F418006

General Info

Members Datasets Scaffolds Average Seq Length
349 186 339 230

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0098462|Ga0495649_0098462_663_1352
Length 211
Sequence MDIKVIAFDADDTLWVNEPYFQNTEKKFCSLLEEFLPEQDLSRELLKIEIENLALYGYGIKGYILSMIETALKVTDNTITNEAIERIIGYGKELLNEPIELLDNVEEVLKALQGHYRIVVATKFHHIEIMSEKGEEDYLKLIRHLDILPEEFMMIGNSLKSDVIPVLNIGGHAIHVPYHTTWAHEHVETTLEHENFRHVERLEEVLGLILQ

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
6 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
153 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
168 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
177 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
185 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
186 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0
Isolates 2.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0
Rhizoplane 0.86
Rhizosphere 85.67
Stem 0
Stem Tuber 0
Unclassified 6.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009937 3300001904 Bacteria 1561
2 JGI24740J21852_10029816 3300001979 Bacteria 1786
3 JGI24740J21852_10039468 3300001979 Bacteria 1440
4 JGI24737J22298_10000078 3300001990 Bacteria 28797
5 JGI24737J22298_10093237 3300001990 Bacteria 893
6 JGI24735J21928_10000050 3300002067 Bacteria 50872
7 JGI24735J21928_10019866 3300002067 Bacteria 2062
8 JGI25162J39368_1000062 3300002737 Bacteria 135587
9 JGI25162J39368_1000733 3300002737 Bacteria 22513
10 JGI25165J46597_1001666 3300003214 Bacteria 10117
11 rootH1_10018511 3300003316 Bacteria 4901
12 rootH2_10001274 3300003320 Bacteria 94480
13 rootL2_10047782 3300003322 Bacteria 3702
14 rootL2_10083044 3300003322 Bacteria 1956
15 rootH1_10005306 3300003323 Bacteria 8521
16 rootH1_10009847 3300003323 Bacteria 10778
17 rootH1_10244779 3300003323 Bacteria 3083
18 Ga0065714_10009821 3300005288 Bacteria 3291
19 Ga0070658_10001195 3300005327 Bacteria 22221
20 Ga0070658_10077338 3300005327 Bacteria 2729
21 Ga0070676_10000058 3300005328 Bacteria 36261
22 Ga0070676_10007742 3300005328 Bacteria 5768
23 Ga0070683_100308415 3300005329 Unclassified 1506
24 Ga0070683_100313696 3300005329 Bacteria 1492
25 Ga0070670_100138484 3300005331 Unclassified 2104
26 Ga0068869_100015199 3300005334 Bacteria 5157
27 Ga0068869_100074081 3300005334 Unclassified 2526
28 Ga0070666_10019429 3300005335 Bacteria 4385
29 Ga0070666_10204988 3300005335 Unclassified 1388
30 Ga0068868_100018320 3300005338 Bacteria 5233
31 Ga0070660_100295654 3300005339 Unclassified 1327
32 Ga0070668_100019749 3300005347 Bacteria 5074
33 Ga0070675_100045260 3300005354 Bacteria 3601
34 Ga0070675_100655815 3300005354 Bacteria 954
35 Ga0070671_100018776 3300005355 Bacteria 5620
36 Ga0070674_100142291 3300005356 Bacteria 1801
37 Ga0070673_100008345 3300005364 Bacteria 6881
38 Ga0070673_100036435 3300005364 Bacteria 3739
39 Ga0070673_100460208 3300005364 Bacteria 1145
40 Ga0070659_100031944 3300005366 Bacteria 4081
41 Ga0070667_100159338 3300005367 Bacteria 1987
42 Ga0070667_100180177 3300005367 Bacteria 1868
43 Ga0070678_100007159 3300005456 Bacteria 6597
44 Ga0070678_100052538 3300005456 Bacteria 2960
45 Ga0070662_100000055 3300005457 Bacteria 60567
46 Ga0070662_100037138 3300005457 Unclassified 3452
47 Ga0070662_100070270 3300005457 Bacteria 2579
48 Ga0068867_100027243 3300005459 Bacteria 4106
49 Ga0070685_10076676 3300005466 Bacteria 1994
50 Ga0068853_100007508 3300005539 Bacteria 8726
51 Ga0068853_100041576 3300005539 Bacteria 3927
52 Ga0068853_100097455 3300005539 Bacteria 2596
53 Ga0068853_100183017 3300005539 Bacteria 1901
54 Ga0070672_100004660 3300005543 Bacteria 8991
55 Ga0070665_100000034 3300005548 Bacteria 324289
56 Ga0070665_100011887 3300005548 Bacteria 8791
57 Ga0068855_100000122 3300005563 Bacteria 97622
58 Ga0068855_100001132 3300005563 Bacteria 33103
59 Ga0068855_100007517 3300005563 Bacteria 13191
60 Ga0068855_100016135 3300005563 Bacteria 8982
61 Ga0068855_100047210 3300005563 Bacteria 5088
62 Ga0068855_100127781 3300005563 Bacteria 2905
63 Ga0068855_100164631 3300005563 Bacteria 2515
64 Ga0068855_100940695 3300005563 Bacteria 911
65 Ga0070664_100169691 3300005564 Unclassified 1935
66 Ga0068857_100057018 3300005577 Bacteria 3467
67 Ga0068857_100116503 3300005577 Bacteria 2404
68 Ga0068857_101213941 3300005577 Bacteria 730
69 Ga0068854_100129572 3300005578 Bacteria 1925
70 Ga0068854_100245910 3300005578 Unclassified 1426
71 Ga0068856_100018522 3300005614 Bacteria 6748
72 Ga0068856_100056912 3300005614 Bacteria 3860
73 Ga0068852_100003135 3300005616 Bacteria 11516
74 Ga0068859_100290289 3300005617 Bacteria 1729
75 Ga0068866_10026258 3300005718 Bacteria 2748
76 Ga0068861_100005802 3300005719 Bacteria 8381
77 Ga0068861_100048778 3300005719 Bacteria 3203
78 Ga0068870_10010474 3300005840 Bacteria 4265
79 Ga0068870_10029664 3300005840 Bacteria 2757
80 Ga0068863_100029768 3300005841 Bacteria 5213
81 Ga0068858_100112683 3300005842 Bacteria 2540
82 Ga0075366_10000392 3300006195 Bacteria 20343
83 Ga0075366_10000653 3300006195 Bacteria 16326
84 Ga0075366_10003359 3300006195 Bacteria 8424
85 Ga0097621_100001503 3300006237 Bacteria 15966
86 Ga0097621_100052072 3300006237 Bacteria 3334
87 Ga0097621_100086734 3300006237 Unclassified 2613
88 Ga0097621_100145460 3300006237 Bacteria 2029
89 Ga0097621_100188718 3300006237 Bacteria 1784
90 Ga0075370_10076888 3300006353 Bacteria 1915
91 Ga0068871_100000099 3300006358 Bacteria 51278
92 Ga0068871_100004512 3300006358 Bacteria 9700
93 Ga0068871_100074709 3300006358 Bacteria 2797
94 Ga0068871_100095270 3300006358 Unclassified 2486
95 Ga0068871_100282266 3300006358 Bacteria 1453
96 Ga0068865_100000055 3300006881 Bacteria 62584
97 Ga0068865_100003508 3300006881 Bacteria 9402
98 Ga0068865_100185620 3300006881 Bacteria 1604
99 Ga0097620_100290291 3300006931 Bacteria 1729
100 Ga0105251_10036484 3300009011 Unclassified 2418
101 Ga0105240_10004347 3300009093 Bacteria 21631
102 Ga0105240_10018298 3300009093 Bacteria 9417
103 Ga0105240_10024342 3300009093 Bacteria 7984
104 Ga0105240_10094566 3300009093 Bacteria 3644
105 Ga0105245_10246931 3300009098 Bacteria 1733
106 Ga0105241_10017740 3300009174 Bacteria 5234
107 Ga0105241_10078973 3300009174 Bacteria 2572
108 Ga0105242_10012932 3300009176 Bacteria 6435
109 Ga0105248_10220495 3300009177 Unclassified 2135
110 Ga0105237_10001160 3300009545 Bacteria 35249
111 Ga0105237_10012114 3300009545 Bacteria 9102
112 Ga0105237_10013650 3300009545 Bacteria 8507
113 Ga0105237_10014787 3300009545 Bacteria 8144
114 Ga0105237_10115874 3300009545 Unclassified 2673
115 Ga0105238_10005104 3300009551 Bacteria 12980
116 Ga0105238_10035466 3300009551 Bacteria 5071
117 Ga0105249_10116291 3300009553 Bacteria 2535
118 Ga0105249_10692296 3300009553 Bacteria 1079
119 Ga0105239_10000002 3300010375 Bacteria 610298
120 Ga0105239_10000006 3300010375 Bacteria 442319
121 Ga0105239_10002817 3300010375 Bacteria 21748
122 Ga0105239_10003056 3300010375 Bacteria 20800
123 Ga0105239_10003325 3300010375 Bacteria 19787
124 Ga0105239_10095505 3300010375 Bacteria 3284
125 Ga0105239_10611722 3300010375 Bacteria 1243
126 Ga0105239_10667489 3300010375 Bacteria 1188
127 Ga0105246_10024473 3300011119 Bacteria 3924
128 Ga0157373_10000037 3300013100 Bacteria 121670
129 Ga0157373_10001486 3300013100 Bacteria 17867
130 Ga0157371_10000141 3300013102 Bacteria 104396
131 Ga0157371_10007182 3300013102 Bacteria 9048
132 Ga0157371_10304519 3300013102 Bacteria 1154
133 Ga0157370_10072690 3300013104 Bacteria 3245
134 Ga0157370_10341994 3300013104 Bacteria 1379
135 Ga0157370_10573573 3300013104 Bacteria 1034
136 Ga0157369_10070795 3300013105 Bacteria 3746
137 Ga0157374_10000051 3300013296 Bacteria 126876
138 Ga0157374_10012812 3300013296 Bacteria 7303
139 Ga0157374_10014360 3300013296 Bacteria 6931
140 Ga0157374_10017459 3300013296 Bacteria 6319
141 Ga0157374_10074279 3300013296 Unclassified 3210
142 Ga0157374_10263460 3300013296 Bacteria 1698
143 Ga0157378_10108928 3300013297 Bacteria 2537
144 Ga0157378_10285849 3300013297 Bacteria 1591
145 Ga0157378_10323263 3300013297 Bacteria 1499
146 Ga0163162_10000018 3300013306 Bacteria 226257
147 Ga0163162_10001999 3300013306 Bacteria 19184
148 Ga0163162_10014095 3300013306 Bacteria 7813
149 Ga0163162_10256901 3300013306 Bacteria 1879
150 Ga0157372_10000418 3300013307 Bacteria 46635
151 Ga0157372_10002874 3300013307 Bacteria 18616
152 Ga0157372_10005186 3300013307 Bacteria 13851
153 Ga0157372_10043718 3300013307 Bacteria 4961
154 Ga0157372_10057282 3300013307 Bacteria 4356
155 Ga0157372_10368162 3300013307 Bacteria 1674
156 Ga0157372_10660852 3300013307 Bacteria 1217
157 Ga0157375_10006776 3300013308 Bacteria 9979
158 Ga0157375_10493075 3300013308 Bacteria 1389
159 Ga0157377_10270202 3300014745 Bacteria 1110
160 Ga0157376_10011884 3300014969 Bacteria 6437
161 Ga0157376_10099623 3300014969 Bacteria 2536
162 Ga0157376_10293076 3300014969 Bacteria 1537
163 Ga0157376_10317251 3300014969 Bacteria 1481
164 Ga0163161_10068336 3300017792 Unclassified 2596
165 Ga0163161_10152414 3300017792 Bacteria 1758
166 Ga0213872_10075469 3300021361 Bacteria 1517
167 Ga0209563_109440 3300025230 Bacteria 1473
168 Ga0207427_100090 3300025231 Bacteria 133759
169 Ga0209437_100034 3300025233 Bacteria 494007
170 Ga0209437_100177 3300025233 Bacteria 135759
171 Ga0209026_1000316 3300025250 Bacteria 51844
172 Ga0209026_1001032 3300025250 Bacteria 13689
173 Ga0209233_1000038 3300025261 Bacteria 548972
174 Ga0209233_1001836 3300025261 Bacteria 8150
175 Ga0207656_10228124 3300025321 Unclassified 907
176 Ga0207710_10055340 3300025900 Bacteria 1788
177 Ga0207647_10000405 3300025904 Bacteria 35306
178 Ga0207647_10009160 3300025904 Bacteria 7042
179 Ga0207647_10094194 3300025904 Bacteria 1784
180 Ga0207645_10000046 3300025907 Bacteria 85043
181 Ga0207645_10000219 3300025907 Bacteria 47364
182 Ga0207643_10246289 3300025908 Bacteria 1100
183 Ga0207705_10000457 3300025909 Bacteria 35062
184 Ga0207654_10014229 3300025911 Bacteria 4108
185 Ga0207654_10119946 3300025911 Bacteria 1650
186 Ga0207654_10259230 3300025911 Bacteria 1168
187 Ga0207695_10034279 3300025913 Bacteria 5524
188 Ga0207695_10049377 3300025913 Bacteria 4436
189 Ga0207695_10076552 3300025913 Bacteria 3401
190 Ga0207695_10084167 3300025913 Bacteria 3211
191 Ga0207695_10093301 3300025913 Bacteria 3019
192 Ga0207671_10001003 3300025914 Bacteria 34695
193 Ga0207671_10008874 3300025914 Bacteria 8465
194 Ga0207671_10036864 3300025914 Bacteria 3626
195 Ga0207671_10045776 3300025914 Bacteria 3236
196 Ga0207671_10083798 3300025914 Bacteria 2394
197 Ga0207657_10091730 3300025919 Bacteria 2532
198 Ga0207657_10116623 3300025919 Bacteria 2200
199 Ga0207650_10171144 3300025925 Bacteria 1726
200 Ga0207659_10123758 3300025926 Bacteria 1985
201 Ga0207687_10323675 3300025927 Bacteria 1249
202 Ga0207644_10014000 3300025931 Bacteria 5362
203 Ga0207690_10011580 3300025932 Bacteria 5269
204 Ga0207690_10231988 3300025932 Bacteria 1417
205 Ga0207706_10000123 3300025933 Bacteria 83810
206 Ga0207706_10047879 3300025933 Unclassified 3782
207 Ga0207706_10089187 3300025933 Bacteria 2711
208 Ga0207686_10140555 3300025934 Bacteria 1668
209 Ga0207669_10017882 3300025937 Bacteria 3649
210 Ga0207704_10000058 3300025938 Bacteria 77010
211 Ga0207704_10005864 3300025938 Bacteria 5686
212 Ga0207704_10136433 3300025938 Bacteria 1709
213 Ga0207704_10255659 3300025938 Bacteria 1318
214 Ga0207691_10019389 3300025940 Bacteria 6437
215 Ga0207689_10001199 3300025942 Bacteria 24909
216 Ga0207689_10026945 3300025942 Bacteria 4811
217 Ga0207661_10005102 3300025944 Bacteria 9218
218 Ga0207661_10200104 3300025944 Unclassified 1756
219 Ga0207679_10155425 3300025945 Unclassified 1867
220 Ga0207667_10000020 3300025949 Bacteria 374770
221 Ga0207667_10000993 3300025949 Bacteria 36313
222 Ga0207667_10039885 3300025949 Bacteria 5001
223 Ga0207667_10258255 3300025949 Bacteria 1782
224 Ga0207651_10070119 3300025960 Bacteria 2478
225 Ga0207651_10246135 3300025960 Bacteria 1460
226 Ga0207712_10039961 3300025961 Bacteria 3217
227 Ga0207668_10074568 3300025972 Bacteria 2436
228 Ga0207668_10234414 3300025972 Bacteria 1481
229 Ga0207640_10158863 3300025981 Bacteria 1670
230 Ga0207640_10211469 3300025981 Unclassified 1478
231 Ga0207658_10187576 3300025986 Bacteria 1716
232 Ga0207703_10176179 3300026035 Unclassified 1884
233 Ga0207639_10014121 3300026041 Bacteria 5607
234 Ga0207639_10033863 3300026041 Bacteria 3772
235 Ga0207639_10090478 3300026041 Bacteria 2448
236 Ga0207639_10341645 3300026041 Bacteria 1335
237 Ga0207678_10201246 3300026067 Bacteria 1703
238 Ga0207702_10013672 3300026078 Bacteria 6742
239 Ga0207702_10094254 3300026078 Bacteria 2627
240 Ga0207702_10163569 3300026078 Bacteria 2034
241 Ga0207648_10002523 3300026089 Bacteria 19646
242 Ga0207648_10003611 3300026089 Bacteria 16173
243 Ga0207674_10315143 3300026116 Bacteria 1513
244 Ga0207675_100006970 3300026118 Bacteria 10691
245 Ga0207675_100026719 3300026118 Bacteria 5373
246 Ga0207683_10000730 3300026121 Bacteria 29877
247 Ga0207683_10078334 3300026121 Bacteria 2928
248 Ga0207698_10009189 3300026142 Bacteria 6287
249 Ga0207698_10020022 3300026142 Bacteria 4596
250 Ga0268266_10000111 3300028379 Bacteria 169743
251 Ga0268266_10300821 3300028379 Bacteria 1496
252 Ga0268264_11291980 3300028381 Unclassified 740
253 Ga0307517_10008073 3300028786 Bacteria 15174
254 Ga0307515_10000002 3300028794 Bacteria 1231751
255 Ga0307515_10000007 3300028794 Bacteria 719669
256 Ga0307515_10000794 3300028794 Bacteria 72827
257 Ga0307515_10002207 3300028794 Bacteria 42742
258 Ga0307514_10122891 3300031649 Bacteria 1806
259 Ga0307507_10000010 3300033179 Bacteria 265208
260 Ga0307510_10002664 3300033180 Bacteria 20420
261 Ga0395899_0000462 3300037312 Bacteria 46052
262 Ga0395899_0030919 3300037312 Bacteria 4026
263 Ga0395900_0000141 3300037418 Bacteria 121159
264 Ga0395900_0000155 3300037418 Bacteria 113606
265 Ga0395900_0007460 3300037418 Bacteria 11304
266 Ga0395898_0007157 3300037466 Bacteria 11847
267 Ga0395905_0000124 3300037471 Bacteria 126707
268 Ga0395905_0000496 3300037471 Bacteria 54071
269 Ga0395905_0162591 3300037471 Bacteria 2098
270 Ga0395901_0000138 3300038443 Bacteria 94944
271 Ga0395901_0010646 3300038443 Bacteria 9320
272 Ga0436361_1129343 3300039447 Bacteria 3795
273 Ga0439431_0005112 3300041997 Bacteria 2893
274 Ga0439448_0021382 3300042005 Bacteria 2006
275 Ga0451577_0325188 3300042876 Bacteria 1395
276 Ga0453683_0182398 3300044673 Bacteria 1331
277 Ga0453684_0101302 3300044712 Bacteria 3524
278 Ga0453684_0272190 3300044712 Bacteria 1935
279 Ga0451576_0007869 3300045051 Bacteria 12632
280 Ga0451576_0632284 3300045051 Bacteria 1125
281 Ga0495638_0136320 3300046460 Bacteria 1437
282 Ga0495651_0156898 3300046462 Bacteria 1635
283 Ga0495650_0000003 3300046471 Bacteria 900730
284 Ga0495650_0031979 3300046471 Bacteria 2359
285 Ga0495650_0065075 3300046471 Bacteria 1448
286 Ga0495650_0163163 3300046471 Bacteria 793
287 Ga0495585_0000079 3300046492 Bacteria 100159
288 Ga0495585_0000330 3300046492 Bacteria 46311
289 Ga0495596_0018227 3300046500 Bacteria 2896
290 Ga0495583_0135372 3300046506 Bacteria 1029
291 Ga0495606_0000163 3300046507 Bacteria 117268
292 Ga0495606_0007123 3300046507 Bacteria 10108
293 Ga0495606_0134317 3300046507 Unclassified 1467
294 Ga0495610_0001356 3300046512 Bacteria 21738
295 Ga0495616_0012051 3300046513 Bacteria 4921
296 Ga0495616_0086976 3300046513 Bacteria 1486
297 Ga0495631_0040003 3300046518 Bacteria 2078
298 Ga0495637_0045250 3300046520 Bacteria 1869
299 Ga0495644_0028992 3300046523 Bacteria 2093
300 Ga0495648_0007985 3300046524 Bacteria 8395
301 Ga0495633_0000044 3300046558 Bacteria 171185
302 Ga0495633_0014741 3300046558 Bacteria 4076
303 Ga0495668_0000044 3300046616 Bacteria 227585
304 Ga0495625_0000159 3300046660 Bacteria 104355
305 Ga0495625_0000900 3300046660 Bacteria 40074
306 Ga0495625_0001731 3300046660 Bacteria 25313
307 Ga0495625_0052513 3300046660 Bacteria 2918
308 Ga0495625_0063108 3300046660 Bacteria 2617
309 Ga0495625_0150792 3300046660 Bacteria 1563
310 Ga0495625_0178227 3300046660 Bacteria 1415
311 Ga0495625_0289326 3300046660 Bacteria 1052
312 Ga0495661_0004111 3300046665 Bacteria 10601
313 Ga0495661_0047570 3300046665 Bacteria 2611
314 Ga0495649_0000003 3300046694 Bacteria 880817
315 Ga0495649_0098462 3300046694 Bacteria 1556
316 Ga0495676_0262039 3300047321 Bacteria 1176
317 Ga0495687_001658 3300047443 Bacteria 19993
318 Ga0495687_031205 3300047443 Bacteria 2446
319 Ga0495673_0049982 3300047469 Bacteria 1838
320 Ga0495686_0000372 3300047472 Bacteria 72285
321 Ga0496105_0315688 3300048908 Unclassified 1254
322 Ga0496110_0017209 3300048913 Bacteria 6045
323 Ga0496116_0010362 3300048919 Bacteria 7826
324 Ga0496117_0000289 3300048920 Bacteria 90202
325 Ga0496122_0006957 3300048925 Bacteria 12743
326 Ga0495678_108023 3300049459 Bacteria 953
327 Ga0495682_0019819 3300049460 Bacteria 2527
328 nmdc:mga0k408_151_c2 3300050493 Bacteria 30883
329 nmdc:mga0k408_1790_c1 3300050493 Bacteria 11512
330 nmdc:mga0k408_75_c2 3300050493 Bacteria 16345
331 nmdc:mga07m45_75778_c1 3300050496 Bacteria 1917
332 Ga0500644_0167057 3300053088 Bacteria 893
333 Ga0500608_003428 3300053122 Bacteria 5942
334 Ga0500618_000001 3300053125 Bacteria 538477
335 Ga0500568_0151545 3300053139 Bacteria 858
336 Ga0500622_0000175 3300053156 Bacteria 69363
337 Ga0500624_000623 3300053157 Bacteria 9484
338 Ga0500634_0026862 3300053161 Bacteria 3135
339 Ga0500611_000011 3300053727 Bacteria 141259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0098462 Ga0495649_0098462_663_1352 209
2 3300041997 Ga0439431_0005112 Ga0439431_0005112_979_1623 212
3 3300053088 Ga0500644_0167057 Ga0500644_0167057_233_877 212
4 3300013307 Ga0157372_10043718 Ga0157372_100437183 219
5 3300025911 Ga0207654_10119946 Ga0207654_101199461 219
6 3300025932 Ga0207690_10231988 Ga0207690_102319881 219
7 iso_pu_bacteria 2599185184 2599478038 223
8 iso_pu_bacteria 2852623160 2852624134 223
9 iso_pu_bacteria 2884933994 2884936946 223
10 iso_pu_bacteria 2919437846 2919441008 223
11 iso_pu_bacteria 2928078545 2928079999 223
12 iso_pu_bacteria 2928147474 2928147544 223
13 iso_pu_bacteria 2932082852 2932083636 223
14 3300044673 Ga0453683_0182398 Ga0453683_0182398_425_1105 226
15 3300044712 Ga0453684_0101302 Ga0453684_0101302_992_1672 226
16 3300045051 Ga0451576_0007869 Ga0451576_0007869_3189_3869 226
17 3300045051 Ga0451576_0632284 Ga0451576_0632284_363_1043 226
18 3300001904 JGI24736J21556_1009937 JGI24736J21556_10099372 227
19 3300001979 JGI24740J21852_10029816 JGI24740J21852_100298162 227
20 3300001979 JGI24740J21852_10039468 JGI24740J21852_100394682 227
21 3300001990 JGI24737J22298_10000078 JGI24737J22298_1000007825 227
22 3300001990 JGI24737J22298_10093237 JGI24737J22298_100932371 227
23 3300002067 JGI24735J21928_10000050 JGI24735J21928_1000005020 227
24 3300002067 JGI24735J21928_10019866 JGI24735J21928_100198662 227
25 3300002737 JGI25162J39368_1000062 JGI25162J39368_100006277 227
26 3300002737 JGI25162J39368_1000733 JGI25162J39368_10007334 227
27 3300003214 JGI25165J46597_1001666 JGI25165J46597_10016665 227
28 3300003316 rootH1_10018511 rootH1_100185113 227
29 3300003320 rootH2_10001274 rootH2_1000127413 227
30 3300003322 rootL2_10047782 rootL2_100477822 227
31 3300003322 rootL2_10083044 rootL2_100830441 227
32 3300003323 rootH1_10005306 rootH1_1000530613 227
33 3300003323 rootH1_10009847 rootH1_100098473 227
34 3300003323 rootH1_10244779 rootH1_102447793 227
35 3300005288 Ga0065714_10009821 Ga0065714_100098213 227
36 3300005327 Ga0070658_10001195 Ga0070658_1000119517 227
37 3300005327 Ga0070658_10077338 Ga0070658_100773383 227
38 3300005328 Ga0070676_10000058 Ga0070676_1000005823 227
39 3300005328 Ga0070676_10007742 Ga0070676_100077423 227
40 3300005329 Ga0070683_100308415 Ga0070683_1003084152 227
41 3300005329 Ga0070683_100313696 Ga0070683_1003136962 227
42 3300005331 Ga0070670_100138484 Ga0070670_1001384841 227
43 3300005334 Ga0068869_100015199 Ga0068869_1000151994 227
44 3300005334 Ga0068869_100074081 Ga0068869_1000740813 227
45 3300005335 Ga0070666_10019429 Ga0070666_100194294 227
46 3300005335 Ga0070666_10204988 Ga0070666_102049882 227
47 3300005338 Ga0068868_100018320 Ga0068868_1000183202 227
48 3300005339 Ga0070660_100295654 Ga0070660_1002956541 227
49 3300005347 Ga0070668_100019749 Ga0070668_1000197491 227
50 3300005354 Ga0070675_100045260 Ga0070675_1000452603 227
51 3300005354 Ga0070675_100655815 Ga0070675_1006558151 227
52 3300005355 Ga0070671_100018776 Ga0070671_1000187765 227
53 3300005356 Ga0070674_100142291 Ga0070674_1001422912 227
54 3300005364 Ga0070673_100008345 Ga0070673_1000083455 227
55 3300005364 Ga0070673_100036435 Ga0070673_1000364352 227
56 3300005364 Ga0070673_100460208 Ga0070673_1004602082 227
57 3300005366 Ga0070659_100031944 Ga0070659_1000319441 227
58 3300005367 Ga0070667_100159338 Ga0070667_1001593382 227
59 3300005367 Ga0070667_100180177 Ga0070667_1001801773 227
60 3300005456 Ga0070678_100007159 Ga0070678_1000071594 227
61 3300005456 Ga0070678_100052538 Ga0070678_1000525384 227
62 3300005457 Ga0070662_100000055 Ga0070662_10000005567 227
63 3300005457 Ga0070662_100037138 Ga0070662_1000371382 227
64 3300005457 Ga0070662_100070270 Ga0070662_1000702702 227
65 3300005459 Ga0068867_100027243 Ga0068867_1000272431 227
66 3300005466 Ga0070685_10076676 Ga0070685_100766762 227
67 3300005539 Ga0068853_100007508 Ga0068853_1000075082 227
68 3300005539 Ga0068853_100041576 Ga0068853_1000415762 227
69 3300005539 Ga0068853_100097455 Ga0068853_1000974553 227
70 3300005539 Ga0068853_100183017 Ga0068853_1001830172 227
71 3300005543 Ga0070672_100004660 Ga0070672_1000046606 227
72 3300005548 Ga0070665_100000034 Ga0070665_100000034202 227
73 3300005548 Ga0070665_100011887 Ga0070665_1000118875 227
74 3300005563 Ga0068855_100000122 Ga0068855_10000012212 227
75 3300005563 Ga0068855_100001132 Ga0068855_10000113231 227
76 3300005563 Ga0068855_100007517 Ga0068855_1000075178 227
77 3300005563 Ga0068855_100016135 Ga0068855_10001613511 227
78 3300005563 Ga0068855_100047210 Ga0068855_1000472106 227
79 3300005563 Ga0068855_100127781 Ga0068855_1001277813 227
80 3300005563 Ga0068855_100164631 Ga0068855_1001646312 227
81 3300005563 Ga0068855_100940695 Ga0068855_1009406952 227
82 3300005564 Ga0070664_100169691 Ga0070664_1001696912 227
83 3300005577 Ga0068857_100057018 Ga0068857_1000570184 227
84 3300005577 Ga0068857_100116503 Ga0068857_1001165031 227
85 3300005577 Ga0068857_101213941 Ga0068857_1012139411 227
86 3300005578 Ga0068854_100129572 Ga0068854_1001295723 227
87 3300005578 Ga0068854_100245910 Ga0068854_1002459102 227
88 3300005614 Ga0068856_100018522 Ga0068856_1000185222 227
89 3300005614 Ga0068856_100056912 Ga0068856_1000569124 227
90 3300005616 Ga0068852_100003135 Ga0068852_1000031352 227
91 3300005617 Ga0068859_100290289 Ga0068859_1002902893 227
92 3300005718 Ga0068866_10026258 Ga0068866_100262584 227
93 3300005719 Ga0068861_100005802 Ga0068861_1000058025 227
94 3300005719 Ga0068861_100048778 Ga0068861_1000487783 227
95 3300005840 Ga0068870_10010474 Ga0068870_100104743 227
96 3300005840 Ga0068870_10029664 Ga0068870_100296641 227
97 3300005841 Ga0068863_100029768 Ga0068863_1000297684 227
98 3300005842 Ga0068858_100112683 Ga0068858_1001126833 227
99 3300006195 Ga0075366_10000392 Ga0075366_100003922 227
100 3300006195 Ga0075366_10000653 Ga0075366_1000065317 227
101 3300006195 Ga0075366_10003359 Ga0075366_100033599 227
102 3300006237 Ga0097621_100001503 Ga0097621_1000015036 227
103 3300006237 Ga0097621_100052072 Ga0097621_1000520722 227
104 3300006237 Ga0097621_100086734 Ga0097621_1000867342 227
105 3300006237 Ga0097621_100145460 Ga0097621_1001454602 227
106 3300006237 Ga0097621_100188718 Ga0097621_1001887183 227
107 3300006353 Ga0075370_10076888 Ga0075370_100768883 227
108 3300006358 Ga0068871_100000099 Ga0068871_10000009949 227
109 3300006358 Ga0068871_100004512 Ga0068871_1000045124 227
110 3300006358 Ga0068871_100074709 Ga0068871_1000747093 227
111 3300006358 Ga0068871_100095270 Ga0068871_1000952702 227
112 3300006358 Ga0068871_100282266 Ga0068871_1002822661 227
113 3300006881 Ga0068865_100000055 Ga0068865_10000005529 227
114 3300006881 Ga0068865_100003508 Ga0068865_1000035084 227
115 3300006881 Ga0068865_100185620 Ga0068865_1001856202 227
116 3300006931 Ga0097620_100290291 Ga0097620_1002902912 227
117 3300009011 Ga0105251_10036484 Ga0105251_100364842 227
118 3300009093 Ga0105240_10004347 Ga0105240_1000434710 227
119 3300009093 Ga0105240_10018298 Ga0105240_1001829811 227
120 3300009093 Ga0105240_10024342 Ga0105240_100243423 227
121 3300009093 Ga0105240_10094566 Ga0105240_100945663 227
122 3300009098 Ga0105245_10246931 Ga0105245_102469312 227
123 3300009174 Ga0105241_10017740 Ga0105241_100177405 227
124 3300009174 Ga0105241_10078973 Ga0105241_100789732 227
125 3300009176 Ga0105242_10012932 Ga0105242_100129322 227
126 3300009177 Ga0105248_10220495 Ga0105248_102204952 227
127 3300009545 Ga0105237_10001160 Ga0105237_1000116035 227
128 3300009545 Ga0105237_10012114 Ga0105237_100121141 227
129 3300009545 Ga0105237_10013650 Ga0105237_100136505 227
130 3300009545 Ga0105237_10014787 Ga0105237_100147873 227
131 3300009545 Ga0105237_10115874 Ga0105237_101158741 227
132 3300009551 Ga0105238_10005104 Ga0105238_100051047 227
133 3300009551 Ga0105238_10035466 Ga0105238_100354665 227
134 3300009553 Ga0105249_10116291 Ga0105249_101162912 227
135 3300009553 Ga0105249_10692296 Ga0105249_106922962 227
136 3300010375 Ga0105239_10000002 Ga0105239_1000000221 227
137 3300010375 Ga0105239_10000006 Ga0105239_1000000668 227
138 3300010375 Ga0105239_10002817 Ga0105239_1000281725 227
139 3300010375 Ga0105239_10003056 Ga0105239_100030562 227
140 3300010375 Ga0105239_10003325 Ga0105239_1000332524 227
141 3300010375 Ga0105239_10095505 Ga0105239_100955053 227
142 3300010375 Ga0105239_10611722 Ga0105239_106117222 227
143 3300010375 Ga0105239_10667489 Ga0105239_106674891 227
144 3300011119 Ga0105246_10024473 Ga0105246_100244733 227
145 3300013100 Ga0157373_10000037 Ga0157373_1000003768 227
146 3300013100 Ga0157373_10001486 Ga0157373_1000148611 227
147 3300013102 Ga0157371_10000141 Ga0157371_1000014165 227
148 3300013102 Ga0157371_10007182 Ga0157371_100071829 227
149 3300013102 Ga0157371_10304519 Ga0157371_103045192 227
150 3300013104 Ga0157370_10072690 Ga0157370_100726904 227
151 3300013104 Ga0157370_10341994 Ga0157370_103419942 227
152 3300013104 Ga0157370_10573573 Ga0157370_105735732 227
153 3300013105 Ga0157369_10070795 Ga0157369_100707953 227
154 3300013296 Ga0157374_10000051 Ga0157374_10000051111 227
155 3300013296 Ga0157374_10012812 Ga0157374_1001281210 227
156 3300013296 Ga0157374_10014360 Ga0157374_100143603 227
157 3300013296 Ga0157374_10017459 Ga0157374_100174597 227
158 3300013296 Ga0157374_10074279 Ga0157374_100742792 227
159 3300013296 Ga0157374_10263460 Ga0157374_102634604 227
160 3300013297 Ga0157378_10108928 Ga0157378_101089282 227
161 3300013297 Ga0157378_10285849 Ga0157378_102858492 227
162 3300013297 Ga0157378_10323263 Ga0157378_103232632 227
163 3300013306 Ga0163162_10000018 Ga0163162_10000018166 227
164 3300013306 Ga0163162_10001999 Ga0163162_100019994 227
165 3300013306 Ga0163162_10014095 Ga0163162_100140952 227
166 3300013306 Ga0163162_10256901 Ga0163162_102569012 227
167 3300013307 Ga0157372_10000418 Ga0157372_1000041834 227
168 3300013307 Ga0157372_10002874 Ga0157372_1000287411 227
169 3300013307 Ga0157372_10005186 Ga0157372_1000518613 227
170 3300013307 Ga0157372_10057282 Ga0157372_100572824 227
171 3300013307 Ga0157372_10368162 Ga0157372_103681622 227
172 3300013307 Ga0157372_10660852 Ga0157372_106608522 227
173 3300013308 Ga0157375_10006776 Ga0157375_1000677610 227
174 3300013308 Ga0157375_10493075 Ga0157375_104930751 227
175 3300014745 Ga0157377_10270202 Ga0157377_102702022 227
176 3300014969 Ga0157376_10011884 Ga0157376_100118842 227
177 3300014969 Ga0157376_10099623 Ga0157376_100996232 227
178 3300014969 Ga0157376_10293076 Ga0157376_102930762 227
179 3300014969 Ga0157376_10317251 Ga0157376_103172512 227
180 3300017792 Ga0163161_10068336 Ga0163161_100683362 227
181 3300017792 Ga0163161_10152414 Ga0163161_101524142 227
182 3300021361 Ga0213872_10075469 Ga0213872_100754692 227
183 3300025230 Ga0209563_109440 Ga0209563_1094402 227
184 3300025231 Ga0207427_100090 Ga0207427_10009048 227
185 3300025233 Ga0209437_100034 Ga0209437_100034257 227
186 3300025233 Ga0209437_100177 Ga0209437_10017777 227
187 3300025250 Ga0209026_1000316 Ga0209026_100031630 227
188 3300025250 Ga0209026_1001032 Ga0209026_10010327 227
189 3300025261 Ga0209233_1000038 Ga0209233_1000038257 227
190 3300025261 Ga0209233_1001836 Ga0209233_10018366 227
191 3300025321 Ga0207656_10228124 Ga0207656_102281241 227
192 3300025900 Ga0207710_10055340 Ga0207710_100553402 227
193 3300025904 Ga0207647_10000405 Ga0207647_100004052 227
194 3300025904 Ga0207647_10009160 Ga0207647_100091603 227
195 3300025904 Ga0207647_10094194 Ga0207647_100941942 227
196 3300025907 Ga0207645_10000046 Ga0207645_1000004667 227
197 3300025907 Ga0207645_10000219 Ga0207645_100002198 227
198 3300025908 Ga0207643_10246289 Ga0207643_102462891 227
199 3300025909 Ga0207705_10000457 Ga0207705_1000045734 227
200 3300025911 Ga0207654_10014229 Ga0207654_100142295 227
201 3300025911 Ga0207654_10259230 Ga0207654_102592301 227
202 3300025913 Ga0207695_10034279 Ga0207695_100342795 227
203 3300025913 Ga0207695_10049377 Ga0207695_100493775 227
204 3300025913 Ga0207695_10076552 Ga0207695_100765524 227
205 3300025913 Ga0207695_10084167 Ga0207695_100841672 227
206 3300025913 Ga0207695_10093301 Ga0207695_100933013 227
207 3300025914 Ga0207671_10001003 Ga0207671_100010038 227
208 3300025914 Ga0207671_10008874 Ga0207671_100088746 227
209 3300025914 Ga0207671_10036864 Ga0207671_100368645 227
210 3300025914 Ga0207671_10045776 Ga0207671_100457766 227
211 3300025914 Ga0207671_10083798 Ga0207671_100837982 227
212 3300025919 Ga0207657_10091730 Ga0207657_100917303 227
213 3300025919 Ga0207657_10116623 Ga0207657_101166233 227
214 3300025925 Ga0207650_10171144 Ga0207650_101711442 227
215 3300025926 Ga0207659_10123758 Ga0207659_101237582 227
216 3300025927 Ga0207687_10323675 Ga0207687_103236752 227
217 3300025931 Ga0207644_10014000 Ga0207644_100140005 227
218 3300025932 Ga0207690_10011580 Ga0207690_100115804 227
219 3300025933 Ga0207706_10000123 Ga0207706_100001231 227
220 3300025933 Ga0207706_10047879 Ga0207706_100478792 227
221 3300025933 Ga0207706_10089187 Ga0207706_100891872 227
222 3300025934 Ga0207686_10140555 Ga0207686_101405551 227
223 3300025937 Ga0207669_10017882 Ga0207669_100178824 227
224 3300025938 Ga0207704_10000058 Ga0207704_1000005824 227
225 3300025938 Ga0207704_10005864 Ga0207704_100058642 227
226 3300025938 Ga0207704_10136433 Ga0207704_101364332 227
227 3300025938 Ga0207704_10255659 Ga0207704_102556592 227
228 3300025940 Ga0207691_10019389 Ga0207691_100193893 227
229 3300025942 Ga0207689_10001199 Ga0207689_1000119910 227
230 3300025942 Ga0207689_10026945 Ga0207689_100269453 227
231 3300025944 Ga0207661_10005102 Ga0207661_100051021 227
232 3300025944 Ga0207661_10200104 Ga0207661_102001041 227
233 3300025945 Ga0207679_10155425 Ga0207679_101554252 227
234 3300025949 Ga0207667_10000020 Ga0207667_10000020306 227
235 3300025949 Ga0207667_10000993 Ga0207667_100009933 227
236 3300025949 Ga0207667_10039885 Ga0207667_100398856 227
237 3300025949 Ga0207667_10258255 Ga0207667_102582552 227
238 3300025960 Ga0207651_10070119 Ga0207651_100701193 227
239 3300025960 Ga0207651_10246135 Ga0207651_102461352 227
240 3300025961 Ga0207712_10039961 Ga0207712_100399612 227
241 3300025972 Ga0207668_10074568 Ga0207668_100745682 227
242 3300025972 Ga0207668_10234414 Ga0207668_102344142 227
243 3300025981 Ga0207640_10158863 Ga0207640_101588631 227
244 3300025981 Ga0207640_10211469 Ga0207640_102114692 227
245 3300025986 Ga0207658_10187576 Ga0207658_101875762 227
246 3300026035 Ga0207703_10176179 Ga0207703_101761792 227
247 3300026041 Ga0207639_10014121 Ga0207639_100141211 227
248 3300026041 Ga0207639_10033863 Ga0207639_100338632 227
249 3300026041 Ga0207639_10090478 Ga0207639_100904783 227
250 3300026041 Ga0207639_10341645 Ga0207639_103416451 227
251 3300026067 Ga0207678_10201246 Ga0207678_102012461 227
252 3300026078 Ga0207702_10013672 Ga0207702_100136722 227
253 3300026078 Ga0207702_10094254 Ga0207702_100942542 227
254 3300026078 Ga0207702_10163569 Ga0207702_101635693 227
255 3300026089 Ga0207648_10002523 Ga0207648_100025235 227
256 3300026089 Ga0207648_10003611 Ga0207648_1000361116 227
257 3300026116 Ga0207674_10315143 Ga0207674_103151431 227
258 3300026118 Ga0207675_100006970 Ga0207675_1000069709 227
259 3300026118 Ga0207675_100026719 Ga0207675_1000267193 227
260 3300026121 Ga0207683_10000730 Ga0207683_1000073011 227
261 3300026121 Ga0207683_10078334 Ga0207683_100783344 227
262 3300026142 Ga0207698_10009189 Ga0207698_100091896 227
263 3300026142 Ga0207698_10020022 Ga0207698_100200226 227
264 3300028379 Ga0268266_10000111 Ga0268266_1000011127 227
265 3300028379 Ga0268266_10300821 Ga0268266_103008212 227
266 3300028381 Ga0268264_11291980 Ga0268264_112919801 227
267 3300028786 Ga0307517_10008073 Ga0307517_1000807315 227
268 3300028794 Ga0307515_10000002 Ga0307515_10000002487 227
269 3300028794 Ga0307515_10000007 Ga0307515_10000007332 227
270 3300028794 Ga0307515_10000794 Ga0307515_1000079457 227
271 3300028794 Ga0307515_10002207 Ga0307515_1000220730 227
272 3300031649 Ga0307514_10122891 Ga0307514_101228912 227
273 3300033179 Ga0307507_10000010 Ga0307507_10000010136 227
274 3300033180 Ga0307510_10002664 Ga0307510_100026648 227
275 3300037312 Ga0395899_0000462 Ga0395899_0000462_8349_9035 227
276 3300037312 Ga0395899_0030919 Ga0395899_0030919_2412_3116 227
277 3300037418 Ga0395900_0000141 Ga0395900_0000141_55168_55854 227
278 3300037418 Ga0395900_0000155 Ga0395900_0000155_12485_13174 227
279 3300037418 Ga0395900_0007460 Ga0395900_0007460_3198_3902 227
280 3300037466 Ga0395898_0007157 Ga0395898_0007157_10965_11651 227
281 3300037471 Ga0395905_0000124 Ga0395905_0000124_79801_80487 227
282 3300037471 Ga0395905_0000496 Ga0395905_0000496_1235_1939 227
283 3300037471 Ga0395905_0162591 Ga0395905_0162591_251_934 227
284 3300038443 Ga0395901_0000138 Ga0395901_0000138_58733_59419 227
285 3300038443 Ga0395901_0010646 Ga0395901_0010646_4266_4970 227
286 3300039447 Ga0436361_1129343 Ga0436361_1129343_2649_3338 227
287 3300042005 Ga0439448_0021382 Ga0439448_0021382_113_805 227
288 3300042876 Ga0451577_0325188 Ga0451577_0325188_108_800 227
289 3300044712 Ga0453684_0272190 Ga0453684_0272190_394_1086 227
290 3300046460 Ga0495638_0136320 Ga0495638_0136320_366_1088 227
291 3300046462 Ga0495651_0156898 Ga0495651_0156898_610_1293 227
292 3300046471 Ga0495650_0000003 Ga0495650_0000003_664633_665355 227
293 3300046471 Ga0495650_0031979 Ga0495650_0031979_667_1356 227
294 3300046471 Ga0495650_0065075 Ga0495650_0065075_515_1204 227
295 3300046471 Ga0495650_0163163 Ga0495650_0163163_31_714 227
296 3300046492 Ga0495585_0000079 Ga0495585_0000079_73105_73797 227
297 3300046492 Ga0495585_0000330 Ga0495585_0000330_3754_4542 227
298 3300046500 Ga0495596_0018227 Ga0495596_0018227_1725_2414 227
299 3300046506 Ga0495583_0135372 Ga0495583_0135372_138_827 227
300 3300046507 Ga0495606_0000163 Ga0495606_0000163_48795_49517 227
301 3300046507 Ga0495606_0007123 Ga0495606_0007123_1131_1820 227
302 3300046507 Ga0495606_0134317 Ga0495606_0134317_624_1313 227
303 3300046512 Ga0495610_0001356 Ga0495610_0001356_4461_5153 227
304 3300046513 Ga0495616_0012051 Ga0495616_0012051_3767_4501 227
305 3300046513 Ga0495616_0086976 Ga0495616_0086976_214_903 227
306 3300046518 Ga0495631_0040003 Ga0495631_0040003_271_960 227
307 3300046520 Ga0495637_0045250 Ga0495637_0045250_223_945 227
308 3300046523 Ga0495644_0028992 Ga0495644_0028992_495_1181 227
309 3300046524 Ga0495648_0007985 Ga0495648_0007985_710_1498 227
310 3300046558 Ga0495633_0000044 Ga0495633_0000044_127456_128145 227
311 3300046558 Ga0495633_0014741 Ga0495633_0014741_1726_2418 227
312 3300046616 Ga0495668_0000044 Ga0495668_0000044_131908_132696 227
313 3300046660 Ga0495625_0000159 Ga0495625_0000159_98539_99273 227
314 3300046660 Ga0495625_0000900 Ga0495625_0000900_8261_8950 227
315 3300046660 Ga0495625_0001731 Ga0495625_0001731_3279_4067 227
316 3300046660 Ga0495625_0052513 Ga0495625_0052513_690_1379 227
317 3300046660 Ga0495625_0063108 Ga0495625_0063108_1011_1700 227
318 3300046660 Ga0495625_0150792 Ga0495625_0150792_529_1212 227
319 3300046660 Ga0495625_0178227 Ga0495625_0178227_511_1194 227
320 3300046660 Ga0495625_0289326 Ga0495625_0289326_134_829 227
321 3300046665 Ga0495661_0004111 Ga0495661_0004111_2113_2796 227
322 3300046665 Ga0495661_0047570 Ga0495661_0047570_419_1111 227
323 3300046694 Ga0495649_0000003 Ga0495649_0000003_781541_782275 227
324 3300047321 Ga0495676_0262039 Ga0495676_0262039_470_1159 227
325 3300047443 Ga0495687_001658 Ga0495687_001658_6418_7116 227
326 3300047443 Ga0495687_031205 Ga0495687_031205_1505_2197 227
327 3300047469 Ga0495673_0049982 Ga0495673_0049982_861_1610 227
328 3300047472 Ga0495686_0000372 Ga0495686_0000372_58100_58789 227
329 3300048908 Ga0496105_0315688 Ga0496105_0315688_121_804 227
330 3300048913 Ga0496110_0017209 Ga0496110_0017209_14_697 227
331 3300048919 Ga0496116_0010362 Ga0496116_0010362_1518_2219 227
332 3300048920 Ga0496117_0000289 Ga0496117_0000289_12440_13141 227
333 3300048925 Ga0496122_0006957 Ga0496122_0006957_6157_6858 227
334 3300049459 Ga0495678_108023 Ga0495678_108023_175_864 227
335 3300049460 Ga0495682_0019819 Ga0495682_0019819_1588_2376 227
336 3300050493 nmdc:mga0k408_151_c2 nmdc:mga0k408_151_c2_14995_15678 227
337 3300050493 nmdc:mga0k408_1790_c1 nmdc:mga0k408_1790_c1_10657_11346 227
338 3300050493 nmdc:mga0k408_75_c2 nmdc:mga0k408_75_c2_14143_14832 227
339 3300050496 nmdc:mga07m45_75778_c1 nmdc:mga07m45_75778_c1_682_1368 227
340 3300053122 Ga0500608_003428 Ga0500608_003428_3093_3782 227
341 3300053125 Ga0500618_000001 Ga0500618_000001_258953_259642 227
342 3300053139 Ga0500568_0151545 Ga0500568_0151545_26_748 227
343 3300053156 Ga0500622_0000175 Ga0500622_0000175_11904_12587 227
344 3300053157 Ga0500624_000623 Ga0500624_000623_5878_6567 227
345 3300053161 Ga0500634_0026862 Ga0500634_0026862_914_1603 227
346 3300053727 Ga0500611_000011 Ga0500611_000011_69930_70619 227
347 iso_pu_bacteria 2721755487 2722728490 227
348 iso_pu_bacteria 2904780799 2904784600 227
349 iso_pu_bacteria 2919177583 2919181193 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

3

170

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9533 3 225
2pke-assembly1.cif.gz_A crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9484 2 225
3ddh-assembly1.cif.gz_A the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9381 3 225
3ddh-assembly1.cif.gz_B the structure of a putative haloacid dehalogenase-like family hydrolase from bacteroides thetaiotaomicron vpi-5482 0.9241 3 225
2pke-assembly1.cif.gz_B crystal structure of haloacid delahogenase-like family hydrolase (np_639141.1) from xanthomonas campestris at 1.81 a resolution 0.9188 3 225
ID Description Score Start End Superfamily
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9581 19 97 1.10.150.240
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9354 3 225 3.40.50.1000
3ddhB02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2 0.9348 19 97 1.10.150.240
2pkeB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.93 3 225 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9085 102 193 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Y4VKY2-F1-model_v4 HAD hydrolase-like protein 0.9925 2 169 GO:0016787
AF-A0A2N2XIM3-F1-model_v4 deleted 0.9892 1 147
AF-A0A7Y3HRJ6-F1-model_v4 HAD hydrolase-like protein 0.9858 2 196 GO:0016787
AF-A0A7T4YGC6-F1-model_v4 HAD family hydrolase 0.9855 2 222 GO:0016787
AF-A0A7U4E8U0-F1-model_v4 Haloacid dehalogenase domain protein hydrolase 0.985 1 226 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.41 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map