F418009

General Info

Members Datasets Scaffolds Average Seq Length
349 196 696 249

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0192599|Ga0495602_0192599_26_844
Length 272
Sequence MAGEFNPASARVLGPDSSLVRMAVENKGLQVVQSGERTNTEGKPVSNLILLSISDSDYSSLRPHLEYVSLPNHLVLHEGGGKLEFAYFPNRGLVSLVVVMKDGKTAEAGIVGNEGFTGTPAAVGLSRSPLQAVVQITGNGFRVEVAALQNTLETTPHLQLMLSRYAVVQGMQVAQTAACNRLHDIKQRLARWLLMTQDRVDSESLPITHDFLATMLGTDRPSVSLAAAVLQKKKLIEYARGAVKIVNRKKLEDSACECYGITQQYNGELGLK

Samples

Sample ID Description Type Environment
1 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
91 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
141 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
142 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
143 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
151 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
152 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
159 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.42
Metatranscriptomes 2.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.72
Rhizosphere 95.7
Stem 0
Stem Tuber 0
Unclassified 31.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495602_0192599 3300048088 Unclassified 1562
2 Ga0065712_10007698 3300005290 Unclassified 2355
3 Ga0065715_10112661 3300005293 Bacteria 2521
4 Ga0065715_10260249 3300005293 Unclassified 1140
5 Ga0070658_10293742 3300005327 Unclassified 1385
6 Ga0070683_100080041 3300005329 Unclassified 3058
7 Ga0070690_100038272 3300005330 Unclassified 3026
8 Ga0070666_10053115 3300005335 Unclassified 2732
9 Ga0070680_100434570 3300005336 Bacteria 1120
10 Ga0070682_100064664 3300005337 Unclassified 2322
11 Ga0068868_100039764 3300005338 Unclassified 3656
12 Ga0070660_100174932 3300005339 Unclassified 1735
13 Ga0070689_100075505 3300005340 Unclassified 2639
14 Ga0070661_100124272 3300005344 Unclassified 1934
15 Ga0070668_100008296 3300005347 Bacteria 7708
16 Ga0070659_100088703 3300005366 Unclassified 2477
17 Ga0070667_100004275 3300005367 Bacteria 12056
18 Ga0070703_10001058 3300005406 Bacteria 8583
19 Ga0070709_10007213 3300005434 Bacteria 6091
20 Ga0070709_10007431 3300005434 Bacteria 6005
21 Ga0070709_10070037 3300005434 Bacteria 2260
22 Ga0070709_10092264 3300005434 Unclassified 2000
23 Ga0070709_10128009 3300005434 Bacteria 1730
24 Ga0070709_10209608 3300005434 Bacteria 1385
25 Ga0070714_100142658 3300005435 Bacteria 2152
26 Ga0070714_100163528 3300005435 Bacteria 2015
27 Ga0070714_100164202 3300005435 Bacteria 2011
28 Ga0070714_100803740 3300005435 Bacteria 911
29 Ga0070713_100004391 3300005436 Bacteria 9475
30 Ga0070713_100010630 3300005436 Bacteria 6658
31 Ga0070713_100022127 3300005436 Bacteria 4907
32 Ga0070713_100086521 3300005436 Unclassified 2687
33 Ga0070713_100108477 3300005436 Bacteria 2417
34 Ga0070713_100172738 3300005436 Bacteria 1937
35 Ga0070713_100357358 3300005436 Bacteria 1356
36 Ga0070710_10085736 3300005437 Bacteria 1848
37 Ga0070711_100004628 3300005439 Bacteria 8141
38 Ga0070711_100013451 3300005439 Bacteria 5141
39 Ga0070711_100052601 3300005439 Unclassified 2803
40 Ga0070711_100220700 3300005439 Unclassified 1473
41 Ga0070711_100319713 3300005439 Bacteria 1240
42 Ga0070705_100077638 3300005440 Unclassified 2029
43 Ga0070705_100316936 3300005440 Bacteria 1124
44 Ga0070694_100007567 3300005444 Bacteria 6631
45 Ga0070708_100007685 3300005445 Bacteria 8639
46 Ga0070708_100019095 3300005445 Bacteria 5751
47 Ga0070708_100050595 3300005445 Bacteria 3680
48 Ga0070708_100116579 3300005445 Bacteria 2459
49 Ga0070708_100194772 3300005445 Unclassified 1896
50 Ga0070708_100433443 3300005445 Unclassified 1240
51 Ga0070662_100000369 3300005457 Bacteria 26852
52 Ga0070681_10045016 3300005458 Bacteria 4417
53 Ga0070681_10058110 3300005458 Bacteria 3848
54 Ga0070706_100014246 3300005467 Bacteria 7347
55 Ga0070706_100134581 3300005467 Bacteria 2307
56 Ga0070707_100075459 3300005468 Bacteria 3252
57 Ga0070707_100170838 3300005468 Bacteria 2119
58 Ga0070707_100213478 3300005468 Unclassified 1881
59 Ga0070707_100319322 3300005468 Bacteria 1509
60 Ga0070707_100380404 3300005468 Bacteria 1371
61 Ga0070698_100086187 3300005471 Unclassified 3127
62 Ga0070698_100477257 3300005471 Unclassified 1184
63 Ga0070699_100001772 3300005518 Bacteria 19661
64 Ga0070699_100035748 3300005518 Bacteria 4294
65 Ga0070699_100044192 3300005518 Viruses 3858
66 Ga0070699_100145252 3300005518 Bacteria 2096
67 Ga0070699_100213751 3300005518 Unclassified 1717
68 Ga0070699_100223163 3300005518 Unclassified 1679
69 Ga0070699_100306324 3300005518 Unclassified 1426
70 Ga0070679_100012575 3300005530 Bacteria 8093
71 Ga0070684_100024582 3300005535 Bacteria 5055
72 Ga0070697_100000661 3300005536 Bacteria 25959
73 Ga0070697_100001813 3300005536 Bacteria 16317
74 Ga0070697_100051844 3300005536 Bacteria 3334
75 Ga0070697_100107304 3300005536 Bacteria 2323
76 Ga0070697_100184073 3300005536 Unclassified 1771
77 Ga0070697_100420404 3300005536 Bacteria 1161
78 Ga0068853_100012414 3300005539 Bacteria 6930
79 Ga0070672_100175449 3300005543 Unclassified 1784
80 Ga0070686_100040881 3300005544 Unclassified 2894
81 Ga0070695_100006664 3300005545 Bacteria 6828
82 Ga0070695_100106942 3300005545 Unclassified 1892
83 Ga0070696_100027253 3300005546 Bacteria 3892
84 Ga0070693_100002141 3300005547 Bacteria 9054
85 Ga0070693_100124794 3300005547 Bacteria 1601
86 Ga0070693_100154142 3300005547 Bacteria 1457
87 Ga0068855_100290540 3300005563 Bacteria 1812
88 Ga0070664_100202821 3300005564 Bacteria 1770
89 Ga0068857_100204333 3300005577 Bacteria 1801
90 Ga0068854_100016072 3300005578 Bacteria 4978
91 Ga0068856_100013375 3300005614 Bacteria 7945
92 Ga0068856_101041641 3300005614 Unclassified 836
93 Ga0070702_100161662 3300005615 Bacteria 1448
94 Ga0068852_100051003 3300005616 Unclassified 3548
95 Ga0068859_100011100 3300005617 Bacteria 9062
96 Ga0068864_100099017 3300005618 Bacteria 2583
97 Ga0068866_10089031 3300005718 Bacteria 1676
98 Ga0068851_10003957 3300005834 Bacteria 6633
99 Ga0068858_100019764 3300005842 Bacteria 6296
100 Ga0068860_100078871 3300005843 Unclassified 3131
101 Ga0068862_100017582 3300005844 Bacteria 5954
102 Ga0070717_10016286 3300006028 Bacteria 5762
103 Ga0070717_10044193 3300006028 Bacteria 3637
104 Ga0070717_10046783 3300006028 Bacteria 3541
105 Ga0070717_10174157 3300006028 Bacteria 1873
106 Ga0070717_10491150 3300006028 Unclassified 1109
107 Ga0070715_10022779 3300006163 Bacteria 2446
108 Ga0070715_10114989 3300006163 Unclassified 1275
109 Ga0070715_10206153 3300006163 Unclassified 1002
110 Ga0070716_100000092 3300006173 Bacteria 35441
111 Ga0070716_100007299 3300006173 Bacteria 5439
112 Ga0070716_100012470 3300006173 Bacteria 4310
113 Ga0070716_100073180 3300006173 Bacteria 2021
114 Ga0070716_100159618 3300006173 Unclassified 1460
115 Ga0070716_100209847 3300006173 Bacteria 1301
116 Ga0070716_100289182 3300006173 Unclassified 1135
117 Ga0070712_100000044 3300006175 Bacteria 66245
118 Ga0070712_100029654 3300006175 Bacteria 3669
119 Ga0070712_100031380 3300006175 Bacteria 3579
120 Ga0070712_100042419 3300006175 Bacteria 3129
121 Ga0070712_100060966 3300006175 Bacteria 2663
122 Ga0070712_100552185 3300006175 Unclassified 971
123 Ga0097621_100024203 3300006237 Unclassified 4738
124 Ga0097621_100755515 3300006237 Unclassified 898
125 Ga0075434_100240793 3300006871 Bacteria 1829
126 Ga0068865_100143595 3300006881 Bacteria 1802
127 Ga0097620_100011100 3300006931 Bacteria 9062
128 Ga0099794_10000577 3300007265 Bacteria 12289
129 Ga0099795_10061909 3300007788 Unclassified 1391
130 Ga0105250_10083670 3300009092 Bacteria 1295
131 Ga0105240_10154408 3300009093 Bacteria 2731
132 Ga0105245_10063621 3300009098 Unclassified 3332
133 Ga0105247_10005325 3300009101 Bacteria 8110
134 Ga0105243_10100598 3300009148 Unclassified 2399
135 Ga0105241_10459024 3300009174 Bacteria 1128
136 Ga0105241_10758235 3300009174 Bacteria 890
137 Ga0105242_10012986 3300009176 Bacteria 6422
138 Ga0105248_10009200 3300009177 Bacteria 10869
139 Ga0105237_10200067 3300009545 Unclassified 1997
140 Ga0105237_10464038 3300009545 Unclassified 1272
141 Ga0105238_10019502 3300009551 Bacteria 6906
142 Ga0105249_10001488 3300009553 Bacteria 20538
143 Ga0099796_10039346 3300010159 Unclassified 1591
144 Ga0099796_10148316 3300010159 Unclassified 922
145 Ga0105239_10576813 3300010375 Bacteria 1282
146 Ga0105246_10089112 3300011119 Unclassified 2219
147 Ga0157373_10306379 3300013100 Bacteria 1128
148 Ga0157371_10024119 3300013102 Unclassified 4444
149 Ga0157370_10073022 3300013104 Unclassified 3237
150 Ga0157369_10097826 3300013105 Unclassified 3130
151 Ga0157374_10008001 3300013296 Bacteria 9037
152 Ga0157374_10912388 3300013296 Bacteria 896
153 Ga0157378_10064121 3300013297 Unclassified 3285
154 Ga0157378_10080363 3300013297 Bacteria 2945
155 Ga0163162_10005421 3300013306 Bacteria 12328
156 Ga0157372_10246213 3300013307 Bacteria 2074
157 Ga0157372_10581947 3300013307 Bacteria 1305
158 Ga0157375_10088350 3300013308 Unclassified 3154
159 Ga0157379_10002367 3300014968 Bacteria 15753
160 Ga0157379_10129546 3300014968 Unclassified 2270
161 Ga0157376_10033200 3300014969 Unclassified 4152
162 Ga0224569_100797 3300022732 Bacteria 2692
163 Ga0224569_100872 3300022732 Bacteria 2557
164 Ga0224569_101357 3300022732 Bacteria 2059
165 Ga0224569_101738 3300022732 Bacteria 1806
166 Ga0224572_1020311 3300024225 Unclassified 1276
167 Ga0228598_1000033 3300024227 Bacteria 19469
168 Ga0228598_1000901 3300024227 Bacteria 6429
169 Ga0228598_1002046 3300024227 Bacteria 4402
170 Ga0228598_1003439 3300024227 Bacteria 3404
171 Ga0228598_1012844 3300024227 Unclassified 1662
172 Ga0228598_1028282 3300024227 Unclassified 1103
173 Ga0228598_1046732 3300024227 Bacteria 857
174 Ga0207656_10195564 3300025321 Bacteria 975
175 Ga0207653_10001643 3300025885 Bacteria 7174
176 Ga0207642_10068296 3300025899 Bacteria 1681
177 Ga0207680_10091039 3300025903 Unclassified 1940
178 Ga0207647_10112472 3300025904 Bacteria 1609
179 Ga0207685_10090432 3300025905 Unclassified 1287
180 Ga0207685_10208040 3300025905 Unclassified 923
181 Ga0207699_10005129 3300025906 Bacteria 6272
182 Ga0207699_10021544 3300025906 Bacteria 3475
183 Ga0207699_10023192 3300025906 Bacteria 3375
184 Ga0207699_10158446 3300025906 Unclassified 1505
185 Ga0207699_10371488 3300025906 Unclassified 1013
186 Ga0207684_10009869 3300025910 Bacteria 8426
187 Ga0207684_10058265 3300025910 Bacteria 3277
188 Ga0207654_10060200 3300025911 Bacteria 2218
189 Ga0207707_10166250 3300025912 Unclassified 1928
190 Ga0207707_10337709 3300025912 Bacteria 1299
191 Ga0207695_10025665 3300025913 Bacteria 6592
192 Ga0207695_10035661 3300025913 Bacteria 5390
193 Ga0207671_10121012 3300025914 Unclassified 2001
194 Ga0207671_10517951 3300025914 Unclassified 951
195 Ga0207693_10000230 3300025915 Bacteria 51238
196 Ga0207693_10004203 3300025915 Bacteria 12211
197 Ga0207693_10021480 3300025915 Bacteria 5128
198 Ga0207693_10021520 3300025915 Bacteria 5123
199 Ga0207693_10044769 3300025915 Bacteria 3477
200 Ga0207693_10206985 3300025915 Bacteria 1542
201 Ga0207693_10378751 3300025915 Unclassified 1107
202 Ga0207663_10003064 3300025916 Bacteria 8099
203 Ga0207663_10003748 3300025916 Bacteria 7494
204 Ga0207663_10036141 3300025916 Bacteria 2970
205 Ga0207660_10455953 3300025917 Bacteria 1034
206 Ga0207657_10026906 3300025919 Bacteria 5275
207 Ga0207652_10294678 3300025921 Unclassified 1464
208 Ga0207646_10078858 3300025922 Bacteria 2944
209 Ga0207646_10213591 3300025922 Viruses 1742
210 Ga0207646_10232591 3300025922 Unclassified 1665
211 Ga0207646_10277282 3300025922 Bacteria 1515
212 Ga0207681_10010796 3300025923 Bacteria 5608
213 Ga0207694_10014134 3300025924 Bacteria 6018
214 Ga0207687_10049958 3300025927 Unclassified 2910
215 Ga0207700_10029060 3300025928 Bacteria 3897
216 Ga0207700_10151210 3300025928 Unclassified 1918
217 Ga0207700_10201311 3300025928 Bacteria 1678
218 Ga0207700_10249358 3300025928 Unclassified 1516
219 Ga0207700_10315916 3300025928 Unclassified 1353
220 Ga0207690_10553578 3300025932 Bacteria 935
221 Ga0207706_10000556 3300025933 Bacteria 39738
222 Ga0207686_10181927 3300025934 Unclassified 1491
223 Ga0207686_10408232 3300025934 Bacteria 1036
224 Ga0207709_10622049 3300025935 Bacteria 857
225 Ga0207670_10058705 3300025936 Unclassified 2614
226 Ga0207704_10079125 3300025938 Unclassified 2117
227 Ga0207704_10411878 3300025938 Unclassified 1069
228 Ga0207665_10000088 3300025939 Bacteria 60223
229 Ga0207665_10007938 3300025939 Bacteria 7007
230 Ga0207665_10026156 3300025939 Unclassified 3851
231 Ga0207665_10041643 3300025939 Bacteria 3068
232 Ga0207665_10063639 3300025939 Bacteria 2506
233 Ga0207665_10156629 3300025939 Bacteria 1635
234 Ga0207665_10241105 3300025939 Bacteria 1332
235 Ga0207711_10000974 3300025941 Bacteria 27428
236 Ga0207661_10170855 3300025944 Unclassified 1892
237 Ga0207667_10016379 3300025949 Bacteria 8379
238 Ga0207712_10004905 3300025961 Bacteria 8460
239 Ga0207640_10056035 3300025981 Unclassified 2585
240 Ga0207658_10230730 3300025986 Unclassified 1562
241 Ga0207658_10709148 3300025986 Unclassified 910
242 Ga0207703_10722205 3300026035 Bacteria 948
243 Ga0207639_10006217 3300026041 Bacteria 8111
244 Ga0207678_10000277 3300026067 Bacteria 46368
245 Ga0207708_10427646 3300026075 Unclassified 1099
246 Ga0207702_10001579 3300026078 Bacteria 22561
247 Ga0207648_10024847 3300026089 Bacteria 5343
248 Ga0207674_10025857 3300026116 Bacteria 6249
249 Ga0207675_100013835 3300026118 Bacteria 7524
250 Ga0207683_10051946 3300026121 Unclassified 3592
251 Ga0207698_10158749 3300026142 Unclassified 1974
252 Ga0209179_1005469 3300027512 Bacteria 1990
253 Ga0209179_1030829 3300027512 Unclassified 1097
254 Ga0209588_1001945 3300027671 Bacteria 5532
255 Ga0209588_1003963 3300027671 Bacteria 4141
256 Ga0265354_1001032 3300028016 Bacteria 4334
257 Ga0265356_1000228 3300028017 Bacteria 10595
258 Ga0265357_1001474 3300028023 Bacteria 1737
259 Ga0265355_1008698 3300028036 Unclassified 815
260 Ga0268265_10027986 3300028380 Unclassified 4032
261 Ga0268264_10350508 3300028381 Bacteria 1405
262 Ga0268264_10526564 3300028381 Bacteria 1156
263 Ga0265338_10016375 3300028800 Bacteria 8074
264 Ga0265762_1002032 3300030760 Bacteria 3690
265 Ga0265762_1014552 3300030760 Bacteria 1421
266 Ga0265775_103370 3300030762 Unclassified 862
267 Ga0265760_10000040 3300031090 Bacteria 38912
268 Ga0265760_10000334 3300031090 Bacteria 13188
269 Ga0265760_10000767 3300031090 Bacteria 9208
270 Ga0265760_10001397 3300031090 Bacteria 7093
271 Ga0265760_10008887 3300031090 Bacteria 2870
272 Ga0265760_10100905 3300031090 Unclassified 912
273 Ga0316214_1024017 3300033545 Unclassified 857
274 Ga0316212_1000397 3300033547 Bacteria 5222
275 Ga0373930_0036347 3300034816 Bacteria 1033
276 Ga0373948_0035638 3300034817 Bacteria 1022
277 Ga0373934_0024934 3300035086 Bacteria 2314
278 Ga0373954_0168993 3300035118 Unclassified 1070
279 Ga0373957_0023842 3300035120 Bacteria 2192
280 Ga0373957_0026649 3300035120 Bacteria 2093
281 Ga0373955_0032308 3300035172 Bacteria 2746
282 Ga0373955_0042321 3300035172 Bacteria 2445
283 Ga0373942_0038260 3300035207 Bacteria 1300
284 Ga0373961_0010139 3300035241 Bacteria 2319
285 Ga0373962_0040546 3300035242 Bacteria 1310
286 Ga0373931_0027327 3300035691 Bacteria 2912
287 Ga0373931_0122480 3300035691 Bacteria 1488
288 Ga0373933_0001531 3300035724 Bacteria 13503
289 Ga0373933_0005536 3300035724 Bacteria 6880
290 Ga0373947_0270800 3300035725 Unclassified 1127
291 Ga0373937_0000001 3300036401 Bacteria 478903
292 Ga0373937_0000025 3300036401 Bacteria 125685
293 Ga0373937_0105346 3300036401 Bacteria 2620
294 Ga0373937_0256730 3300036401 Bacteria 1648
295 Ga0373925_0003174 3300037068 Bacteria 12856
296 Ga0373925_0123402 3300037068 Bacteria 2013
297 Ga0242420_000688 3300038996 Bacteria 4016
298 Ga0453683_0007320 3300044673 Bacteria 7505
299 Ga0453684_0040322 3300044712 Bacteria 6343
300 Ga0451576_0068274 3300045051 Bacteria 3699
301 Ga0451576_0622058 3300045051 Bacteria 1135
302 Ga0495592_0191700 3300046454 Unclassified 1385
303 Ga0495651_0006265 3300046462 Bacteria 9099
304 Ga0495651_0022945 3300046462 Bacteria 4853
305 Ga0495651_0137649 3300046462 Bacteria 1775
306 Ga0495580_0003281 3300046472 Bacteria 13830
307 Ga0495580_0004367 3300046472 Bacteria 11872
308 Ga0495580_0010427 3300046472 Bacteria 7242
309 Ga0495580_0027204 3300046472 Bacteria 4162
310 Ga0495580_0040037 3300046472 Bacteria 3351
311 Ga0495580_0058253 3300046472 Bacteria 2717
312 Ga0495582_0004941 3300046473 Bacteria 7474
313 Ga0495594_0066302 3300046499 Unclassified 2003
314 Ga0495628_0020349 3300046516 Bacteria 5476
315 Ga0495587_0000344 3300046536 Bacteria 33147
316 Ga0495587_0022487 3300046536 Bacteria 3882
317 Ga0495587_0060057 3300046536 Bacteria 2230
318 Ga0495587_0249402 3300046536 Bacteria 998
319 Ga0495667_0067035 3300046559 Bacteria 2346
320 Ga0495599_0367646 3300046678 Unclassified 860
321 Ga0495623_0012076 3300046679 Bacteria 5594
322 Ga0495623_0071632 3300046679 Bacteria 2156
323 Ga0495658_0024575 3300046683 Unclassified 3211
324 Ga0495604_0150440 3300047317 Bacteria 1654
325 Ga0495604_0225141 3300047317 Unclassified 1289
326 Ga0495674_0123338 3300047319 Unclassified 2188
327 Ga0495674_0431836 3300047319 Unclassified 1060
328 Ga0495675_0011835 3300047444 Bacteria 5483
329 Ga0495675_0041849 3300047444 Bacteria 2919
330 Ga0495684_0001952 3300047471 Bacteria 16555
331 Ga0495602_0000089 3300048088 Bacteria 89567
332 Ga0495602_0026245 3300048088 Bacteria 5621
333 Ga0496101_0186875 3300048904 Bacteria 1598
334 Ga0496102_0000662 3300048905 Bacteria 34346
335 Ga0496102_0169317 3300048905 Bacteria 2056
336 Ga0496103_0003783 3300048906 Bacteria 9205
337 Ga0496103_0041754 3300048906 Unclassified 2820
338 Ga0496104_0034476 3300048907 Bacteria 4720
339 Ga0496104_0170210 3300048907 Unclassified 2089
340 Ga0496106_0188219 3300048909 Bacteria 1640
341 Ga0496106_0240184 3300048909 Unclassified 1447
342 Ga0496109_0226355 3300048912 Unclassified 1759
343 Ga0496110_0044107 3300048913 Unclassified 3894
344 Ga0496112_0014273 3300048915 Bacteria 7361
345 Ga0496113_0258071 3300048916 Unclassified 1392
346 nmdc:mga0n895_134865_c1 3300050512 Bacteria 2495
347 nmdc:mga08x19_18184_c1 3300050514 Unclassified 4306
348 Ga0495612_0048632 3300053078 Unclassified 1739
349 Ga0495602_0192599
350 Ga0065712_10007698
351 Ga0065715_10112661
352 Ga0065715_10260249
353 Ga0070658_10293742
354 Ga0070683_100080041
355 Ga0070690_100038272
356 Ga0070666_10053115
357 Ga0070680_100434570
358 Ga0070682_100064664
359 Ga0068868_100039764
360 Ga0070660_100174932
361 Ga0070689_100075505
362 Ga0070661_100124272
363 Ga0070668_100008296
364 Ga0070659_100088703
365 Ga0070667_100004275
366 Ga0070703_10001058
367 Ga0070709_10007213
368 Ga0070709_10007431
369 Ga0070709_10070037
370 Ga0070709_10092264
371 Ga0070709_10128009
372 Ga0070709_10209608
373 Ga0070714_100142658
374 Ga0070714_100163528
375 Ga0070714_100164202
376 Ga0070714_100803740
377 Ga0070713_100004391
378 Ga0070713_100010630
379 Ga0070713_100022127
380 Ga0070713_100086521
381 Ga0070713_100108477
382 Ga0070713_100172738
383 Ga0070713_100357358
384 Ga0070710_10085736
385 Ga0070711_100004628
386 Ga0070711_100013451
387 Ga0070711_100052601
388 Ga0070711_100220700
389 Ga0070711_100319713
390 Ga0070705_100077638
391 Ga0070705_100316936
392 Ga0070694_100007567
393 Ga0070708_100007685
394 Ga0070708_100019095
395 Ga0070708_100050595
396 Ga0070708_100116579
397 Ga0070708_100194772
398 Ga0070708_100433443
399 Ga0070662_100000369
400 Ga0070681_10045016
401 Ga0070681_10058110
402 Ga0070706_100014246
403 Ga0070706_100134581
404 Ga0070707_100075459
405 Ga0070707_100170838
406 Ga0070707_100213478
407 Ga0070707_100319322
408 Ga0070707_100380404
409 Ga0070698_100086187
410 Ga0070698_100477257
411 Ga0070699_100001772
412 Ga0070699_100035748
413 Ga0070699_100044192
414 Ga0070699_100145252
415 Ga0070699_100213751
416 Ga0070699_100223163
417 Ga0070699_100306324
418 Ga0070679_100012575
419 Ga0070684_100024582
420 Ga0070697_100000661
421 Ga0070697_100001813
422 Ga0070697_100051844
423 Ga0070697_100107304
424 Ga0070697_100184073
425 Ga0070697_100420404
426 Ga0068853_100012414
427 Ga0070672_100175449
428 Ga0070686_100040881
429 Ga0070695_100006664
430 Ga0070695_100106942
431 Ga0070696_100027253
432 Ga0070693_100002141
433 Ga0070693_100124794
434 Ga0070693_100154142
435 Ga0068855_100290540
436 Ga0070664_100202821
437 Ga0068857_100204333
438 Ga0068854_100016072
439 Ga0068856_100013375
440 Ga0068856_101041641
441 Ga0070702_100161662
442 Ga0068852_100051003
443 Ga0068859_100011100
444 Ga0068864_100099017
445 Ga0068866_10089031
446 Ga0068851_10003957
447 Ga0068858_100019764
448 Ga0068860_100078871
449 Ga0068862_100017582
450 Ga0070717_10016286
451 Ga0070717_10044193
452 Ga0070717_10046783
453 Ga0070717_10174157
454 Ga0070717_10491150
455 Ga0070715_10022779
456 Ga0070715_10114989
457 Ga0070715_10206153
458 Ga0070716_100000092
459 Ga0070716_100007299
460 Ga0070716_100012470
461 Ga0070716_100073180
462 Ga0070716_100159618
463 Ga0070716_100209847
464 Ga0070716_100289182
465 Ga0070712_100000044
466 Ga0070712_100029654
467 Ga0070712_100031380
468 Ga0070712_100042419
469 Ga0070712_100060966
470 Ga0070712_100552185
471 Ga0097621_100024203
472 Ga0097621_100755515
473 Ga0075434_100240793
474 Ga0068865_100143595
475 Ga0097620_100011100
476 Ga0099794_10000577
477 Ga0099795_10061909
478 Ga0105250_10083670
479 Ga0105240_10154408
480 Ga0105245_10063621
481 Ga0105247_10005325
482 Ga0105243_10100598
483 Ga0105241_10459024
484 Ga0105241_10758235
485 Ga0105242_10012986
486 Ga0105248_10009200
487 Ga0105237_10200067
488 Ga0105237_10464038
489 Ga0105238_10019502
490 Ga0105249_10001488
491 Ga0099796_10039346
492 Ga0099796_10148316
493 Ga0105239_10576813
494 Ga0105246_10089112
495 Ga0157373_10306379
496 Ga0157371_10024119
497 Ga0157370_10073022
498 Ga0157369_10097826
499 Ga0157374_10008001
500 Ga0157374_10912388
501 Ga0157378_10064121
502 Ga0157378_10080363
503 Ga0163162_10005421
504 Ga0157372_10246213
505 Ga0157372_10581947
506 Ga0157375_10088350
507 Ga0157379_10002367
508 Ga0157379_10129546
509 Ga0157376_10033200
510 Ga0224569_100797
511 Ga0224569_100872
512 Ga0224569_101357
513 Ga0224569_101738
514 Ga0224572_1020311
515 Ga0228598_1000033
516 Ga0228598_1000901
517 Ga0228598_1002046
518 Ga0228598_1003439
519 Ga0228598_1012844
520 Ga0228598_1028282
521 Ga0228598_1046732
522 Ga0207656_10195564
523 Ga0207653_10001643
524 Ga0207642_10068296
525 Ga0207680_10091039
526 Ga0207647_10112472
527 Ga0207685_10090432
528 Ga0207685_10208040
529 Ga0207699_10005129
530 Ga0207699_10021544
531 Ga0207699_10023192
532 Ga0207699_10158446
533 Ga0207699_10371488
534 Ga0207684_10009869
535 Ga0207684_10058265
536 Ga0207654_10060200
537 Ga0207707_10166250
538 Ga0207707_10337709
539 Ga0207695_10025665
540 Ga0207695_10035661
541 Ga0207671_10121012
542 Ga0207671_10517951
543 Ga0207693_10000230
544 Ga0207693_10004203
545 Ga0207693_10021480
546 Ga0207693_10021520
547 Ga0207693_10044769
548 Ga0207693_10206985
549 Ga0207693_10378751
550 Ga0207663_10003064
551 Ga0207663_10003748
552 Ga0207663_10036141
553 Ga0207660_10455953
554 Ga0207657_10026906
555 Ga0207652_10294678
556 Ga0207646_10078858
557 Ga0207646_10213591
558 Ga0207646_10232591
559 Ga0207646_10277282
560 Ga0207681_10010796
561 Ga0207694_10014134
562 Ga0207687_10049958
563 Ga0207700_10029060
564 Ga0207700_10151210
565 Ga0207700_10201311
566 Ga0207700_10249358
567 Ga0207700_10315916
568 Ga0207690_10553578
569 Ga0207706_10000556
570 Ga0207686_10181927
571 Ga0207686_10408232
572 Ga0207709_10622049
573 Ga0207670_10058705
574 Ga0207704_10079125
575 Ga0207704_10411878
576 Ga0207665_10000088
577 Ga0207665_10007938
578 Ga0207665_10026156
579 Ga0207665_10041643
580 Ga0207665_10063639
581 Ga0207665_10156629
582 Ga0207665_10241105
583 Ga0207711_10000974
584 Ga0207661_10170855
585 Ga0207667_10016379
586 Ga0207712_10004905
587 Ga0207640_10056035
588 Ga0207658_10230730
589 Ga0207658_10709148
590 Ga0207703_10722205
591 Ga0207639_10006217
592 Ga0207678_10000277
593 Ga0207708_10427646
594 Ga0207702_10001579
595 Ga0207648_10024847
596 Ga0207674_10025857
597 Ga0207675_100013835
598 Ga0207683_10051946
599 Ga0207698_10158749
600 Ga0209179_1005469
601 Ga0209179_1030829
602 Ga0209588_1001945
603 Ga0209588_1003963
604 Ga0265354_1001032
605 Ga0265356_1000228
606 Ga0265357_1001474
607 Ga0265355_1008698
608 Ga0268265_10027986
609 Ga0268264_10350508
610 Ga0268264_10526564
611 Ga0265338_10016375
612 Ga0265762_1002032
613 Ga0265762_1014552
614 Ga0265775_103370
615 Ga0265760_10000040
616 Ga0265760_10000334
617 Ga0265760_10000767
618 Ga0265760_10001397
619 Ga0265760_10008887
620 Ga0265760_10100905
621 Ga0316214_1024017
622 Ga0316212_1000397
623 Ga0373930_0036347
624 Ga0373948_0035638
625 Ga0373934_0024934
626 Ga0373954_0168993
627 Ga0373957_0023842
628 Ga0373957_0026649
629 Ga0373955_0032308
630 Ga0373955_0042321
631 Ga0373942_0038260
632 Ga0373961_0010139
633 Ga0373962_0040546
634 Ga0373931_0027327
635 Ga0373931_0122480
636 Ga0373933_0001531
637 Ga0373933_0005536
638 Ga0373947_0270800
639 Ga0373937_0000001
640 Ga0373937_0000025
641 Ga0373937_0105346
642 Ga0373937_0256730
643 Ga0373925_0003174
644 Ga0373925_0123402
645 Ga0242420_000688
646 Ga0453683_0007320
647 Ga0453684_0040322
648 Ga0451576_0068274
649 Ga0451576_0622058
650 Ga0495592_0191700
651 Ga0495651_0006265
652 Ga0495651_0022945
653 Ga0495651_0137649
654 Ga0495580_0003281
655 Ga0495580_0004367
656 Ga0495580_0010427
657 Ga0495580_0027204
658 Ga0495580_0040037
659 Ga0495580_0058253
660 Ga0495582_0004941
661 Ga0495594_0066302
662 Ga0495628_0020349
663 Ga0495587_0000344
664 Ga0495587_0022487
665 Ga0495587_0060057
666 Ga0495587_0249402
667 Ga0495667_0067035
668 Ga0495599_0367646
669 Ga0495623_0012076
670 Ga0495623_0071632
671 Ga0495658_0024575
672 Ga0495604_0150440
673 Ga0495604_0225141
674 Ga0495674_0123338
675 Ga0495674_0431836
676 Ga0495675_0011835
677 Ga0495675_0041849
678 Ga0495684_0001952
679 Ga0495602_0000089
680 Ga0495602_0026245
681 Ga0496101_0186875
682 Ga0496102_0000662
683 Ga0496102_0169317
684 Ga0496103_0003783
685 Ga0496103_0041754
686 Ga0496104_0034476
687 Ga0496104_0170210
688 Ga0496106_0188219
689 Ga0496106_0240184
690 Ga0496109_0226355
691 Ga0496110_0044107
692 Ga0496112_0014273
693 Ga0496113_0258071
694 nmdc:mga0n895_134865_c1
695 nmdc:mga08x19_18184_c1
696 Ga0495612_0048632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

187

254

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tj6-assembly1.cif.gz_A sthk open state, camp-bound in the presence of popa 0.8688 31 144
4d7s-assembly1.cif.gz_A structure of the sthk carboxy-terminal region in complex with cgmp 0.8686 31 144
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.8602 163 224
2ptm-assembly1.cif.gz_A structure and rearrangements in the carboxy-terminal region of spih channels 0.8522 23 144
6rsx-assembly1.cif.gz_A regulatory subunit of camp-dependant protein kinase a from euglena gracilis at 1.6 a resolution 0.8504 27 135
ID Description Score Start End Superfamily
3dv8A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9517 161 231 1.10.10.10
4n9iD02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9368 181 222 1.10.10.10
4n9iC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9366 181 222 1.10.10.10
3iwzA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9311 161 222 1.10.10.10
4ev0D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9206 160 232 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W8UNR8-F1-model_v4 CRP-like cAMP-binding protein 0.9684 22 135
AF-A0A242M9L9-F1-model_v4 cAMP-dependent protein kinase 0.9608 23 246 GO:0003677
GO:0003700
GO:0005829
GO:0016301
AF-A0A022GEY2-F1-model_v4 Crp/Fnr family transcriptional regulator 0.9575 24 246 GO:0003677
GO:0003700
GO:0005829
AF-A0A4Q3JXK2-F1-model_v4 deleted 0.9562 120 246
AF-V7ER79-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9559 30 129

Map