379_10100187
490 Ga0157379_10185291
491 Ga0157379_10678038
492 Ga0157376_10191245
493 Ga0157376_10263078
494 Ga0207656_10051197
495 Ga0207680_10070826
496 Ga0207680_10080145
497 Ga0207680_10392089
498 Ga0207699_10079771
499 Ga0207707_10026084
500 Ga0207695_10051873
501 Ga0207695_10056064
502 Ga0207695_10098681
503 Ga0207695_10103075
504 Ga0207695_10169450
505 Ga0207695_10200488
506 Ga0207695_10247635
507 Ga0207695_10510737
508 Ga0207671_10063001
509 Ga0207671_10245800
510 Ga0207671_10256309
511 Ga0207693_10001796
512 Ga0207681_10282567
513 Ga0207694_10044207
514 Ga0207694_10331311
515 Ga0207694_10427397
516 Ga0207687_10133951
517 Ga0207644_10054179
518 Ga0207644_10089468
519 Ga0207644_10136947
520 Ga0207706_10434692
521 Ga0207706_10514537
522 Ga0207686_10032053
523 Ga0207665_10016735
524 Ga0207691_10098831
525 Ga0207711_10112842
526 Ga0207711_10164286
527 Ga0207689_10522142
528 Ga0207679_10392802
529 Ga0207679_10562307
530 Ga0207667_10060979
531 Ga0207667_10093487
532 Ga0207651_10463711
533 Ga0207651_10774499
534 Ga0207712_10082220
535 Ga0207712_10717970
536 Ga0207712_10755979
537 Ga0207640_10033128
538 Ga0207658_10040062
539 Ga0207658_10095994
540 Ga0207658_10201878
541 Ga0207703_10001680
542 Ga0207703_10002243
543 Ga0207703_10098601
544 Ga0207639_10264823
545 Ga0207639_11059020
546 Ga0207678_10095430
547 Ga0207678_10231009
548 Ga0207702_10061398
549 Ga0207702_10102552
550 Ga0207702_11038494
551 Ga0207641_10000273
552 Ga0207641_10000289
553 Ga0207641_10186500
554 Ga0207676_10389051
555 Ga0207675_100045070
556 Ga0207683_10035582
557 Ga0207698_10504602
558 Ga0207698_10655021
559 Ga0265356_1001441
560 Ga0268266_10001894
561 Ga0268266_10004135
562 Ga0268266_10010095
563 Ga0268266_10021295
564 Ga0268266_10050611
565 Ga0268266_10123684
566 Ga0268265_10010614
567 Ga0268265_10039699
568 Ga0268265_10671886
569 Ga0268264_10000151
570 Ga0268264_10000499
571 Ga0268264_10035296
572 Ga0268264_10068291
573 Ga0265770_1002469
574 Ga0265765_1008426
575 Ga0265760_10000245
576 Ga0265320_10050231
577 Ga0265340_10181669
578 Ga0307509_10000028
579 Ga0307414_10206030
580 Ga0307510_10000003
581 Ga0307510_10000010
582 Ga0307510_10003055
583 Ga0307510_10015386
584 Ga0373934_0098785
585 Ga0373936_0006460
586 Ga0373936_0011512
587 Ga0373953_0183041
588 Ga0373954_0012182
589 Ga0373943_0161621
590 Ga0373946_0145391
591 Ga0373955_0043713
592 Ga0373931_0454228
593 Ga0373927_0085053
594 Ga0373933_0117426
595 Ga0373933_0269194
596 Ga0373947_0028383
597 Ga0373937_0314558
598 Ga0373937_0437145
599 Ga0373925_0074628
600 Ga0436364_0509912
601 Ga0436365_0612073
602 Ga0451577_0009257
603 Ga0453683_0009059
604 Ga0453684_0991739
605 Ga0466959_0001312
606 Ga0466959_0036663
607 Ga0495629_0081101
608 Ga0495651_0201170
609 Ga0495580_0001376
610 Ga0495580_0060431
611 Ga0495580_0064900
612 Ga0495606_0105459
613 Ga0495606_0112254
614 Ga0495606_0152307
615 Ga0495628_0130106
616 Ga0495643_0081692
617 Ga0495648_0185651
618 Ga0495586_0147915
619 Ga0495587_0067540
620 Ga0495645_0231493
621 Ga0495668_0226449
622 Ga0495668_0507743
623 Ga0495625_0161178
624 Ga0495623_0095545
625 Ga0495613_0343293
626 Ga0495624_0157530
627 Ga0495687_029098
628 Ga0495687_135326
629 Ga0495593_0164526
630 Ga0495602_0038884
631 Ga0496101_0042968
632 Ga0496102_0009669
633 Ga0496102_0023699
634 Ga0496102_0073373
635 Ga0496102_0080852
636 Ga0496103_0066476
637 Ga0496106_0011603
638 Ga0496106_0062660
639 Ga0496107_0000149
640 Ga0496109_0129176
641 Ga0496115_0011159
642 Ga0496115_0279876
643 Ga0496116_0008010
644 Ga0496116_0015218
645 Ga0496117_0000152
646 Ga0496117_0000186
647 Ga0496118_0000003
648 Ga0496118_0000052
649 Ga0496119_0000151
650 Ga0496119_0001275
651 Ga0496119_0005689
652 Ga0496119_0107431
653 Ga0496119_0130447
654 Ga0496120_0000286
655 Ga0496120_0132063
656 Ga0496121_0000653
657 Ga0496121_0001775
658 Ga0496121_0015797
659 Ga0496121_0057153
660 Ga0496121_0103137
661 Ga0496121_0202147
662 Ga0496121_0255715
663 Ga0496124_0010417
664 Ga0496125_0001409
665 Ga0496125_0001701
666 Ga0496125_0036056
667 Ga0496125_0051555
668 Ga0496125_0134703
669 Ga0496126_0035136
670 Ga0496126_0078186
671 Ga0496126_0168555
672 Ga0496126_0195501
673 Ga0500583_0010235
674 Ga0500583_0067540
675 Ga0500566_0209693
676 Ga0500648_201108
677 Ga0500569_007134
678 Ga0500608_000719
679 Ga0500614_005901
680 Ga0500559_0138083
681 Ga0500559_0151813
682 Ga0500590_036562
683 Ga0500590_167192
684 Ga0500616_0000053
685 Ga0500639_154899
686 Ga0500637_0223793
687 Ga0500576_124082
688 Ga0500625_080456
689 Ga0500596_001815
690 Ga0500596_024755
691 2643728809
692 2643731042
693 2644044306
694 2644044824
695 2644390997
696 2644391770

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

45

99

0.96

PF07883

Cupin_2

Cupin domain

160

224

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xcj-assembly1.cif.gz_B crystal structure of p2 c, the immunity repressor of temperate e. coli phage p2 0.9501 5 58
6rnx-assembly1.cif.gz_A crystal structure of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.887 7 67
6rnz-assembly2.cif.gz_B crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) 0.884 7 67
1y7y-assembly1.cif.gz_B high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8732 9 66
1y7y-assembly1.cif.gz_A high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila 0.8686 9 66
ID Description Score Start End Superfamily
2xcjB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9501 5 58 1.10.260.40
2b5aC00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8744 9 71 1.10.260.40
1y7yB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8732 9 66 1.10.260.40
2b5aB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8725 9 71 1.10.260.40
2l49B01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8717 8 57 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1M7ZM53-F1-model_v4 Cupin domain-containing protein 0.975 135 210
AF-A0A656AD51-F1-model_v4 deleted 0.9397 107 194
AF-A0A1X1PND8-F1-model_v4 Cupin type-2 domain-containing protein 0.9354 118 192
AF-A0A656AD51-F1-model_v4 deleted 0.9196 107 194
AF-A0A529LE48-F1-model_v4 Cupin domain-containing protein 0.9112 102 196

Map