F418012

General Info

Members Datasets Scaffolds Average Seq Length
349 215 698 206

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0098134|Ga0496100_0098134_251_952
Length 233
Sequence MDPAIALRGFILGFTIAASVGPISLLVIRRTLAEGRFYGFVSGLGVATADATYGAIAAFGLAAVTNVLVNARQVLGLAGGAFLLWLAWQTIRSRPTEAATVPSGRRGYVAAYLSILGLTLANPMTILSFGALFAGFGVTHGVTGDAVVIVLGVLLGSTTWWLVLTTAIGAMRLRVTPAWIGRINVASGVVIGVFAVLVIASAVVAGPSAGSAAQRGGGPEASRAAVTPRPGSG

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
199 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
209 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
210 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
211 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
212 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.17
Nodule 0
Rhizoplane 8.02
Rhizosphere 81.38
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0098134 3300048903 Bacteria 2013
2 JGI25153J46596_10000048 3300003215 Bacteria 141500
3 Ga0055531_10012321 3300003794 Bacteria 4034
4 Ga0070670_100294524 3300005331 Bacteria 1418
5 Ga0068869_100128790 3300005334 Bacteria 1943
6 Ga0068869_100728578 3300005334 Bacteria 847
7 Ga0070682_100424173 3300005337 Bacteria 1012
8 Ga0068868_100402354 3300005338 Unclassified 1182
9 Ga0070689_101009181 3300005340 Bacteria 741
10 Ga0070661_100138776 3300005344 Bacteria 1831
11 Ga0070692_10312930 3300005345 Bacteria 963
12 Ga0070692_10599365 3300005345 Bacteria 729
13 Ga0070668_100265891 3300005347 Bacteria 1428
14 Ga0070669_100085038 3300005353 Bacteria 2362
15 Ga0070675_100009207 3300005354 Bacteria 7671
16 Ga0070674_100050305 3300005356 Bacteria 2869
17 Ga0070674_100416089 3300005356 Bacteria 1102
18 Ga0070674_100752191 3300005356 Bacteria 838
19 Ga0070673_100183273 3300005364 Bacteria 1793
20 Ga0070688_100005106 3300005365 Bacteria 6882
21 Ga0070659_100218603 3300005366 Bacteria 1572
22 Ga0070701_10053073 3300005438 Bacteria 2109
23 Ga0070700_100003207 3300005441 Bacteria 8408
24 Ga0070700_100044824 3300005441 Bacteria 2726
25 Ga0070694_100128169 3300005444 Bacteria 1830
26 Ga0070708_100754247 3300005445 Bacteria 915
27 Ga0070663_100803816 3300005455 Bacteria 806
28 Ga0070662_100013088 3300005457 Bacteria 5515
29 Ga0070662_100450070 3300005457 Bacteria 1069
30 Ga0068867_100018122 3300005459 Bacteria 5003
31 Ga0070685_10003827 3300005466 Bacteria 7611
32 Ga0070706_100146656 3300005467 Bacteria 2204
33 Ga0070707_100077586 3300005468 Bacteria 3205
34 Ga0070698_100008251 3300005471 Bacteria 11261
35 Ga0070698_100234365 3300005471 Bacteria 1769
36 Ga0070699_100038377 3300005518 Bacteria 4147
37 Ga0070699_100369043 3300005518 Bacteria 1295
38 Ga0070699_100486622 3300005518 Bacteria 1120
39 Ga0070699_100842960 3300005518 Bacteria 839
40 Ga0070679_100146573 3300005530 Bacteria 2338
41 Ga0070697_100018222 3300005536 Bacteria 5534
42 Ga0070697_100450588 3300005536 Bacteria 1121
43 Ga0070686_100014321 3300005544 Bacteria 4569
44 Ga0070695_100304804 3300005545 Bacteria 1179
45 Ga0070696_100083218 3300005546 Bacteria 2269
46 Ga0070696_100274445 3300005546 Bacteria 1283
47 Ga0070664_100430428 3300005564 Bacteria 1209
48 Ga0070702_100174338 3300005615 Bacteria 1402
49 Ga0068852_100041831 3300005616 Bacteria 3876
50 Ga0068859_100004835 3300005617 Bacteria 13711
51 Ga0068864_100013049 3300005618 Bacteria 6881
52 Ga0068866_10046132 3300005718 Bacteria 2190
53 Ga0068861_100660206 3300005719 Bacteria 967
54 Ga0068861_101209513 3300005719 Bacteria 731
55 Ga0068870_10234209 3300005840 Bacteria 1130
56 Ga0068858_100023530 3300005842 Bacteria 5738
57 Ga0068858_100192712 3300005842 Bacteria 1926
58 Ga0068860_100132513 3300005843 Bacteria 2393
59 Ga0068862_100029096 3300005844 Bacteria 4653
60 Ga0068862_100070316 3300005844 Bacteria 3021
61 Ga0081539_10045352 3300005985 Bacteria 2529
62 Ga0075362_10084089 3300006177 Bacteria 1470
63 Ga0097621_100348693 3300006237 Unclassified 1316
64 Ga0075428_100124504 3300006844 Bacteria 2806
65 Ga0075433_10374270 3300006852 Bacteria 1258
66 Ga0075434_100058871 3300006871 Bacteria 3819
67 Ga0075434_100068003 3300006871 Bacteria 3549
68 Ga0068865_100124952 3300006881 Bacteria 1919
69 Ga0097620_100004835 3300006931 Bacteria 13711
70 Ga0075435_100245689 3300007076 Bacteria 1523
71 Ga0075435_100481426 3300007076 Bacteria 1072
72 Ga0111539_10049311 3300009094 Bacteria 5022
73 Ga0111539_10377162 3300009094 Unclassified 1651
74 Ga0105245_10017207 3300009098 Bacteria 6306
75 Ga0105245_10454518 3300009098 Bacteria 1290
76 Ga0105245_10538210 3300009098 Bacteria 1189
77 Ga0105245_11213753 3300009098 Bacteria 802
78 Ga0114129_10087068 3300009147 Bacteria 4332
79 Ga0114129_12050848 3300009147 Unclassified 691
80 Ga0105243_10009939 3300009148 Bacteria 7232
81 Ga0105243_10356717 3300009148 Bacteria 1344
82 Ga0105242_10093585 3300009176 Bacteria 2534
83 Ga0105248_10089583 3300009177 Bacteria 3463
84 Ga0105248_10421391 3300009177 Bacteria 1503
85 Ga0105237_10449952 3300009545 Bacteria 1294
86 Ga0105238_10043522 3300009551 Bacteria 4543
87 Ga0105249_10002179 3300009553 Bacteria 16968
88 Ga0105239_10013128 3300010375 Bacteria 9204
89 Ga0105239_10624687 3300010375 Unclassified 1230
90 Ga0105246_10150347 3300011119 Bacteria 1762
91 Ga0157378_10009038 3300013297 Bacteria 8672
92 Ga0157375_10002966 3300013308 Bacteria 14734
93 Ga0157375_10501906 3300013308 Bacteria 1377
94 Ga0163163_10053629 3300014325 Bacteria 3981
95 Ga0163163_10177399 3300014325 Bacteria 2177
96 Ga0157380_10028334 3300014326 Bacteria 4269
97 Ga0157380_10054320 3300014326 Bacteria 3178
98 Ga0157380_10120513 3300014326 Bacteria 2221
99 Ga0157377_10004215 3300014745 Bacteria 6582
100 Ga0157377_10298598 3300014745 Unclassified 1062
101 Ga0163161_10099873 3300017792 Bacteria 2159
102 Ga0209758_1000048 3300025297 Bacteria 358400
103 Ga0209050_1005599 3300025298 Bacteria 7798
104 Ga0207426_1067470 3300025302 Bacteria 1008
105 Ga0209051_1054023 3300025303 Bacteria 1315
106 Ga0209257_1000237 3300025304 Bacteria 128812
107 Ga0207643_10005851 3300025908 Bacteria 6568
108 Ga0207684_10015022 3300025910 Bacteria 6666
109 Ga0207660_10150508 3300025917 Unclassified 1787
110 Ga0207662_10000834 3300025918 Bacteria 14168
111 Ga0207652_10138876 3300025921 Bacteria 2172
112 Ga0207646_10089546 3300025922 Bacteria 2754
113 Ga0207681_10031911 3300025923 Bacteria 3444
114 Ga0207650_10021877 3300025925 Bacteria 4524
115 Ga0207659_10012956 3300025926 Bacteria 5326
116 Ga0207687_10177414 3300025927 Bacteria 1648
117 Ga0207706_10011128 3300025933 Bacteria 8199
118 Ga0207706_10437088 3300025933 Bacteria 1133
119 Ga0207706_10492591 3300025933 Bacteria 1058
120 Ga0207709_10267116 3300025935 Bacteria 1257
121 Ga0207709_10270546 3300025935 Bacteria 1250
122 Ga0207669_10015240 3300025937 Bacteria 3873
123 Ga0207669_10066074 3300025937 Bacteria 2247
124 Ga0207704_10069292 3300025938 Bacteria 2228
125 Ga0207704_10203156 3300025938 Bacteria 1452
126 Ga0207711_10335532 3300025941 Bacteria 1399
127 Ga0207711_10715098 3300025941 Bacteria 934
128 Ga0207689_10089364 3300025942 Bacteria 2530
129 Ga0207689_10219488 3300025942 Bacteria 1571
130 Ga0207712_10724294 3300025961 Bacteria 870
131 Ga0207668_10028759 3300025972 Bacteria 3638
132 Ga0207668_10537581 3300025972 Unclassified 1011
133 Ga0207640_10372628 3300025981 Bacteria 1154
134 Ga0207703_10065336 3300026035 Bacteria 2990
135 Ga0207678_10001990 3300026067 Bacteria 18614
136 Ga0207708_10006773 3300026075 Bacteria 8478
137 Ga0207648_10004430 3300026089 Bacteria 14410
138 Ga0207676_10214935 3300026095 Bacteria 1709
139 Ga0207676_10805577 3300026095 Unclassified 917
140 Ga0207674_10021647 3300026116 Bacteria 6922
141 Ga0207675_100223338 3300026118 Archaea 1815
142 Ga0207675_100231154 3300026118 Bacteria 1784
143 Ga0207675_100404505 3300026118 Bacteria 1346
144 Ga0207683_10775417 3300026121 Bacteria 890
145 Ga0268266_10389635 3300028379 Bacteria 1316
146 Ga0268266_10837411 3300028379 Bacteria 889
147 Ga0268265_10034341 3300028380 Bacteria 3695
148 Ga0268264_10265733 3300028381 Bacteria 1601
149 Ga0265326_10004480 3300028558 Bacteria 4473
150 Ga0265319_1008967 3300028563 Bacteria 4320
151 Ga0265319_1077606 3300028563 Bacteria 1057
152 Ga0265318_10003738 3300028577 Bacteria 7579
153 Ga0265318_10028101 3300028577 Unclassified 2203
154 Ga0265322_10015542 3300028654 Bacteria 2199
155 Ga0265322_10028749 3300028654 Bacteria 1588
156 Ga0265338_10038053 3300028800 Bacteria 4566
157 Ga0265324_10004219 3300029957 Bacteria 6575
158 Ga0265332_10004373 3300031238 Bacteria 6644
159 Ga0265332_10218924 3300031238 Bacteria 790
160 Ga0265325_10025961 3300031241 Bacteria 3178
161 Ga0265325_10081295 3300031241 Unclassified 1610
162 Ga0265329_10004685 3300031242 Bacteria 5638
163 Ga0265339_10058334 3300031249 Bacteria 2084
164 Ga0265316_10015520 3300031344 Bacteria 6656
165 Ga0307513_10155684 3300031456 Bacteria 2186
166 Ga0307513_10289828 3300031456 Bacteria 1409
167 Ga0265313_10087725 3300031595 Bacteria 1402
168 Ga0265313_10089620 3300031595 Bacteria 1383
169 Ga0307508_10181539 3300031616 Bacteria 1707
170 Ga0265314_10011504 3300031711 Bacteria 7298
171 Ga0265342_10020941 3300031712 Bacteria 4182
172 Ga0373931_0062139 3300035691 Bacteria 2016
173 Ga0373947_0233233 3300035725 Bacteria 1213
174 Ga0395905_0159317 3300037471 Unclassified 2122
175 Ga0451849_1493866 3300041505 Bacteria 1130
176 Ga0451853_2569526 3300041512 Bacteria 817
177 Ga0450910_016488 3300042147 Bacteria 1094
178 Ga0439446_0023213 3300042156 Bacteria 1763
179 Ga0466960_0659392 3300044901 Unclassified 625
180 Ga0495651_0007899 3300046462 Bacteria 8152
181 Ga0495582_0226303 3300046473 Bacteria 1071
182 Ga0495664_0212106 3300046477 Bacteria 1173
183 Ga0495584_0309035 3300046491 Bacteria 803
184 Ga0495608_0385386 3300046511 Unclassified 859
185 Ga0495630_0050861 3300046517 Bacteria 3101
186 Ga0495587_0203711 3300046536 Bacteria 1119
187 Ga0495656_0227805 3300046615 Bacteria 934
188 Ga0495634_0138624 3300046642 Bacteria 1546
189 Ga0495625_0211450 3300046660 Bacteria 1275
190 Ga0495635_0271385 3300046663 Bacteria 1141
191 Ga0495680_0203151 3300047322 Bacteria 1421
192 Ga0495602_0150888 3300048088 Unclassified 1827
193 Ga0495602_0558529 3300048088 Bacteria 792
194 Ga0496101_0531461 3300048904 Bacteria 930
195 Ga0496102_0231947 3300048905 Bacteria 1740
196 Ga0496104_0418806 3300048907 Bacteria 1251
197 Ga0496104_0747973 3300048907 Bacteria 885
198 Ga0496105_0127474 3300048908 Bacteria 2098
199 Ga0496105_0260727 3300048908 Bacteria 1402
200 Ga0496106_0037718 3300048909 Bacteria 3616
201 Ga0496106_0196899 3300048909 Bacteria 1603
202 Ga0496107_0209929 3300048910 Bacteria 1448
203 Ga0496108_0013624 3300048911 Bacteria 6638
204 Ga0496108_0276603 3300048911 Bacteria 1462
205 Ga0496108_0455362 3300048911 Unclassified 1118
206 Ga0496109_0009855 3300048912 Bacteria 8155
207 Ga0496109_0012924 3300048912 Bacteria 7219
208 Ga0496109_0076065 3300048912 Bacteria 3087
209 Ga0496109_0388616 3300048912 Bacteria 1318
210 Ga0496109_0562673 3300048912 Bacteria 1075
211 Ga0496110_0001722 3300048913 Bacteria 16109
212 Ga0496110_0160163 3300048913 Bacteria 2040
213 Ga0496111_0017929 3300048914 Bacteria 4897
214 Ga0496111_0237501 3300048914 Bacteria 1353
215 Ga0496112_0373989 3300048915 Bacteria 1366
216 Ga0496112_0929300 3300048915 Bacteria 791
217 Ga0496113_0246143 3300048916 Unclassified 1427
218 Ga0496114_0023298 3300048917 Bacteria 5052
219 Ga0496114_0039094 3300048917 Bacteria 3926
220 Ga0496114_0171577 3300048917 Bacteria 1891
221 Ga0501031_0518125 3300049568 Bacteria 769
222 Ga0501032_0002982 3300049569 Bacteria 13147
223 Ga0501032_0118860 3300049569 Bacteria 1748
224 Ga0501032_0669153 3300049569 Bacteria 659
225 Ga0501033_0009223 3300049570 Bacteria 7596
226 Ga0501033_0750719 3300049570 Bacteria 662
227 Ga0501034_0004301 3300049571 Bacteria 15868
228 Ga0501034_0229517 3300049571 Bacteria 1806
229 Ga0501036_0039021 3300049572 Bacteria 4021
230 Ga0501036_0087962 3300049572 Bacteria 2626
231 Ga0501036_0700701 3300049572 Unclassified 837
232 Ga0501037_0000746 3300049573 Bacteria 24670
233 Ga0501037_0150927 3300049573 Bacteria 1661
234 Ga0501038_0001994 3300049574 Bacteria 18863
235 Ga0501038_0030867 3300049574 Bacteria 4738
236 Ga0501038_0241465 3300049574 Unclassified 1434
237 Ga0501038_0434746 3300049574 Bacteria 1011
238 Ga0501038_0450052 3300049574 Bacteria 990
239 Ga0501038_0612644 3300049574 Bacteria 823
240 Ga0501039_0013262 3300049575 Bacteria 6302
241 Ga0501039_0216820 3300049575 Bacteria 1505
242 Ga0501039_0247568 3300049575 Bacteria 1402
243 Ga0501040_0029670 3300049576 Bacteria 3694
244 Ga0501040_0039393 3300049576 Bacteria 3214
245 Ga0501041_0358620 3300049577 Bacteria 922
246 Ga0501041_0361509 3300049577 Bacteria 918
247 Ga0501043_0003818 3300049579 Bacteria 12393
248 Ga0501043_0351450 3300049579 Bacteria 1120
249 Ga0501046_0019455 3300049580 Bacteria 5633
250 Ga0501046_0153655 3300049580 Bacteria 1735
251 Ga0501047_0014963 3300049581 Bacteria 7382
252 Ga0501047_0289290 3300049581 Bacteria 1482
253 Ga0501047_0442211 3300049581 Bacteria 1130
254 Ga0501048_0013781 3300049582 Bacteria 5998
255 Ga0501068_0007540 3300049584 Bacteria 6021
256 Ga0501068_0083365 3300049584 Bacteria 1965
257 Ga0501069_0001518 3300049585 Bacteria 11494
258 Ga0501070_0010948 3300049586 Bacteria 7657
259 Ga0501070_0017357 3300049586 Bacteria 6042
260 Ga0501071_0133762 3300049587 Bacteria 1844
261 Ga0501071_0377146 3300049587 Bacteria 1081
262 Ga0501072_0015788 3300049588 Bacteria 5790
263 Ga0501072_0020363 3300049588 Bacteria 5139
264 Ga0501072_0102145 3300049588 Bacteria 2279
265 Ga0501072_0124155 3300049588 Bacteria 2057
266 Ga0501073_0005008 3300049589 Bacteria 9937
267 Ga0501073_0097625 3300049589 Bacteria 2040
268 Ga0501073_0200988 3300049589 Bacteria 1378
269 Ga0501074_0009909 3300049590 Bacteria 6923
270 Ga0501074_0220287 3300049590 Unclassified 1351
271 Ga0501074_0316268 3300049590 Bacteria 1109
272 Ga0501075_0032063 3300049591 Bacteria 3903
273 Ga0501075_0072055 3300049591 Bacteria 2612
274 Ga0501075_0080104 3300049591 Bacteria 2472
275 Ga0501075_0586641 3300049591 Bacteria 850
276 Ga0501075_0588591 3300049591 Bacteria 849
277 Ga0501076_0193795 3300049592 Unclassified 1659
278 Ga0501076_0224301 3300049592 Unclassified 1536
279 Ga0501076_0344185 3300049592 Bacteria 1224
280 Ga0501077_0090839 3300049593 Bacteria 1935
281 Ga0501079_0029210 3300049741 Bacteria 4232
282 Ga0501079_0186885 3300049741 Bacteria 1617
283 Ga0501079_0285221 3300049741 Unclassified 1291
284 Ga0501079_0446992 3300049741 Bacteria 1015
285 Ga0501079_0474867 3300049741 Bacteria 983
286 Ga0501080_0037364 3300049742 Bacteria 4535
287 Ga0501080_0064400 3300049742 Bacteria 3410
288 Ga0501080_0304849 3300049742 Bacteria 1444
289 Ga0501080_0530727 3300049742 Bacteria 1049
290 Ga0501080_1240826 3300049742 Unclassified 640
291 Ga0501081_0033968 3300049743 Bacteria 3468
292 Ga0501081_0113101 3300049743 Bacteria 1928
293 Ga0501081_0349136 3300049743 Bacteria 1090
294 Ga0501083_0002333 3300049744 Bacteria 12981
295 Ga0501083_0131524 3300049744 Bacteria 1641
296 Ga0501083_0259041 3300049744 Bacteria 1132
297 Ga0501035_0013483 3300049822 Bacteria 7544
298 Ga0501035_0564729 3300049822 Bacteria 931
299 Ga0501044_0015227 3300049823 Bacteria 8283
300 Ga0501044_0024868 3300049823 Bacteria 6352
301 Ga0501044_0145396 3300049823 Bacteria 2357
302 Ga0501044_0220478 3300049823 Bacteria 1847
303 Ga0501045_0191010 3300049824 Unclassified 1526
304 nmdc:mga05p37_1325723_c1 3300050507 Bacteria 731
305 nmdc:mga08y16_350921_c1 3300050511 Unclassified 1515
306 nmdc:mga0n895_137750_c1 3300050512 Bacteria 2468
307 nmdc:mga0n895_41791_c1 3300050512 Bacteria 4458
308 nmdc:mga0rr50_828379_c1 3300050513 Bacteria 789
309 nmdc:mga08x19_168755_c1 3300050514 Bacteria 1489
310 nmdc:mga0a205_309992_c1 3300050515 Bacteria 1450
311 Ga0495612_0163108 3300053078 Bacteria 974
312 Ga0495595_0027950 3300053084 Bacteria 2516
313 Ga0495595_0028717 3300053084 Bacteria 2486
314 Ga0500578_0022971 3300053086 Bacteria 4006
315 Ga0500644_0011981 3300053088 Bacteria 2385
316 Ga0500583_0111834 3300053092 Bacteria 1346
317 Ga0500583_0354567 3300053092 Bacteria 710
318 Ga0500651_0007723 3300053093 Bacteria 6292
319 Ga0500566_0033799 3300053094 Bacteria 2978
320 Ga0500641_0008123 3300053096 Bacteria 3738
321 Ga0500641_0120530 3300053096 Bacteria 1131
322 Ga0500555_011419 3300053103 Bacteria 2551
323 Ga0500569_039474 3300053109 Bacteria 1375
324 Ga0500594_0041225 3300053118 Bacteria 1264
325 Ga0500595_001295 3300053119 Bacteria 13600
326 Ga0500642_0007462 3300053130 Bacteria 3677
327 Ga0500642_0024834 3300053130 Unclassified 2426
328 Ga0500642_0084758 3300053130 Bacteria 1460
329 Ga0500568_0003100 3300053139 Bacteria 9479
330 Ga0500577_0006962 3300053142 Bacteria 3147
331 Ga0500588_0001607 3300053146 Bacteria 4355
332 Ga0500588_0003599 3300053146 Bacteria 3283
333 Ga0500604_0001319 3300053151 Bacteria 6908
334 Ga0500604_0004451 3300053151 Bacteria 3719
335 Ga0500616_0001080 3300053153 Bacteria 28464
336 Ga0500609_001663 3300053731 Bacteria 3249
337 Ga0500609_003308 3300053731 Bacteria 2273
338 Ga0501084_0022238 3300054114 Bacteria 5291
339 Ga0501084_0033892 3300054114 Bacteria 4271
340 Ga0501084_0108246 3300054114 Bacteria 2335
341 Ga0501084_0726261 3300054114 Bacteria 837
342 Ga0501082_0012939 3300060353 Bacteria 7172
343 Ga0501082_0344847 3300060353 Bacteria 1298
344 Ga0501082_0399550 3300060353 Unclassified 1199
345 Ga0501082_0505755 3300060353 Bacteria 1056
346 Ga0530510_0004623 3300061734 Bacteria 9522
347 Ga0530510_0195509 3300061734 Unclassified 1502
348 Ga0530510_0199183 3300061734 Bacteria 1487
349 Ga0530510_0299220 3300061734 Bacteria 1204
350 Ga0496100_0098134
351 JGI25153J46596_10000048
352 Ga0055531_10012321
353 Ga0070670_100294524
354 Ga0068869_100128790
355 Ga0068869_100728578
356 Ga0070682_100424173
357 Ga0068868_100402354
358 Ga0070689_101009181
359 Ga0070661_100138776
360 Ga0070692_10312930
361 Ga0070692_10599365
362 Ga0070668_100265891
363 Ga0070669_100085038
364 Ga0070675_100009207
365 Ga0070674_100050305
366 Ga0070674_100416089
367 Ga0070674_100752191
368 Ga0070673_100183273
369 Ga0070688_100005106
370 Ga0070659_100218603
371 Ga0070701_10053073
372 Ga0070700_100003207
373 Ga0070700_100044824
374 Ga0070694_100128169
375 Ga0070708_100754247
376 Ga0070663_100803816
377 Ga0070662_100013088
378 Ga0070662_100450070
379 Ga0068867_100018122
380 Ga0070685_10003827
381 Ga0070706_100146656
382 Ga0070707_100077586
383 Ga0070698_100008251
384 Ga0070698_100234365
385 Ga0070699_100038377
386 Ga0070699_100369043
387 Ga0070699_100486622
388 Ga0070699_100842960
389 Ga0070679_100146573
390 Ga0070697_100018222
391 Ga0070697_100450588
392 Ga0070686_100014321
393 Ga0070695_100304804
394 Ga0070696_100083218
395 Ga0070696_100274445
396 Ga0070664_100430428
397 Ga0070702_100174338
398 Ga0068852_100041831
399 Ga0068859_100004835
400 Ga0068864_100013049
401 Ga0068866_10046132
402 Ga0068861_100660206
403 Ga0068861_101209513
404 Ga0068870_10234209
405 Ga0068858_100023530
406 Ga0068858_100192712
407 Ga0068860_100132513
408 Ga0068862_100029096
409 Ga0068862_100070316
410 Ga0081539_10045352
411 Ga0075362_10084089
412 Ga0097621_100348693
413 Ga0075428_100124504
414 Ga0075433_10374270
415 Ga0075434_100058871
416 Ga0075434_100068003
417 Ga0068865_100124952
418 Ga0097620_100004835
419 Ga0075435_100245689
420 Ga0075435_100481426
421 Ga0111539_10049311
422 Ga0111539_10377162
423 Ga0105245_10017207
424 Ga0105245_10454518
425 Ga0105245_10538210
426 Ga0105245_11213753
427 Ga0114129_10087068
428 Ga0114129_12050848
429 Ga0105243_10009939
430 Ga0105243_10356717
431 Ga0105242_10093585
432 Ga0105248_10089583
433 Ga0105248_10421391
434 Ga0105237_10449952
435 Ga0105238_10043522
436 Ga0105249_10002179
437 Ga0105239_10013128
438 Ga0105239_10624687
439 Ga0105246_10150347
440 Ga0157378_10009038
441 Ga0157375_10002966
442 Ga0157375_10501906
443 Ga0163163_10053629
444 Ga0163163_10177399
445 Ga0157380_10028334
446 Ga0157380_10054320
447 Ga0157380_10120513
448 Ga0157377_10004215
449 Ga0157377_10298598
450 Ga0163161_10099873
451 Ga0209758_1000048
452 Ga0209050_1005599
453 Ga0207426_1067470
454 Ga0209051_1054023
455 Ga0209257_1000237
456 Ga0207643_10005851
457 Ga0207684_10015022
458 Ga0207660_10150508
459 Ga0207662_10000834
460 Ga0207652_10138876
461 Ga0207646_10089546
462 Ga0207681_10031911
463 Ga0207650_10021877
464 Ga0207659_10012956
465 Ga0207687_10177414
466 Ga0207706_10011128
467 Ga0207706_10437088
468 Ga0207706_10492591
469 Ga0207709_10267116
470 Ga0207709_10270546
471 Ga0207669_10015240
472 Ga0207669_10066074
473 Ga0207704_10069292
474 Ga0207704_10203156
475 Ga0207711_10335532
476 Ga0207711_10715098
477 Ga0207689_10089364
478 Ga0207689_10219488
479 Ga0207712_10724294
480 Ga0207668_10028759
481 Ga0207668_10537581
482 Ga0207640_10372628
483 Ga0207703_10065336
484 Ga0207678_10001990
485 Ga0207708_10006773
486 Ga0207648_10004430
487 Ga0207676_10214935
488 Ga0207676_10805577
489 Ga0207674_10021647
490 Ga0207675_100223338
491 Ga0207675_100231154
492 Ga0207675_100404505
493 Ga0207683_10775417
494 Ga0268266_10389635
495 Ga0268266_10837411
496 Ga0268265_10034341
497 Ga0268264_10265733
498 Ga0265326_10004480
499 Ga0265319_1008967
500 Ga0265319_1077606
501 Ga0265318_10003738
502 Ga0265318_10028101
503 Ga0265322_10015542
504 Ga0265322_10028749
505 Ga0265338_10038053
506 Ga0265324_10004219
507 Ga0265332_10004373
508 Ga0265332_10218924
509 Ga0265325_10025961
510 Ga0265325_10081295
511 Ga0265329_10004685
512 Ga0265339_10058334
513 Ga0265316_10015520
514 Ga0307513_10155684
515 Ga0307513_10289828
516 Ga0265313_10087725
517 Ga0265313_10089620
518 Ga0307508_10181539
519 Ga0265314_10011504
520 Ga0265342_10020941
521 Ga0373931_0062139
522 Ga0373947_0233233
523 Ga0395905_0159317
524 Ga0451849_1493866
525 Ga0451853_2569526
526 Ga0450910_016488
527 Ga0439446_0023213
528 Ga0466960_0659392
529 Ga0495651_0007899
530 Ga0495582_0226303
531 Ga0495664_0212106
532 Ga0495584_0309035
533 Ga0495608_0385386
534 Ga0495630_0050861
535 Ga0495587_0203711
536 Ga0495656_0227805
537 Ga0495634_0138624
538 Ga0495625_0211450
539 Ga0495635_0271385
540 Ga0495680_0203151
541 Ga0495602_0150888
542 Ga0495602_0558529
543 Ga0496101_0531461
544 Ga0496102_0231947
545 Ga0496104_0418806
546 Ga0496104_0747973
547 Ga0496105_0127474
548 Ga0496105_0260727
549 Ga0496106_0037718
550 Ga0496106_0196899
551 Ga0496107_0209929
552 Ga0496108_0013624
553 Ga0496108_0276603
554 Ga0496108_0455362
555 Ga0496109_0009855
556 Ga0496109_0012924
557 Ga0496109_0076065
558 Ga0496109_0388616
559 Ga0496109_0562673
560 Ga0496110_0001722
561 Ga0496110_0160163
562 Ga0496111_0017929
563 Ga0496111_0237501
564 Ga0496112_0373989
565 Ga0496112_0929300
566 Ga0496113_0246143
567 Ga0496114_0023298
568 Ga0496114_0039094
569 Ga0496114_0171577
570 Ga0501031_0518125
571 Ga0501032_0002982
572 Ga0501032_0118860
573 Ga0501032_0669153
574 Ga0501033_0009223
575 Ga0501033_0750719
576 Ga0501034_0004301
577 Ga0501034_0229517
578 Ga0501036_0039021
579 Ga0501036_0087962
580 Ga0501036_0700701
581 Ga0501037_0000746
582 Ga0501037_0150927
583 Ga0501038_0001994
584 Ga0501038_0030867
585 Ga0501038_0241465
586 Ga0501038_0434746
587 Ga0501038_0450052
588 Ga0501038_0612644
589 Ga0501039_0013262
590 Ga0501039_0216820
591 Ga0501039_0247568
592 Ga0501040_0029670
593 Ga0501040_0039393
594 Ga0501041_0358620
595 Ga0501041_0361509
596 Ga0501043_0003818
597 Ga0501043_0351450
598 Ga0501046_0019455
599 Ga0501046_0153655
600 Ga0501047_0014963
601 Ga0501047_0289290
602 Ga0501047_0442211
603 Ga0501048_0013781
604 Ga0501068_0007540
605 Ga0501068_0083365
606 Ga0501069_0001518
607 Ga0501070_0010948
608 Ga0501070_0017357
609 Ga0501071_0133762
610 Ga0501071_0377146
611 Ga0501072_0015788
612 Ga0501072_0020363
613 Ga0501072_0102145
614 Ga0501072_0124155
615 Ga0501073_0005008
616 Ga0501073_0097625
617 Ga0501073_0200988
618 Ga0501074_0009909
619 Ga0501074_0220287
620 Ga0501074_0316268
621 Ga0501075_0032063
622 Ga0501075_0072055
623 Ga0501075_0080104
624 Ga0501075_0586641
625 Ga0501075_0588591
626 Ga0501076_0193795
627 Ga0501076_0224301
628 Ga0501076_0344185
629 Ga0501077_0090839
630 Ga0501079_0029210
631 Ga0501079_0186885
632 Ga0501079_0285221
633 Ga0501079_0446992
634 Ga0501079_0474867
635 Ga0501080_0037364
636 Ga0501080_0064400
637 Ga0501080_0304849
638 Ga0501080_0530727
639 Ga0501080_1240826
640 Ga0501081_0033968
641 Ga0501081_0113101
642 Ga0501081_0349136
643 Ga0501083_0002333
644 Ga0501083_0131524
645 Ga0501083_0259041
646 Ga0501035_0013483
647 Ga0501035_0564729
648 Ga0501044_0015227
649 Ga0501044_0024868
650 Ga0501044_0145396
651 Ga0501044_0220478
652 Ga0501045_0191010
653 nmdc:mga05p37_1325723_c1
654 nmdc:mga08y16_350921_c1
655 nmdc:mga0n895_137750_c1
656 nmdc:mga0n895_41791_c1
657 nmdc:mga0rr50_828379_c1
658 nmdc:mga08x19_168755_c1
659 nmdc:mga0a205_309992_c1
660 Ga0495612_0163108
661 Ga0495595_0027950
662 Ga0495595_0028717
663 Ga0500578_0022971
664 Ga0500644_0011981
665 Ga0500583_0111834
666 Ga0500583_0354567
667 Ga0500651_0007723
668 Ga0500566_0033799
669 Ga0500641_0008123
670 Ga0500641_0120530
671 Ga0500555_011419
672 Ga0500569_039474
673 Ga0500594_0041225
674 Ga0500595_001295
675 Ga0500642_0007462
676 Ga0500642_0024834
677 Ga0500642_0084758
678 Ga0500568_0003100
679 Ga0500577_0006962
680 Ga0500588_0001607
681 Ga0500588_0003599
682 Ga0500604_0001319
683 Ga0500604_0004451
684 Ga0500616_0001080
685 Ga0500609_001663
686 Ga0500609_003308
687 Ga0501084_0022238
688 Ga0501084_0033892
689 Ga0501084_0108246
690 Ga0501084_0726261
691 Ga0501082_0012939
692 Ga0501082_0344847
693 Ga0501082_0399550
694 Ga0501082_0505755
695 Ga0530510_0004623
696 Ga0530510_0195509
697 Ga0530510_0199183
698 Ga0530510_0299220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

14

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4933 6 208
7xzi-assembly1.cif.gz_A cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.467 6 208
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4573 6 208
6kkl-assembly1.cif.gz_A crystal structure of drug:proton antiporter-1 (dha1) family sotb, in the inward conformation (h115n mutant) 0.4459 5 214
7vcf-assembly1.cif.gz_A cryo-em structure of chlamydomonas toc-tic supercomplex 0.4375 6 208
ID Description Score Start End Superfamily
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6395 2 209 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6195 2 209 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6128 8 210 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.582 8 210 1.20.1250.20
af_B9G125_1_232_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.58 12 208 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2W4R3A8-F1-model_v4 Lysine transporter LysE 0.9466 3 210 GO:0005886
GO:0015171
AF-A0A7W1GWE8-F1-model_v4 LysE family translocator 0.946 7 210 GO:0005886
GO:0015171
AF-H6NCX6-F1-model_v4 Lysine exporter protein LysE/YggA 0.9441 8 212 GO:0005886
GO:0015171
AF-A0A5E4PL78-F1-model_v4 Lysine transporter LysE 0.9373 21 207 GO:0005886
GO:0015171
AF-A0A3A6PBK7-F1-model_v4 LysE family translocator 0.9357 2 210 GO:0005886
GO:0015171

Map