F418168
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 350 | 179 | 696 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10073902|Ga0070681_100739022 |
| Length | 246 |
| Sequence | MIRVAFRQGLRHKGEIVATRKHPLASPRGSREEMSKKNNTLGSLIRGLRRQKSWTLRQMSDKVGIPLSTLAKVEQDKLSLTYDKLQQFTSRLGLTMTEFLAHAEAPSSDPPKVVTARRSLTRDGNSIQVSTPNYDYEYLCADLREKRMVPILTRIRAHDIAEFGEPVRHQGEEFVFVLEGTVEVHLQFYTSVVLQAGQGIYLDSTMGHAYVAKDCDSALVLGICSSEDPNLAGELITLAGKAEKVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 104 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 109 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 110 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 112 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 113 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 115 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 119 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 120 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 123 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 124 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 125 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 126 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 127 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 128 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 129 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 149 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 151 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 152 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 154 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 155 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 156 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 157 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 158 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 159 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 160 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 161 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 162 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 163 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 164 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 165 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 166 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 167 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 168 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 169 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 170 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 171 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 172 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 173 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 174 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 175 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 176 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 177 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 178 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 179 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.43 |
| Metatranscriptomes | 0.86 |
| Isolates | 1.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.14 |
| Nodule | 0 |
| Rhizoplane | 3.71 |
| Rhizosphere | 77.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070681_10073902 | 3300005458 | Bacteria | 3371 |
| 2 | rootH2_10153096 | 3300003320 | Bacteria | 1177 |
| 3 | rootL2_10077857 | 3300003322 | Unclassified | 2977 |
| 4 | rootL2_10277747 | 3300003322 | Bacteria | 1112 |
| 5 | rootH1_10386929 | 3300003323 | Bacteria | 2143 |
| 6 | Ga0065712_10095868 | 3300005290 | Unclassified | 2204 |
| 7 | Ga0065712_10390553 | 3300005290 | Unclassified | 742 |
| 8 | Ga0065715_10160543 | 3300005293 | Unclassified | 1634 |
| 9 | Ga0070658_10401067 | 3300005327 | Bacteria | 1178 |
| 10 | Ga0070690_100136347 | 3300005330 | Bacteria | 1662 |
| 11 | Ga0070670_100096007 | 3300005331 | Bacteria | 2550 |
| 12 | Ga0070670_100131221 | 3300005331 | Unclassified | 2163 |
| 13 | Ga0070670_100303556 | 3300005331 | Bacteria | 1397 |
| 14 | Ga0070666_10008191 | 3300005335 | Bacteria | 6477 |
| 15 | Ga0070666_10022492 | 3300005335 | Bacteria | 4093 |
| 16 | Ga0070682_100236039 | 3300005337 | Bacteria | 1310 |
| 17 | Ga0068868_100046538 | 3300005338 | Bacteria | 3396 |
| 18 | Ga0068868_100415501 | 3300005338 | Bacteria | 1164 |
| 19 | Ga0070661_100286559 | 3300005344 | Bacteria | 1279 |
| 20 | Ga0070675_100042061 | 3300005354 | Bacteria | 3733 |
| 21 | Ga0070671_100035563 | 3300005355 | Bacteria | 4126 |
| 22 | Ga0070671_100081015 | 3300005355 | Bacteria | 2714 |
| 23 | Ga0070673_100549131 | 3300005364 | Bacteria | 1049 |
| 24 | Ga0070673_100783448 | 3300005364 | Bacteria | 879 |
| 25 | Ga0070667_100030513 | 3300005367 | Bacteria | 4496 |
| 26 | Ga0070667_100043382 | 3300005367 | Plasmid | 3774 |
| 27 | Ga0070667_100186096 | 3300005367 | Bacteria | 1838 |
| 28 | Ga0070667_100411014 | 3300005367 | Bacteria | 1233 |
| 29 | Ga0070709_10128057 | 3300005434 | Bacteria | 1730 |
| 30 | Ga0070714_100152018 | 3300005435 | Bacteria | 2087 |
| 31 | Ga0070713_100133643 | 3300005436 | Bacteria | 2190 |
| 32 | Ga0070713_100694468 | 3300005436 | Unclassified | 971 |
| 33 | Ga0070710_10108263 | 3300005437 | Bacteria | 1666 |
| 34 | Ga0070711_100003598 | 3300005439 | Bacteria | 9041 |
| 35 | Ga0070705_100061913 | 3300005440 | Bacteria | 2226 |
| 36 | Ga0070663_100200141 | 3300005455 | Bacteria | 1558 |
| 37 | Ga0070663_100307207 | 3300005455 | Unclassified | 1271 |
| 38 | Ga0070663_100905851 | 3300005455 | Bacteria | 762 |
| 39 | Ga0070662_100225199 | 3300005457 | Unclassified | 1498 |
| 40 | Ga0068853_100042349 | 3300005539 | Unclassified | 3893 |
| 41 | Ga0068853_100050495 | 3300005539 | Bacteria | 3578 |
| 42 | Ga0070672_100297746 | 3300005543 | Unclassified | 1367 |
| 43 | Ga0070672_100570561 | 3300005543 | Bacteria | 984 |
| 44 | Ga0070693_100040244 | 3300005547 | Bacteria | 2623 |
| 45 | Ga0070665_100010244 | 3300005548 | Bacteria | 9486 |
| 46 | Ga0070665_100037462 | 3300005548 | Bacteria | 4877 |
| 47 | Ga0070665_100060446 | 3300005548 | Bacteria | 3798 |
| 48 | Ga0070665_100103540 | 3300005548 | Bacteria | 2849 |
| 49 | Ga0068855_100519754 | 3300005563 | Unclassified | 1291 |
| 50 | Ga0068855_100624792 | 3300005563 | Bacteria | 1159 |
| 51 | Ga0070664_100630126 | 3300005564 | Unclassified | 996 |
| 52 | Ga0068854_100180068 | 3300005578 | Bacteria | 1650 |
| 53 | Ga0068854_100288728 | 3300005578 | Unclassified | 1323 |
| 54 | Ga0068856_100067340 | 3300005614 | Plasmid | 3538 |
| 55 | Ga0068856_100115190 | 3300005614 | Bacteria | 2687 |
| 56 | Ga0068856_100448700 | 3300005614 | Bacteria | 1310 |
| 57 | Ga0070702_100078528 | 3300005615 | Unclassified | 1970 |
| 58 | Ga0068852_100817236 | 3300005616 | Unclassified | 947 |
| 59 | Ga0068859_100058967 | 3300005617 | Bacteria | 3867 |
| 60 | Ga0068859_100564823 | 3300005617 | Bacteria | 1232 |
| 61 | Ga0068861_100019213 | 3300005719 | Bacteria | 4882 |
| 62 | Ga0068851_10157986 | 3300005834 | Bacteria | 1243 |
| 63 | Ga0068863_100008471 | 3300005841 | Bacteria | 10043 |
| 64 | Ga0068863_100047609 | 3300005841 | Bacteria | 4067 |
| 65 | Ga0068863_100206959 | 3300005841 | Bacteria | 1888 |
| 66 | Ga0068858_100003274 | 3300005842 | Bacteria | 16136 |
| 67 | Ga0068858_100009797 | 3300005842 | Bacteria | 9120 |
| 68 | Ga0068858_100029839 | 3300005842 | Bacteria | 5066 |
| 69 | Ga0068858_100179568 | 3300005842 | Bacteria | 1998 |
| 70 | Ga0068858_100333844 | 3300005842 | Unclassified | 1450 |
| 71 | Ga0068860_100000371 | 3300005843 | Bacteria | 59118 |
| 72 | Ga0068860_100004395 | 3300005843 | Bacteria | 14397 |
| 73 | Ga0068860_100008888 | 3300005843 | Bacteria | 10008 |
| 74 | Ga0068860_100047589 | 3300005843 | Bacteria | 4087 |
| 75 | Ga0068862_100008583 | 3300005844 | Bacteria | 8455 |
| 76 | Ga0068862_100086803 | 3300005844 | Bacteria | 2721 |
| 77 | Ga0068862_100206020 | 3300005844 | Bacteria | 1775 |
| 78 | Ga0068862_100375243 | 3300005844 | Unclassified | 1325 |
| 79 | Ga0070715_10002148 | 3300006163 | Bacteria | 5974 |
| 80 | Ga0070712_100892315 | 3300006175 | Unclassified | 766 |
| 81 | Ga0097621_100026619 | 3300006237 | Bacteria | 4539 |
| 82 | Ga0097621_100235689 | 3300006237 | Bacteria | 1598 |
| 83 | Ga0068871_100033392 | 3300006358 | Bacteria | 4074 |
| 84 | Ga0068871_100330826 | 3300006358 | Bacteria | 1344 |
| 85 | Ga0068871_100460968 | 3300006358 | Unclassified | 1141 |
| 86 | Ga0068871_100800216 | 3300006358 | Unclassified | 869 |
| 87 | Ga0068865_100012227 | 3300006881 | Bacteria | 5398 |
| 88 | Ga0097620_100058966 | 3300006931 | Bacteria | 3867 |
| 89 | Ga0097620_100564807 | 3300006931 | Bacteria | 1232 |
| 90 | Ga0105240_10009834 | 3300009093 | Bacteria | 13500 |
| 91 | Ga0105240_10011492 | 3300009093 | Bacteria | 12328 |
| 92 | Ga0105240_10017129 | 3300009093 | Bacteria | 9780 |
| 93 | Ga0105240_10036471 | 3300009093 | Bacteria | 6324 |
| 94 | Ga0105240_10042367 | 3300009093 | Bacteria | 5802 |
| 95 | Ga0105240_10076634 | 3300009093 | Bacteria | 4122 |
| 96 | Ga0105240_10123362 | 3300009093 | Bacteria | 3117 |
| 97 | Ga0105240_10152837 | 3300009093 | Bacteria | 2747 |
| 98 | Ga0105240_10279128 | 3300009093 | Unclassified | 1920 |
| 99 | Ga0105240_10283878 | 3300009093 | Bacteria | 1901 |
| 100 | Ga0105240_10394456 | 3300009093 | Bacteria | 1560 |
| 101 | Ga0105240_10397792 | 3300009093 | Bacteria | 1552 |
| 102 | Ga0105240_10640470 | 3300009093 | Bacteria | 1166 |
| 103 | Ga0105245_10077222 | 3300009098 | Bacteria | 3036 |
| 104 | Ga0105247_10014012 | 3300009101 | Bacteria | 4808 |
| 105 | Ga0105247_10082303 | 3300009101 | Bacteria | 2031 |
| 106 | Ga0105247_10096742 | 3300009101 | Unclassified | 1882 |
| 107 | Ga0105241_10015842 | 3300009174 | Bacteria | 5522 |
| 108 | Ga0105241_10135503 | 3300009174 | Bacteria | 1999 |
| 109 | Ga0105241_10191316 | 3300009174 | Bacteria | 1704 |
| 110 | Ga0105242_10059233 | 3300009176 | Bacteria | 3141 |
| 111 | Ga0105248_10090674 | 3300009177 | Bacteria | 3442 |
| 112 | Ga0105248_10138030 | 3300009177 | Bacteria | 2751 |
| 113 | Ga0105248_10149575 | 3300009177 | Bacteria | 2634 |
| 114 | Ga0105237_10042247 | 3300009545 | Bacteria | 4598 |
| 115 | Ga0105237_10044319 | 3300009545 | Bacteria | 4479 |
| 116 | Ga0105237_10056865 | 3300009545 | Bacteria | 3915 |
| 117 | Ga0105237_10087823 | 3300009545 | Bacteria | 3099 |
| 118 | Ga0105237_10196637 | 3300009545 | Bacteria | 2016 |
| 119 | Ga0105238_10056305 | 3300009551 | Bacteria | 3945 |
| 120 | Ga0105238_10062920 | 3300009551 | Bacteria | 3711 |
| 121 | Ga0105238_10404689 | 3300009551 | Bacteria | 1358 |
| 122 | Ga0105238_10603331 | 3300009551 | Bacteria | 1106 |
| 123 | Ga0105249_10011853 | 3300009553 | Bacteria | 7664 |
| 124 | Ga0105249_10376359 | 3300009553 | Bacteria | 1445 |
| 125 | Ga0105249_10674501 | 3300009553 | Bacteria | 1092 |
| 126 | Ga0105249_10888823 | 3300009553 | Bacteria | 957 |
| 127 | Ga0105239_10052364 | 3300010375 | Bacteria | 4477 |
| 128 | Ga0105239_10076536 | 3300010375 | Bacteria | 3680 |
| 129 | Ga0105239_10271907 | 3300010375 | Unclassified | 1906 |
| 130 | Ga0157374_10013276 | 3300013296 | Bacteria | 7186 |
| 131 | Ga0157374_10260095 | 3300013296 | Bacteria | 1709 |
| 132 | Ga0163162_10032179 | 3300013306 | Bacteria | 5207 |
| 133 | Ga0163162_10038576 | 3300013306 | Bacteria | 4767 |
| 134 | Ga0157372_10781387 | 3300013307 | Bacteria | 1110 |
| 135 | Ga0157372_10867198 | 3300013307 | Bacteria | 1048 |
| 136 | Ga0157375_11484671 | 3300013308 | Bacteria | 800 |
| 137 | Ga0163163_10099043 | 3300014325 | Bacteria | 2937 |
| 138 | Ga0163163_10411991 | 3300014325 | Bacteria | 1410 |
| 139 | Ga0163163_10424800 | 3300014325 | Bacteria | 1388 |
| 140 | Ga0157379_10043469 | 3300014968 | Bacteria | 4011 |
| 141 | Ga0157379_10100187 | 3300014968 | Bacteria | 2601 |
| 142 | Ga0157379_10185291 | 3300014968 | Bacteria | 1881 |
| 143 | Ga0157379_10678038 | 3300014968 | Bacteria | 966 |
| 144 | Ga0157376_10191245 | 3300014969 | Bacteria | 1877 |
| 145 | Ga0157376_10263078 | 3300014969 | Bacteria | 1617 |
| 146 | Ga0207656_10051197 | 3300025321 | Bacteria | 1785 |
| 147 | Ga0207680_10070826 | 3300025903 | Bacteria | 2159 |
| 148 | Ga0207680_10080145 | 3300025903 | Bacteria | 2050 |
| 149 | Ga0207680_10392089 | 3300025903 | Bacteria | 980 |
| 150 | Ga0207699_10079771 | 3300025906 | Bacteria | 2026 |
| 151 | Ga0207707_10026084 | 3300025912 | Bacteria | 5110 |
| 152 | Ga0207695_10051873 | 3300025913 | Bacteria | 4303 |
| 153 | Ga0207695_10056064 | 3300025913 | Bacteria | 4103 |
| 154 | Ga0207695_10098681 | 3300025913 | Bacteria | 2920 |
| 155 | Ga0207695_10103075 | 3300025913 | Unclassified | 2845 |
| 156 | Ga0207695_10169450 | 3300025913 | Bacteria | 2110 |
| 157 | Ga0207695_10200488 | 3300025913 | Bacteria | 1910 |
| 158 | Ga0207695_10247635 | 3300025913 | Bacteria | 1682 |
| 159 | Ga0207695_10510737 | 3300025913 | Bacteria | 1084 |
| 160 | Ga0207671_10063001 | 3300025914 | Bacteria | 2755 |
| 161 | Ga0207671_10245800 | 3300025914 | Bacteria | 1406 |
| 162 | Ga0207671_10256309 | 3300025914 | Bacteria | 1376 |
| 163 | Ga0207693_10001796 | 3300025915 | Bacteria | 18812 |
| 164 | Ga0207681_10282567 | 3300025923 | Bacteria | 1307 |
| 165 | Ga0207694_10044207 | 3300025924 | Bacteria | 3440 |
| 166 | Ga0207694_10331311 | 3300025924 | Bacteria | 1258 |
| 167 | Ga0207694_10427397 | 3300025924 | Bacteria | 1104 |
| 168 | Ga0207687_10133951 | 3300025927 | Bacteria | 1872 |
| 169 | Ga0207644_10054179 | 3300025931 | Bacteria | 2888 |
| 170 | Ga0207644_10089468 | 3300025931 | Bacteria | 2291 |
| 171 | Ga0207644_10136947 | 3300025931 | Bacteria | 1881 |
| 172 | Ga0207706_10434692 | 3300025933 | Bacteria | 1136 |
| 173 | Ga0207706_10514537 | 3300025933 | Unclassified | 1032 |
| 174 | Ga0207686_10032053 | 3300025934 | Bacteria | 3125 |
| 175 | Ga0207665_10016735 | 3300025939 | Bacteria | 4816 |
| 176 | Ga0207691_10098831 | 3300025940 | Bacteria | 2606 |
| 177 | Ga0207711_10112842 | 3300025941 | Bacteria | 2419 |
| 178 | Ga0207711_10164286 | 3300025941 | Bacteria | 2011 |
| 179 | Ga0207689_10522142 | 3300025942 | Unclassified | 996 |
| 180 | Ga0207679_10392802 | 3300025945 | Bacteria | 1219 |
| 181 | Ga0207679_10562307 | 3300025945 | Unclassified | 1024 |
| 182 | Ga0207667_10060979 | 3300025949 | Bacteria | 3948 |
| 183 | Ga0207667_10093487 | 3300025949 | Bacteria | 3105 |
| 184 | Ga0207651_10463711 | 3300025960 | Bacteria | 1089 |
| 185 | Ga0207651_10774499 | 3300025960 | Bacteria | 849 |
| 186 | Ga0207712_10082220 | 3300025961 | Bacteria | 2347 |
| 187 | Ga0207712_10717970 | 3300025961 | Bacteria | 873 |
| 188 | Ga0207712_10755979 | 3300025961 | Unclassified | 852 |
| 189 | Ga0207640_10033128 | 3300025981 | Bacteria | 3211 |
| 190 | Ga0207658_10040062 | 3300025986 | Unclassified | 3384 |
| 191 | Ga0207658_10095994 | 3300025986 | Bacteria | 2311 |
| 192 | Ga0207658_10201878 | 3300025986 | Bacteria | 1660 |
| 193 | Ga0207703_10001680 | 3300026035 | Bacteria | 19905 |
| 194 | Ga0207703_10002243 | 3300026035 | Bacteria | 16902 |
| 195 | Ga0207703_10098601 | 3300026035 | Bacteria | 2471 |
| 196 | Ga0207639_10264823 | 3300026041 | Bacteria | 1505 |
| 197 | Ga0207639_11059020 | 3300026041 | Unclassified | 760 |
| 198 | Ga0207678_10095430 | 3300026067 | Bacteria | 2542 |
| 199 | Ga0207678_10231009 | 3300026067 | Unclassified | 1584 |
| 200 | Ga0207702_10061398 | 3300026078 | Bacteria | 3206 |
| 201 | Ga0207702_10102552 | 3300026078 | Bacteria | 2529 |
| 202 | Ga0207702_11038494 | 3300026078 | Unclassified | 813 |
| 203 | Ga0207641_10000273 | 3300026088 | Bacteria | 65757 |
| 204 | Ga0207641_10000289 | 3300026088 | Bacteria | 62844 |
| 205 | Ga0207641_10186500 | 3300026088 | Bacteria | 1903 |
| 206 | Ga0207676_10389051 | 3300026095 | Bacteria | 1300 |
| 207 | Ga0207675_100045070 | 3300026118 | Bacteria | 4120 |
| 208 | Ga0207683_10035582 | 3300026121 | Bacteria | 4332 |
| 209 | Ga0207698_10504602 | 3300026142 | Bacteria | 1178 |
| 210 | Ga0207698_10655021 | 3300026142 | Bacteria | 1041 |
| 211 | Ga0265356_1001441 | 3300028017 | Unclassified | 3531 |
| 212 | Ga0268266_10001894 | 3300028379 | Bacteria | 23577 |
| 213 | Ga0268266_10004135 | 3300028379 | Bacteria | 14017 |
| 214 | Ga0268266_10010095 | 3300028379 | Bacteria | 8280 |
| 215 | Ga0268266_10021295 | 3300028379 | Bacteria | 5524 |
| 216 | Ga0268266_10050611 | 3300028379 | Bacteria | 3565 |
| 217 | Ga0268266_10123684 | 3300028379 | Bacteria | 2305 |
| 218 | Ga0268265_10010614 | 3300028380 | Bacteria | 6221 |
| 219 | Ga0268265_10039699 | 3300028380 | Bacteria | 3471 |
| 220 | Ga0268265_10671886 | 3300028380 | Unclassified | 998 |
| 221 | Ga0268264_10000151 | 3300028381 | Bacteria | 158241 |
| 222 | Ga0268264_10000499 | 3300028381 | Bacteria | 51388 |
| 223 | Ga0268264_10035296 | 3300028381 | Bacteria | 4116 |
| 224 | Ga0268264_10068291 | 3300028381 | Bacteria | 3003 |
| 225 | Ga0265770_1002469 | 3300030878 | Bacteria | 2512 |
| 226 | Ga0265765_1008426 | 3300030879 | Bacteria | 1124 |
| 227 | Ga0265760_10000245 | 3300031090 | Bacteria | 14861 |
| 228 | Ga0265320_10050231 | 3300031240 | Bacteria | 2028 |
| 229 | Ga0265340_10181669 | 3300031247 | Bacteria | 951 |
| 230 | Ga0307509_10000028 | 3300031507 | Bacteria | 223572 |
| 231 | Ga0307414_10206030 | 3300032004 | Unclassified | 1604 |
| 232 | Ga0307510_10000003 | 3300033180 | Bacteria | 756654 |
| 233 | Ga0307510_10000010 | 3300033180 | Bacteria | 377457 |
| 234 | Ga0307510_10003055 | 3300033180 | Bacteria | 19328 |
| 235 | Ga0307510_10015386 | 3300033180 | Bacteria | 9045 |
| 236 | Ga0373934_0098785 | 3300035086 | Unclassified | 1180 |
| 237 | Ga0373936_0006460 | 3300035113 | Bacteria | 4423 |
| 238 | Ga0373936_0011512 | 3300035113 | Unclassified | 3350 |
| 239 | Ga0373953_0183041 | 3300035117 | Unclassified | 904 |
| 240 | Ga0373954_0012182 | 3300035118 | Bacteria | 3824 |
| 241 | Ga0373943_0161621 | 3300035170 | Unclassified | 1220 |
| 242 | Ga0373946_0145391 | 3300035171 | Unclassified | 1102 |
| 243 | Ga0373955_0043713 | 3300035172 | Bacteria | 2411 |
| 244 | Ga0373931_0454228 | 3300035691 | Unclassified | 820 |
| 245 | Ga0373927_0085053 | 3300035695 | Bacteria | 2052 |
| 246 | Ga0373933_0117426 | 3300035724 | Bacteria | 1664 |
| 247 | Ga0373933_0269194 | 3300035724 | Unclassified | 1099 |
| 248 | Ga0373947_0028383 | 3300035725 | Bacteria | 3281 |
| 249 | Ga0373937_0314558 | 3300036401 | Bacteria | 1481 |
| 250 | Ga0373937_0437145 | 3300036401 | Unclassified | 1242 |
| 251 | Ga0373925_0074628 | 3300037068 | Bacteria | 2569 |
| 252 | Ga0436364_0509912 | 3300037853 | Bacteria | 3628 |
| 253 | Ga0436365_0612073 | 3300039437 | Unclassified | 1254 |
| 254 | Ga0451577_0009257 | 3300042876 | Bacteria | 9492 |
| 255 | Ga0453683_0009059 | 3300044673 | Bacteria | 6647 |
| 256 | Ga0453684_0991739 | 3300044712 | Unclassified | 894 |
| 257 | Ga0466959_0001312 | 3300045049 | Bacteria | 15090 |
| 258 | Ga0466959_0036663 | 3300045049 | Bacteria | 3623 |
| 259 | Ga0495629_0081101 | 3300046459 | Bacteria | 2265 |
| 260 | Ga0495651_0201170 | 3300046462 | Bacteria | 1394 |
| 261 | Ga0495580_0001376 | 3300046472 | Bacteria | 21326 |
| 262 | Ga0495580_0060431 | 3300046472 | Bacteria | 2662 |
| 263 | Ga0495580_0064900 | 3300046472 | Unclassified | 2558 |
| 264 | Ga0495606_0105459 | 3300046507 | Unclassified | 1708 |
| 265 | Ga0495606_0112254 | 3300046507 | Bacteria | 1643 |
| 266 | Ga0495606_0152307 | 3300046507 | Unclassified | 1356 |
| 267 | Ga0495628_0130106 | 3300046516 | Bacteria | 1926 |
| 268 | Ga0495643_0081692 | 3300046522 | Unclassified | 1680 |
| 269 | Ga0495648_0185651 | 3300046524 | Bacteria | 1053 |
| 270 | Ga0495586_0147915 | 3300046535 | Bacteria | 1321 |
| 271 | Ga0495587_0067540 | 3300046536 | Bacteria | 2084 |
| 272 | Ga0495645_0231493 | 3300046543 | Unclassified | 1238 |
| 273 | Ga0495668_0226449 | 3300046616 | Unclassified | 1024 |
| 274 | Ga0495668_0507743 | 3300046616 | Bacteria | 665 |
| 275 | Ga0495625_0161178 | 3300046660 | Unclassified | 1502 |
| 276 | Ga0495623_0095545 | 3300046679 | Bacteria | 1817 |
| 277 | Ga0495613_0343293 | 3300046689 | Bacteria | 1027 |
| 278 | Ga0495624_0157530 | 3300046690 | Bacteria | 1388 |
| 279 | Ga0495687_029098 | 3300047443 | Bacteria | 2562 |
| 280 | Ga0495687_135326 | 3300047443 | Unclassified | 866 |
| 281 | Ga0495593_0164526 | 3300047673 | Bacteria | 1119 |
| 282 | Ga0495602_0038884 | 3300048088 | Bacteria | 4390 |
| 283 | Ga0496101_0042968 | 3300048904 | Bacteria | 3228 |
| 284 | Ga0496102_0009669 | 3300048905 | Bacteria | 8293 |
| 285 | Ga0496102_0023699 | 3300048905 | Bacteria | 5454 |
| 286 | Ga0496102_0073373 | 3300048905 | Bacteria | 3145 |
| 287 | Ga0496102_0080852 | 3300048905 | Bacteria | 2995 |
| 288 | Ga0496103_0066476 | 3300048906 | Bacteria | 2250 |
| 289 | Ga0496106_0011603 | 3300048909 | Bacteria | 6512 |
| 290 | Ga0496106_0062660 | 3300048909 | Bacteria | 2824 |
| 291 | Ga0496107_0000149 | 3300048910 | Bacteria | 35123 |
| 292 | Ga0496109_0129176 | 3300048912 | Bacteria | 2358 |
| 293 | Ga0496115_0011159 | 3300048918 | Bacteria | 6731 |
| 294 | Ga0496115_0279876 | 3300048918 | Bacteria | 1370 |
| 295 | Ga0496116_0008010 | 3300048919 | Bacteria | 9249 |
| 296 | Ga0496116_0015218 | 3300048919 | Bacteria | 6093 |
| 297 | Ga0496117_0000152 | 3300048920 | Bacteria | 147897 |
| 298 | Ga0496117_0000186 | 3300048920 | Bacteria | 127231 |
| 299 | Ga0496118_0000003 | 3300048921 | Bacteria | 773148 |
| 300 | Ga0496118_0000052 | 3300048921 | Bacteria | 237465 |
| 301 | Ga0496119_0000151 | 3300048922 | Bacteria | 96860 |
| 302 | Ga0496119_0001275 | 3300048922 | Bacteria | 31240 |
| 303 | Ga0496119_0005689 | 3300048922 | Bacteria | 11822 |
| 304 | Ga0496119_0107431 | 3300048922 | Bacteria | 1556 |
| 305 | Ga0496119_0130447 | 3300048922 | Bacteria | 1370 |
| 306 | Ga0496120_0000286 | 3300048923 | Bacteria | 84869 |
| 307 | Ga0496120_0132063 | 3300048923 | Unclassified | 1277 |
| 308 | Ga0496121_0000653 | 3300048924 | Bacteria | 64947 |
| 309 | Ga0496121_0001775 | 3300048924 | Bacteria | 35033 |
| 310 | Ga0496121_0015797 | 3300048924 | Bacteria | 7861 |
| 311 | Ga0496121_0057153 | 3300048924 | Unclassified | 3235 |
| 312 | Ga0496121_0103137 | 3300048924 | Bacteria | 2195 |
| 313 | Ga0496121_0202147 | 3300048924 | Unclassified | 1415 |
| 314 | Ga0496121_0255715 | 3300048924 | Unclassified | 1212 |
| 315 | Ga0496124_0010417 | 3300048927 | Bacteria | 9411 |
| 316 | Ga0496125_0001409 | 3300048928 | Bacteria | 35088 |
| 317 | Ga0496125_0001701 | 3300048928 | Bacteria | 30700 |
| 318 | Ga0496125_0036056 | 3300048928 | Bacteria | 4326 |
| 319 | Ga0496125_0051555 | 3300048928 | Unclassified | 3392 |
| 320 | Ga0496125_0134703 | 3300048928 | Bacteria | 1730 |
| 321 | Ga0496126_0035136 | 3300048929 | Unclassified | 4700 |
| 322 | Ga0496126_0078186 | 3300048929 | Bacteria | 2932 |
| 323 | Ga0496126_0168555 | 3300048929 | Bacteria | 1867 |
| 324 | Ga0496126_0195501 | 3300048929 | Bacteria | 1711 |
| 325 | Ga0500583_0010235 | 3300053092 | Bacteria | 3471 |
| 326 | Ga0500583_0067540 | 3300053092 | Bacteria | 1704 |
| 327 | Ga0500566_0209693 | 3300053094 | Bacteria | 977 |
| 328 | Ga0500648_201108 | 3300053097 | Bacteria | 1001 |
| 329 | Ga0500569_007134 | 3300053109 | Unclassified | 2494 |
| 330 | Ga0500608_000719 | 3300053122 | Bacteria | 12153 |
| 331 | Ga0500614_005901 | 3300053123 | Bacteria | 2572 |
| 332 | Ga0500559_0138083 | 3300053136 | Bacteria | 1141 |
| 333 | Ga0500559_0151813 | 3300053136 | Bacteria | 1087 |
| 334 | Ga0500590_036562 | 3300053148 | Bacteria | 2539 |
| 335 | Ga0500590_167192 | 3300053148 | Bacteria | 972 |
| 336 | Ga0500616_0000053 | 3300053153 | Bacteria | 291841 |
| 337 | Ga0500639_154899 | 3300053163 | Bacteria | 1051 |
| 338 | Ga0500637_0223793 | 3300053178 | Bacteria | 1062 |
| 339 | Ga0500576_124082 | 3300053725 | Unclassified | 1012 |
| 340 | Ga0500625_080456 | 3300053729 | Bacteria | 1424 |
| 341 | Ga0500596_001815 | 3300053735 | Bacteria | 4292 |
| 342 | Ga0500596_024755 | 3300053735 | Bacteria | 914 |
| 343 | 2643728809 | 2643221541 | Bacteria | 5498788 |
| 344 | 2643731042 | 2643221541 | Bacteria | 5498788 |
| 345 | 2644044306 | 2643221606 | Bacteria | 5588032 |
| 346 | 2644044824 | 2643221606 | Bacteria | 5588032 |
| 347 | 2644390997 | 2643221671 | Bacteria | 5496681 |
| 348 | 2644391770 | 2643221671 | Bacteria | 5496681 |
| 349 | Ga0070681_10073902 | |||
| 350 | rootH2_10153096 | |||
| 351 | rootL2_10077857 | |||
| 352 | rootL2_10277747 | |||
| 353 | rootH1_10386929 | |||
| 354 | Ga0065712_10095868 | |||
| 355 | Ga0065712_10390553 | |||
| 356 | Ga0065715_10160543 | |||
| 357 | Ga0070658_10401067 | |||
| 358 | Ga0070690_100136347 | |||
| 359 | Ga0070670_100096007 | |||
| 360 | Ga0070670_100131221 | |||
| 361 | Ga0070670_100303556 | |||
| 362 | Ga0070666_10008191 | |||
| 363 | Ga0070666_10022492 | |||
| 364 | Ga0070682_100236039 | |||
| 365 | Ga0068868_100046538 | |||
| 366 | Ga0068868_100415501 | |||
| 367 | Ga0070661_100286559 | |||
| 368 | Ga0070675_100042061 | |||
| 369 | Ga0070671_100035563 | |||
| 370 | Ga0070671_100081015 | |||
| 371 | Ga0070673_100549131 | |||
| 372 | Ga0070673_100783448 | |||
| 373 | Ga0070667_100030513 | |||
| 374 | Ga0070667_100043382 | |||
| 375 | Ga0070667_100186096 | |||
| 376 | Ga0070667_100411014 | |||
| 377 | Ga0070709_10128057 | |||
| 378 | Ga0070714_100152018 | |||
| 379 | Ga0070713_100133643 | |||
| 380 | Ga0070713_100694468 | |||
| 381 | Ga0070710_10108263 | |||
| 382 | Ga0070711_100003598 | |||
| 383 | Ga0070705_100061913 | |||
| 384 | Ga0070663_100200141 | |||
| 385 | Ga0070663_100307207 | |||
| 386 | Ga0070663_100905851 | |||
| 387 | Ga0070662_100225199 | |||
| 388 | Ga0068853_100042349 | |||
| 389 | Ga0068853_100050495 | |||
| 390 | Ga0070672_100297746 | |||
| 391 | Ga0070672_100570561 | |||
| 392 | Ga0070693_100040244 | |||
| 393 | Ga0070665_100010244 | |||
| 394 | Ga0070665_100037462 | |||
| 395 | Ga0070665_100060446 | |||
| 396 | Ga0070665_100103540 | |||
| 397 | Ga0068855_100519754 | |||
| 398 | Ga0068855_100624792 | |||
| 399 | Ga0070664_100630126 | |||
| 400 | Ga0068854_100180068 | |||
| 401 | Ga0068854_100288728 | |||
| 402 | Ga0068856_100067340 | |||
| 403 | Ga0068856_100115190 | |||
| 404 | Ga0068856_100448700 | |||
| 405 | Ga0070702_100078528 | |||
| 406 | Ga0068852_100817236 | |||
| 407 | Ga0068859_100058967 | |||
| 408 | Ga0068859_100564823 | |||
| 409 | Ga0068861_100019213 | |||
| 410 | Ga0068851_10157986 | |||
| 411 | Ga0068863_100008471 | |||
| 412 | Ga0068863_100047609 | |||
| 413 | Ga0068863_100206959 | |||
| 414 | Ga0068858_100003274 | |||
| 415 | Ga0068858_100009797 | |||
| 416 | Ga0068858_100029839 | |||
| 417 | Ga0068858_100179568 | |||
| 418 | Ga0068858_100333844 | |||
| 419 | Ga0068860_100000371 | |||
| 420 | Ga0068860_100004395 | |||
| 421 | Ga0068860_100008888 | |||
| 422 | Ga0068860_100047589 | |||
| 423 | Ga0068862_100008583 | |||
| 424 | Ga0068862_100086803 | |||
| 425 | Ga0068862_100206020 | |||
| 426 | Ga0068862_100375243 | |||
| 427 | Ga0070715_10002148 | |||
| 428 | Ga0070712_100892315 | |||
| 429 | Ga0097621_100026619 | |||
| 430 | Ga0097621_100235689 | |||
| 431 | Ga0068871_100033392 | |||
| 432 | Ga0068871_100330826 | |||
| 433 | Ga0068871_100460968 | |||
| 434 | Ga0068871_100800216 | |||
| 435 | Ga0068865_100012227 | |||
| 436 | Ga0097620_100058966 | |||
| 437 | Ga0097620_100564807 | |||
| 438 | Ga0105240_10009834 | |||
| 439 | Ga0105240_10011492 | |||
| 440 | Ga0105240_10017129 | |||
| 441 | Ga0105240_10036471 | |||
| 442 | Ga0105240_10042367 | |||
| 443 | Ga0105240_10076634 | |||
| 444 | Ga0105240_10123362 | |||
| 445 | Ga0105240_10152837 | |||
| 446 | Ga0105240_10279128 | |||
| 447 | Ga0105240_10283878 | |||
| 448 | Ga0105240_10394456 | |||
| 449 | Ga0105240_10397792 | |||
| 450 | Ga0105240_10640470 | |||
| 451 | Ga0105245_10077222 | |||
| 452 | Ga0105247_10014012 | |||
| 453 | Ga0105247_10082303 | |||
| 454 | Ga0105247_10096742 | |||
| 455 | Ga0105241_10015842 | |||
| 456 | Ga0105241_10135503 | |||
| 457 | Ga0105241_10191316 | |||
| 458 | Ga0105242_10059233 | |||
| 459 | Ga0105248_10090674 | |||
| 460 | Ga0105248_10138030 | |||
| 461 | Ga0105248_10149575 | |||
| 462 | Ga0105237_10042247 | |||
| 463 | Ga0105237_10044319 | |||
| 464 | Ga0105237_10056865 | |||
| 465 | Ga0105237_10087823 | |||
| 466 | Ga0105237_10196637 | |||
| 467 | Ga0105238_10056305 | |||
| 468 | Ga0105238_10062920 | |||
| 469 | Ga0105238_10404689 | |||
| 470 | Ga0105238_10603331 | |||
| 471 | Ga0105249_10011853 | |||
| 472 | Ga0105249_10376359 | |||
| 473 | Ga0105249_10674501 | |||
| 474 | Ga0105249_10888823 | |||
| 475 | Ga0105239_10052364 | |||
| 476 | Ga0105239_10076536 | |||
| 477 | Ga0105239_10271907 | |||
| 478 | Ga0157374_10013276 | |||
| 479 | Ga0157374_10260095 | |||
| 480 | Ga0163162_10032179 | |||
| 481 | Ga0163162_10038576 | |||
| 482 | Ga0157372_10781387 | |||
| 483 | Ga0157372_10867198 | |||
| 484 | Ga0157375_11484671 | |||
| 485 | Ga0163163_10099043 | |||
| 486 | Ga0163163_10411991 | |||
| 487 | Ga0163163_10424800 | |||
| 488 | Ga0157379_10043469 | |||
| 489 | Ga0157379_10100187 | |||
| 490 | Ga0157379_10185291 | |||
| 491 | Ga0157379_10678038 | |||
| 492 | Ga0157376_10191245 | |||
| 493 | Ga0157376_10263078 | |||
| 494 | Ga0207656_10051197 | |||
| 495 | Ga0207680_10070826 | |||
| 496 | Ga0207680_10080145 | |||
| 497 | Ga0207680_10392089 | |||
| 498 | Ga0207699_10079771 | |||
| 499 | Ga0207707_10026084 | |||
| 500 | Ga0207695_10051873 | |||
| 501 | Ga0207695_10056064 | |||
| 502 | Ga0207695_10098681 | |||
| 503 | Ga0207695_10103075 | |||
| 504 | Ga0207695_10169450 | |||
| 505 | Ga0207695_10200488 | |||
| 506 | Ga0207695_10247635 | |||
| 507 | Ga0207695_10510737 | |||
| 508 | Ga0207671_10063001 | |||
| 509 | Ga0207671_10245800 | |||
| 510 | Ga0207671_10256309 | |||
| 511 | Ga0207693_10001796 | |||
| 512 | Ga0207681_10282567 | |||
| 513 | Ga0207694_10044207 | |||
| 514 | Ga0207694_10331311 | |||
| 515 | Ga0207694_10427397 | |||
| 516 | Ga0207687_10133951 | |||
| 517 | Ga0207644_10054179 | |||
| 518 | Ga0207644_10089468 | |||
| 519 | Ga0207644_10136947 | |||
| 520 | Ga0207706_10434692 | |||
| 521 | Ga0207706_10514537 | |||
| 522 | Ga0207686_10032053 | |||
| 523 | Ga0207665_10016735 | |||
| 524 | Ga0207691_10098831 | |||
| 525 | Ga0207711_10112842 | |||
| 526 | Ga0207711_10164286 | |||
| 527 | Ga0207689_10522142 | |||
| 528 | Ga0207679_10392802 | |||
| 529 | Ga0207679_10562307 | |||
| 530 | Ga0207667_10060979 | |||
| 531 | Ga0207667_10093487 | |||
| 532 | Ga0207651_10463711 | |||
| 533 | Ga0207651_10774499 | |||
| 534 | Ga0207712_10082220 | |||
| 535 | Ga0207712_10717970 | |||
| 536 | Ga0207712_10755979 | |||
| 537 | Ga0207640_10033128 | |||
| 538 | Ga0207658_10040062 | |||
| 539 | Ga0207658_10095994 | |||
| 540 | Ga0207658_10201878 | |||
| 541 | Ga0207703_10001680 | |||
| 542 | Ga0207703_10002243 | |||
| 543 | Ga0207703_10098601 | |||
| 544 | Ga0207639_10264823 | |||
| 545 | Ga0207639_11059020 | |||
| 546 | Ga0207678_10095430 | |||
| 547 | Ga0207678_10231009 | |||
| 548 | Ga0207702_10061398 | |||
| 549 | Ga0207702_10102552 | |||
| 550 | Ga0207702_11038494 | |||
| 551 | Ga0207641_10000273 | |||
| 552 | Ga0207641_10000289 | |||
| 553 | Ga0207641_10186500 | |||
| 554 | Ga0207676_10389051 | |||
| 555 | Ga0207675_100045070 | |||
| 556 | Ga0207683_10035582 | |||
| 557 | Ga0207698_10504602 | |||
| 558 | Ga0207698_10655021 | |||
| 559 | Ga0265356_1001441 | |||
| 560 | Ga0268266_10001894 | |||
| 561 | Ga0268266_10004135 | |||
| 562 | Ga0268266_10010095 | |||
| 563 | Ga0268266_10021295 | |||
| 564 | Ga0268266_10050611 | |||
| 565 | Ga0268266_10123684 | |||
| 566 | Ga0268265_10010614 | |||
| 567 | Ga0268265_10039699 | |||
| 568 | Ga0268265_10671886 | |||
| 569 | Ga0268264_10000151 | |||
| 570 | Ga0268264_10000499 | |||
| 571 | Ga0268264_10035296 | |||
| 572 | Ga0268264_10068291 | |||
| 573 | Ga0265770_1002469 | |||
| 574 | Ga0265765_1008426 | |||
| 575 | Ga0265760_10000245 | |||
| 576 | Ga0265320_10050231 | |||
| 577 | Ga0265340_10181669 | |||
| 578 | Ga0307509_10000028 | |||
| 579 | Ga0307414_10206030 | |||
| 580 | Ga0307510_10000003 | |||
| 581 | Ga0307510_10000010 | |||
| 582 | Ga0307510_10003055 | |||
| 583 | Ga0307510_10015386 | |||
| 584 | Ga0373934_0098785 | |||
| 585 | Ga0373936_0006460 | |||
| 586 | Ga0373936_0011512 | |||
| 587 | Ga0373953_0183041 | |||
| 588 | Ga0373954_0012182 | |||
| 589 | Ga0373943_0161621 | |||
| 590 | Ga0373946_0145391 | |||
| 591 | Ga0373955_0043713 | |||
| 592 | Ga0373931_0454228 | |||
| 593 | Ga0373927_0085053 | |||
| 594 | Ga0373933_0117426 | |||
| 595 | Ga0373933_0269194 | |||
| 596 | Ga0373947_0028383 | |||
| 597 | Ga0373937_0314558 | |||
| 598 | Ga0373937_0437145 | |||
| 599 | Ga0373925_0074628 | |||
| 600 | Ga0436364_0509912 | |||
| 601 | Ga0436365_0612073 | |||
| 602 | Ga0451577_0009257 | |||
| 603 | Ga0453683_0009059 | |||
| 604 | Ga0453684_0991739 | |||
| 605 | Ga0466959_0001312 | |||
| 606 | Ga0466959_0036663 | |||
| 607 | Ga0495629_0081101 | |||
| 608 | Ga0495651_0201170 | |||
| 609 | Ga0495580_0001376 | |||
| 610 | Ga0495580_0060431 | |||
| 611 | Ga0495580_0064900 | |||
| 612 | Ga0495606_0105459 | |||
| 613 | Ga0495606_0112254 | |||
| 614 | Ga0495606_0152307 | |||
| 615 | Ga0495628_0130106 | |||
| 616 | Ga0495643_0081692 | |||
| 617 | Ga0495648_0185651 | |||
| 618 | Ga0495586_0147915 | |||
| 619 | Ga0495587_0067540 | |||
| 620 | Ga0495645_0231493 | |||
| 621 | Ga0495668_0226449 | |||
| 622 | Ga0495668_0507743 | |||
| 623 | Ga0495625_0161178 | |||
| 624 | Ga0495623_0095545 | |||
| 625 | Ga0495613_0343293 | |||
| 626 | Ga0495624_0157530 | |||
| 627 | Ga0495687_029098 | |||
| 628 | Ga0495687_135326 | |||
| 629 | Ga0495593_0164526 | |||
| 630 | Ga0495602_0038884 | |||
| 631 | Ga0496101_0042968 | |||
| 632 | Ga0496102_0009669 | |||
| 633 | Ga0496102_0023699 | |||
| 634 | Ga0496102_0073373 | |||
| 635 | Ga0496102_0080852 | |||
| 636 | Ga0496103_0066476 | |||
| 637 | Ga0496106_0011603 | |||
| 638 | Ga0496106_0062660 | |||
| 639 | Ga0496107_0000149 | |||
| 640 | Ga0496109_0129176 | |||
| 641 | Ga0496115_0011159 | |||
| 642 | Ga0496115_0279876 | |||
| 643 | Ga0496116_0008010 | |||
| 644 | Ga0496116_0015218 | |||
| 645 | Ga0496117_0000152 | |||
| 646 | Ga0496117_0000186 | |||
| 647 | Ga0496118_0000003 | |||
| 648 | Ga0496118_0000052 | |||
| 649 | Ga0496119_0000151 | |||
| 650 | Ga0496119_0001275 | |||
| 651 | Ga0496119_0005689 | |||
| 652 | Ga0496119_0107431 | |||
| 653 | Ga0496119_0130447 | |||
| 654 | Ga0496120_0000286 | |||
| 655 | Ga0496120_0132063 | |||
| 656 | Ga0496121_0000653 | |||
| 657 | Ga0496121_0001775 | |||
| 658 | Ga0496121_0015797 | |||
| 659 | Ga0496121_0057153 | |||
| 660 | Ga0496121_0103137 | |||
| 661 | Ga0496121_0202147 | |||
| 662 | Ga0496121_0255715 | |||
| 663 | Ga0496124_0010417 | |||
| 664 | Ga0496125_0001409 | |||
| 665 | Ga0496125_0001701 | |||
| 666 | Ga0496125_0036056 | |||
| 667 | Ga0496125_0051555 | |||
| 668 | Ga0496125_0134703 | |||
| 669 | Ga0496126_0035136 | |||
| 670 | Ga0496126_0078186 | |||
| 671 | Ga0496126_0168555 | |||
| 672 | Ga0496126_0195501 | |||
| 673 | Ga0500583_0010235 | |||
| 674 | Ga0500583_0067540 | |||
| 675 | Ga0500566_0209693 | |||
| 676 | Ga0500648_201108 | |||
| 677 | Ga0500569_007134 | |||
| 678 | Ga0500608_000719 | |||
| 679 | Ga0500614_005901 | |||
| 680 | Ga0500559_0138083 | |||
| 681 | Ga0500559_0151813 | |||
| 682 | Ga0500590_036562 | |||
| 683 | Ga0500590_167192 | |||
| 684 | Ga0500616_0000053 | |||
| 685 | Ga0500639_154899 | |||
| 686 | Ga0500637_0223793 | |||
| 687 | Ga0500576_124082 | |||
| 688 | Ga0500625_080456 | |||
| 689 | Ga0500596_001815 | |||
| 690 | Ga0500596_024755 | |||
| 691 | 2643728809 | |||
| 692 | 2643731042 | |||
| 693 | 2644044306 | |||
| 694 | 2644044824 | |||
| 695 | 2644390997 | |||
| 696 | 2644391770 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2xcj-assembly1.cif.gz_B | crystal structure of p2 c, the immunity repressor of temperate e. coli phage p2 | 0.9501 | 5 | 58 |
| 6rnx-assembly1.cif.gz_A | crystal structure of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) | 0.887 | 7 | 67 |
| 6rnz-assembly2.cif.gz_B | crystal structure of the n-terminal hth dna-binding domain of the essential repressor ddro from radiation-resistant deinococcus bacteria (deinococcus deserti) | 0.884 | 7 | 67 |
| 1y7y-assembly1.cif.gz_B | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.8732 | 9 | 66 |
| 1y7y-assembly1.cif.gz_A | high-resolution crystal structure of the restriction-modification controller protein c.ahdi from aeromonas hydrophila | 0.8686 | 9 | 66 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2xcjB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9501 | 5 | 58 | 1.10.260.40 |
| 2b5aC00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8744 | 9 | 71 | 1.10.260.40 |
| 1y7yB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8732 | 9 | 66 | 1.10.260.40 |
| 2b5aB00 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8725 | 9 | 71 | 1.10.260.40 |
| 2l49B01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.8717 | 8 | 57 | 1.10.260.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M7ZM53-F1-model_v4 | Cupin domain-containing protein | 0.975 | 135 | 210 |
|
| AF-A0A656AD51-F1-model_v4 | deleted | 0.9397 | 107 | 194 |
|
| AF-A0A1X1PND8-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9354 | 118 | 192 |
|
| AF-A0A656AD51-F1-model_v4 | deleted | 0.9196 | 107 | 194 |
|
| AF-A0A529LE48-F1-model_v4 | Cupin domain-containing protein | 0.9112 | 102 | 196 |
|