F417940

General Info

Members Datasets Scaffolds Average Seq Length
349 204 698 110

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10356523|Ga0307514_103565231
Length 116
Sequence MKMVEESVSDVLDRQVAQTYASWFRALADPSRVQIVEFLARQDRPLPVGAIVDAVGLAQSTVSQHLKILTEVRFVLVEPVGNARHYRINQNCISCFPSAADVVMGRPAPAPIDGCS

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
125 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
150 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
181 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
182 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
183 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
184 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
185 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
186 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
189 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
190 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
191 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
192 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
193 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
194 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
195 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
196 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
197 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
198 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
199 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
200 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
201 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
202 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
203 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
204 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 1.15
Isolates 4.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.44
Nodule 0.29
Rhizoplane 5.16
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 0.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10356523 3300031649 Bacteria 776
2 rootH2_10072995 3300003320 Bacteria 4883
3 Ga0070658_10300511 3300005327 Bacteria 1369
4 Ga0070658_11048440 3300005327 Bacteria 709
5 Ga0070683_100002557 3300005329 Bacteria 14539
6 Ga0070683_100068119 3300005329 Bacteria 3316
7 Ga0070683_100888871 3300005329 Bacteria 854
8 Ga0070683_101612746 3300005329 Bacteria 624
9 Ga0070683_101826641 3300005329 Bacteria 584
10 Ga0070670_100160551 3300005331 Bacteria 1948
11 Ga0068869_100022834 3300005334 Bacteria 4314
12 Ga0070680_100493823 3300005336 Bacteria 1047
13 Ga0070680_100551251 3300005336 Bacteria 988
14 Ga0070682_100597773 3300005337 Bacteria 871
15 Ga0068868_100004256 3300005338 Bacteria 10016
16 Ga0070660_101784521 3300005339 Bacteria 524
17 Ga0070661_100010057 3300005344 Bacteria 6567
18 Ga0070661_100019342 3300005344 Bacteria 4854
19 Ga0070692_10003629 3300005345 Bacteria 6303
20 Ga0070692_10539863 3300005345 Bacteria 762
21 Ga0070692_10789341 3300005345 Bacteria 647
22 Ga0070668_100000735 3300005347 Bacteria 22385
23 Ga0070668_100224935 3300005347 Bacteria 1549
24 Ga0070675_100023493 3300005354 Bacteria 4931
25 Ga0070671_100302843 3300005355 Bacteria 1361
26 Ga0070674_101300592 3300005356 Bacteria 648
27 Ga0070688_100293108 3300005365 Bacteria 1173
28 Ga0070659_100090409 3300005366 Bacteria 2453
29 Ga0070667_101210980 3300005367 Bacteria 707
30 Ga0070709_10012449 3300005434 Bacteria 4763
31 Ga0070709_10227932 3300005434 Bacteria 1332
32 Ga0070714_100021777 3300005435 Bacteria 5247
33 Ga0070714_100171299 3300005435 Bacteria 1970
34 Ga0070714_101143545 3300005435 Bacteria 759
35 Ga0070714_101744124 3300005435 Bacteria 608
36 Ga0070713_100013318 3300005436 Bacteria 6069
37 Ga0070713_100221850 3300005436 Bacteria 1715
38 Ga0070713_100734272 3300005436 Bacteria 944
39 Ga0070710_10943081 3300005437 Bacteria 625
40 Ga0070711_100113078 3300005439 Bacteria 1996
41 Ga0070711_100684844 3300005439 Bacteria 862
42 Ga0070700_100068478 3300005441 Bacteria 2257
43 Ga0070694_100951501 3300005444 Bacteria 711
44 Ga0070663_100135420 3300005455 Bacteria 1875
45 Ga0070662_100013034 3300005457 Bacteria 5526
46 Ga0070681_10230570 3300005458 Bacteria 1766
47 Ga0070685_10087358 3300005466 Bacteria 1881
48 Ga0070679_100061438 3300005530 Bacteria 3745
49 Ga0070679_100672239 3300005530 Bacteria 978
50 Ga0070684_100026623 3300005535 Bacteria 4873
51 Ga0070684_100067391 3300005535 Bacteria 3144
52 Ga0070684_100133567 3300005535 Bacteria 2240
53 Ga0070684_100211773 3300005535 Bacteria 1766
54 Ga0070684_100340509 3300005535 Bacteria 1379
55 Ga0068853_100470981 3300005539 Bacteria 1183
56 Ga0070672_100447606 3300005543 Bacteria 1112
57 Ga0070693_101417513 3300005547 Bacteria 541
58 Ga0070665_100075550 3300005548 Bacteria 3376
59 Ga0070665_100210320 3300005548 Bacteria 1946
60 Ga0070665_100460388 3300005548 Bacteria 1282
61 Ga0068855_101014608 3300005563 Bacteria 871
62 Ga0070664_100001185 3300005564 Bacteria 20756
63 Ga0070664_100118922 3300005564 Bacteria 2312
64 Ga0070664_100455289 3300005564 Bacteria 1175
65 Ga0070664_100475084 3300005564 Bacteria 1150
66 Ga0070664_100785533 3300005564 Bacteria 890
67 Ga0070664_101325344 3300005564 Bacteria 680
68 Ga0068857_100093607 3300005577 Bacteria 2691
69 Ga0068857_100202337 3300005577 Bacteria 1810
70 Ga0068857_100408061 3300005577 Bacteria 1265
71 Ga0068856_101031369 3300005614 Bacteria 841
72 Ga0068856_101097421 3300005614 Bacteria 813
73 Ga0068852_100008057 3300005616 Bacteria 7728
74 Ga0068859_101197974 3300005617 Bacteria 836
75 Ga0068864_100069738 3300005618 Bacteria 3057
76 Ga0068864_100161158 3300005618 Bacteria 2039
77 Ga0068861_100050725 3300005719 Bacteria 3147
78 Ga0068870_10146060 3300005840 Bacteria 1388
79 Ga0068863_100003607 3300005841 Bacteria 15285
80 Ga0068863_100063255 3300005841 Bacteria 3499
81 Ga0068863_100241018 3300005841 Bacteria 1745
82 Ga0068858_100137393 3300005842 Bacteria 2294
83 Ga0068858_101045604 3300005842 Bacteria 801
84 Ga0068860_100121225 3300005843 Bacteria 2504
85 Ga0068860_100129993 3300005843 Bacteria 2416
86 Ga0068860_101074123 3300005843 Bacteria 824
87 Ga0070712_100092766 3300006175 Bacteria 2215
88 Ga0097621_101715762 3300006237 Bacteria 598
89 Ga0068871_100689084 3300006358 Bacteria 935
90 Ga0068871_102187000 3300006358 Bacteria 527
91 Ga0075430_100266864 3300006846 Bacteria 1417
92 Ga0075431_100285512 3300006847 Bacteria 1671
93 Ga0075429_100692251 3300006880 Bacteria 893
94 Ga0068865_100255822 3300006881 Bacteria 1384
95 Ga0097620_101197993 3300006931 Bacteria 836
96 Ga0105251_10636342 3300009011 Bacteria 509
97 Ga0105250_10595285 3300009092 Bacteria 512
98 Ga0111539_10006924 3300009094 Bacteria 14552
99 Ga0105245_10069645 3300009098 Bacteria 3190
100 Ga0105243_11827412 3300009148 Bacteria 639
101 Ga0105241_10130164 3300009174 Bacteria 2036
102 Ga0105242_10447479 3300009176 Bacteria 1217
103 Ga0105248_10048817 3300009177 Bacteria 4747
104 Ga0105248_10122385 3300009177 Bacteria 2935
105 Ga0105248_10160898 3300009177 Bacteria 2532
106 Ga0105237_10445837 3300009545 Bacteria 1300
107 Ga0105237_12603000 3300009545 Bacteria 517
108 Ga0105239_10892446 3300010375 Bacteria 1020
109 Ga0105239_10920099 3300010375 Bacteria 1004
110 Ga0105239_11155337 3300010375 Bacteria 892
111 Ga0105239_12214380 3300010375 Bacteria 639
112 Ga0157370_10430497 3300013104 Bacteria 1213
113 Ga0157369_10906229 3300013105 Bacteria 904
114 Ga0157372_11742869 3300013307 Bacteria 716
115 Ga0157372_11832831 3300013307 Bacteria 698
116 Ga0157372_11894778 3300013307 Bacteria 685
117 Ga0157375_10354679 3300013308 Bacteria 1633
118 Ga0163163_10004571 3300014325 Bacteria 11812
119 Ga0163163_10015648 3300014325 Bacteria 7020
120 Ga0163163_10171482 3300014325 Bacteria 2216
121 Ga0163163_10478577 3300014325 Bacteria 1306
122 Ga0163163_10918066 3300014325 Bacteria 939
123 Ga0163163_13198320 3300014325 Bacteria 511
124 Ga0157380_10281894 3300014326 Bacteria 1521
125 Ga0157380_10471837 3300014326 Bacteria 1211
126 Ga0157377_10013431 3300014745 Bacteria 4145
127 Ga0157377_10782838 3300014745 Bacteria 701
128 Ga0157379_10384249 3300014968 Bacteria 1288
129 Ga0157379_10485635 3300014968 Bacteria 1144
130 Ga0206354_10686940 3300020081 Bacteria 760
131 Ga0206353_10475108 3300020082 Bacteria 882
132 Ga0206353_10830031 3300020082 Bacteria 2350
133 Ga0224712_10119513 3300022467 Bacteria 1139
134 Ga0207692_10663848 3300025898 Bacteria 674
135 Ga0207688_10072357 3300025901 Bacteria 1958
136 Ga0207699_10301019 3300025906 Bacteria 1120
137 Ga0207643_10195599 3300025908 Bacteria 1229
138 Ga0207705_10512186 3300025909 Bacteria 932
139 Ga0207654_10235768 3300025911 Bacteria 1220
140 Ga0207707_10372579 3300025912 Bacteria 1228
141 Ga0207707_10733907 3300025912 Bacteria 827
142 Ga0207660_11741613 3300025917 Bacteria 501
143 Ga0207662_10232993 3300025918 Bacteria 1203
144 Ga0207649_10030913 3300025920 Bacteria 3177
145 Ga0207649_10486021 3300025920 Bacteria 937
146 Ga0207649_10596973 3300025920 Bacteria 849
147 Ga0207652_10654588 3300025921 Bacteria 939
148 Ga0207652_10750227 3300025921 Bacteria 869
149 Ga0207652_10834189 3300025921 Bacteria 817
150 Ga0207652_11669610 3300025921 Bacteria 542
151 Ga0207681_10036262 3300025923 Bacteria 3253
152 Ga0207650_10300606 3300025925 Bacteria 1311
153 Ga0207659_10002478 3300025926 Bacteria 11001
154 Ga0207687_10100409 3300025927 Bacteria 2128
155 Ga0207700_10039437 3300025928 Bacteria 3438
156 Ga0207700_10430192 3300025928 Bacteria 1161
157 Ga0207700_11132785 3300025928 Bacteria 699
158 Ga0207664_10154952 3300025929 Bacteria 1950
159 Ga0207664_10212559 3300025929 Bacteria 1674
160 Ga0207664_11047195 3300025929 Bacteria 730
161 Ga0207690_10058595 3300025932 Bacteria 2605
162 Ga0207690_10164541 3300025932 Bacteria 1656
163 Ga0207706_10007095 3300025933 Bacteria 10365
164 Ga0207709_10088685 3300025935 Bacteria 2014
165 Ga0207669_11078277 3300025937 Bacteria 677
166 Ga0207691_10121171 3300025940 Bacteria 2318
167 Ga0207711_10007526 3300025941 Bacteria 9108
168 Ga0207711_10323036 3300025941 Archaea 1426
169 Ga0207711_10398387 3300025941 Bacteria 1279
170 Ga0207689_10011315 3300025942 Bacteria 7655
171 Ga0207661_10005907 3300025944 Bacteria 8641
172 Ga0207661_10016740 3300025944 Bacteria 5412
173 Ga0207661_10057720 3300025944 Bacteria 3122
174 Ga0207661_11575270 3300025944 Bacteria 601
175 Ga0207679_10021569 3300025945 Bacteria 4370
176 Ga0207679_10149682 3300025945 Bacteria 1898
177 Ga0207679_10263431 3300025945 Bacteria 1471
178 Ga0207679_10475334 3300025945 Bacteria 1112
179 Ga0207651_11459734 3300025960 Bacteria 616
180 Ga0207668_10000596 3300025972 Bacteria 22473
181 Ga0207668_10026238 3300025972 Bacteria 3781
182 Ga0207668_10087012 3300025972 Bacteria 2284
183 Ga0207677_10006013 3300026023 Bacteria 6614
184 Ga0207677_12257987 3300026023 Bacteria 506
185 Ga0207703_10065849 3300026035 Bacteria 2979
186 Ga0207703_11913815 3300026035 Bacteria 569
187 Ga0207678_10026779 3300026067 Bacteria 5029
188 Ga0207708_10098964 3300026075 Bacteria 2255
189 Ga0207702_10341072 3300026078 Bacteria 1431
190 Ga0207702_11063265 3300026078 Bacteria 803
191 Ga0207702_11173644 3300026078 Bacteria 762
192 Ga0207641_10008874 3300026088 Bacteria 8302
193 Ga0207641_10203983 3300026088 Bacteria 1825
194 Ga0207641_10553069 3300026088 Bacteria 1122
195 Ga0207641_12110296 3300026088 Bacteria 564
196 Ga0207648_10297925 3300026089 Bacteria 1446
197 Ga0207676_10089656 3300026095 Bacteria 2521
198 Ga0207674_10023560 3300026116 Bacteria 6592
199 Ga0207674_10090376 3300026116 Bacteria 3053
200 Ga0207674_10129699 3300026116 Bacteria 2485
201 Ga0207674_10300754 3300026116 Bacteria 1553
202 Ga0207674_10449586 3300026116 Bacteria 1245
203 Ga0207675_100033593 3300026118 Bacteria 4779
204 Ga0207698_10069291 3300026142 Bacteria 2789
205 Ga0268266_10044505 3300028379 Bacteria 3795
206 Ga0268266_10541779 3300028379 Bacteria 1114
207 Ga0268266_11835543 3300028379 Bacteria 581
208 Ga0268265_10060270 3300028380 Bacteria 2908
209 Ga0268264_10074921 3300028381 Bacteria 2876
210 Ga0268264_10874869 3300028381 Bacteria 901
211 Ga0268264_10939670 3300028381 Bacteria 869
212 Ga0307515_10002222 3300028794 Bacteria 42600
213 Ga0307515_10026760 3300028794 Bacteria 9904
214 Ga0307512_10015741 3300030522 Bacteria 6999
215 Ga0307513_10004690 3300031456 Bacteria 18180
216 Ga0307513_10134459 3300031456 Bacteria 2411
217 Ga0307513_10533082 3300031456 Bacteria 888
218 Ga0307509_10114918 3300031507 Bacteria 2685
219 Ga0307508_10034957 3300031616 Bacteria 4530
220 Ga0307508_10421007 3300031616 Bacteria 927
221 Ga0307508_10548364 3300031616 Bacteria 754
222 Ga0307514_10412785 3300031649 Bacteria 683
223 Ga0307516_10006730 3300031730 Bacteria 13433
224 Ga0307516_10008204 3300031730 Bacteria 11860
225 Ga0307516_10008925 3300031730 Bacteria 11247
226 Ga0307405_10022073 3300031731 Bacteria 3592
227 Ga0307405_10434980 3300031731 Bacteria 1036
228 Ga0307405_11220908 3300031731 Bacteria 651
229 Ga0307405_11351967 3300031731 Bacteria 621
230 Ga0307413_10194731 3300031824 Bacteria 1458
231 Ga0307413_10644477 3300031824 Bacteria 873
232 Ga0307413_11320678 3300031824 Bacteria 632
233 Ga0307410_10120871 3300031852 Bacteria 1910
234 Ga0307410_10235793 3300031852 Bacteria 1415
235 Ga0307410_10471881 3300031852 Bacteria 1028
236 Ga0307410_10778499 3300031852 Bacteria 812
237 Ga0307406_10029500 3300031901 Bacteria 3323
238 Ga0307406_10051978 3300031901 Bacteria 2604
239 Ga0307406_10977539 3300031901 Bacteria 725
240 Ga0307406_11031964 3300031901 Bacteria 707
241 Ga0307406_11286011 3300031901 Bacteria 638
242 Ga0307407_10012438 3300031903 Bacteria 4090
243 Ga0307407_10054716 3300031903 Bacteria 2303
244 Ga0307407_10680591 3300031903 Bacteria 773
245 Ga0307412_10018137 3300031911 Bacteria 4228
246 Ga0307412_10432945 3300031911 Bacteria 1079
247 Ga0307409_100005930 3300031995 Bacteria 7106
248 Ga0307409_100092938 3300031995 Bacteria 2477
249 Ga0307409_100366465 3300031995 Bacteria 1365
250 Ga0307409_101787751 3300031995 Bacteria 644
251 Ga0307409_101832464 3300031995 Bacteria 636
252 Ga0307409_102830093 3300031995 Bacteria 513
253 Ga0307416_100021488 3300032002 Bacteria 4634
254 Ga0307416_100271667 3300032002 Bacteria 1665
255 Ga0307416_101851309 3300032002 Bacteria 707
256 Ga0307414_10461111 3300032004 Bacteria 1117
257 Ga0307411_10759833 3300032005 Bacteria 850
258 Ga0307415_100000031 3300032126 Bacteria 60320
259 Ga0307415_100038820 3300032126 Bacteria 3141
260 Ga0307415_100233213 3300032126 Bacteria 1484
261 Ga0307415_100287061 3300032126 Bacteria 1356
262 Ga0307415_100485895 3300032126 Bacteria 1076
263 Ga0307415_100692647 3300032126 Bacteria 919
264 Ga0307415_101749745 3300032126 Bacteria 600
265 Ga0307415_101908228 3300032126 Bacteria 577
266 Ga0307507_10291299 3300033179 Bacteria 1010
267 Ga0307507_10502128 3300033179 Bacteria 653
268 Ga0307510_10386863 3300033180 Bacteria 843
269 Ga0373941_0138024 3300035115 Bacteria 884
270 Ga0373942_0111810 3300035207 Bacteria 845
271 Ga0373962_0005896 3300035242 Bacteria 2958
272 Ga0373935_0045978 3300035692 Bacteria 2756
273 Ga0373935_1052177 3300035692 Bacteria 605
274 Ga0373947_0830799 3300035725 Bacteria 631
275 Ga0373937_0238032 3300036401 Bacteria 1715
276 Ga0395900_0124130 3300037418 Bacteria 2648
277 Ga0395898_0869494 3300037466 Bacteria 840
278 Ga0395898_1688193 3300037466 Bacteria 556
279 Ga0395905_0899827 3300037471 Bacteria 788
280 Ga0395901_0016606 3300038443 Bacteria 7502
281 Ga0451798_0146417 3300041458 Bacteria 558
282 Ga0451802_0704916 3300041460 Bacteria 791
283 Ga0451853_0994605 3300041512 Bacteria 1049
284 Ga0451853_1195617 3300041512 Bacteria 3624
285 Ga0466957_0158190 3300044842 Bacteria 1470
286 Ga0495629_0346289 3300046459 Bacteria 1014
287 Ga0495638_0394244 3300046460 Bacteria 720
288 Ga0495582_0354794 3300046473 Bacteria 845
289 Ga0495594_0526768 3300046499 Bacteria 671
290 Ga0495594_0875303 3300046499 Bacteria 505
291 Ga0495608_0550854 3300046511 Bacteria 695
292 Ga0495632_0008726 3300046519 Bacteria 6181
293 Ga0495632_0083026 3300046519 Bacteria 1526
294 Ga0495635_0128739 3300046663 Bacteria 1726
295 Ga0495657_0728004 3300046675 Bacteria 569
296 Ga0495658_0785223 3300046683 Bacteria 610
297 Ga0495636_0489678 3300047318 Bacteria 594
298 Ga0496104_0021280 3300048907 Bacteria 5952
299 Ga0496104_1850251 3300048907 Bacteria 506
300 Ga0496105_0050944 3300048908 Bacteria 3421
301 Ga0496105_0263318 3300048908 Bacteria 1394
302 Ga0496108_0005257 3300048911 Bacteria 10456
303 Ga0496109_0049048 3300048912 Bacteria 3842
304 Ga0496110_0153365 3300048913 Bacteria 2086
305 Ga0496111_0061758 3300048914 Bacteria 2716
306 Ga0496112_0021701 3300048915 Bacteria 6108
307 Ga0496112_0099725 3300048915 Unclassified 2874
308 Ga0496112_0100345 3300048915 Bacteria 2864
309 Ga0496112_0184239 3300048915 Bacteria 2051
310 Ga0496112_0472082 3300048915 Bacteria 1192
311 Ga0496113_0006089 3300048916 Bacteria 7607
312 Ga0496113_0089856 3300048916 Bacteria 2365
313 Ga0496114_1487775 3300048917 Bacteria 565
314 Ga0501071_0652620 3300049587 Bacteria 810
315 Ga0501075_0553359 3300049591 Bacteria 878
316 Ga0501081_0825460 3300049743 Bacteria 698
317 Ga0501264_063885 3300049761 Bacteria 502
318 nmdc:mga0qj67_1429942_c1 3300050509 Bacteria 533
319 nmdc:mga0qj67_238030_c1 3300050509 Bacteria 1477
320 nmdc:mga06r32_557218_c1 3300050510 Bacteria 1120
321 nmdc:mga08y16_14025_c1 3300050511 Bacteria 8435
322 nmdc:mga0n895_2083365_c1 3300050512 Unclassified 524
323 Ga0500644_0417648 3300053088 Bacteria 586
324 Ga0500646_0001039 3300053090 Bacteria 7586
325 Ga0500583_0361747 3300053092 Bacteria 702
326 Ga0500583_0432010 3300053092 Bacteria 628
327 Ga0500651_0160587 3300053093 Bacteria 1344
328 Ga0500641_0169454 3300053096 Bacteria 940
329 Ga0500650_0316186 3300053098 Bacteria 688
330 Ga0500594_0011966 3300053118 Bacteria 2035
331 Ga0500652_052004 3300053131 Bacteria 1674
332 Ga0500577_0153938 3300053142 Bacteria 976
333 Ga0500600_0324154 3300053149 Bacteria 647
334 Ga0500633_0301237 3300053160 Bacteria 590
335 2623589324 2622736626 Bacteria 7181580
336 2623590082 2622736626 Bacteria 7181580
337 2676484743 2675903059 Bacteria 8644972
338 2753265939 2751185782 Bacteria 11227053
339 2855677527 2855676851 Bacteria 7063653
340 2858853370 2858848962 Bacteria 6963058
341 2858891412 2858888857 Bacteria 7060307
342 2867309043 2867302475 Bacteria 7087181
343 2869053735 2869048445 Bacteria 6875584
344 2880493847 2880489317 Bacteria 7096270
345 2880502398 2880495981 Bacteria 7340502
346 2996225309 2996221748 Bacteria 6799777
347 8003863392 8003856774 Bacteria 7675274
348 8003871958 8003870546 Bacteria 7396674
349 8055416876 8055412473 Bacteria 6257500
350 Ga0307514_10356523
351 rootH2_10072995
352 Ga0070658_10300511
353 Ga0070658_11048440
354 Ga0070683_100002557
355 Ga0070683_100068119
356 Ga0070683_100888871
357 Ga0070683_101612746
358 Ga0070683_101826641
359 Ga0070670_100160551
360 Ga0068869_100022834
361 Ga0070680_100493823
362 Ga0070680_100551251
363 Ga0070682_100597773
364 Ga0068868_100004256
365 Ga0070660_101784521
366 Ga0070661_100010057
367 Ga0070661_100019342
368 Ga0070692_10003629
369 Ga0070692_10539863
370 Ga0070692_10789341
371 Ga0070668_100000735
372 Ga0070668_100224935
373 Ga0070675_100023493
374 Ga0070671_100302843
375 Ga0070674_101300592
376 Ga0070688_100293108
377 Ga0070659_100090409
378 Ga0070667_101210980
379 Ga0070709_10012449
380 Ga0070709_10227932
381 Ga0070714_100021777
382 Ga0070714_100171299
383 Ga0070714_101143545
384 Ga0070714_101744124
385 Ga0070713_100013318
386 Ga0070713_100221850
387 Ga0070713_100734272
388 Ga0070710_10943081
389 Ga0070711_100113078
390 Ga0070711_100684844
391 Ga0070700_100068478
392 Ga0070694_100951501
393 Ga0070663_100135420
394 Ga0070662_100013034
395 Ga0070681_10230570
396 Ga0070685_10087358
397 Ga0070679_100061438
398 Ga0070679_100672239
399 Ga0070684_100026623
400 Ga0070684_100067391
401 Ga0070684_100133567
402 Ga0070684_100211773
403 Ga0070684_100340509
404 Ga0068853_100470981
405 Ga0070672_100447606
406 Ga0070693_101417513
407 Ga0070665_100075550
408 Ga0070665_100210320
409 Ga0070665_100460388
410 Ga0068855_101014608
411 Ga0070664_100001185
412 Ga0070664_100118922
413 Ga0070664_100455289
414 Ga0070664_100475084
415 Ga0070664_100785533
416 Ga0070664_101325344
417 Ga0068857_100093607
418 Ga0068857_100202337
419 Ga0068857_100408061
420 Ga0068856_101031369
421 Ga0068856_101097421
422 Ga0068852_100008057
423 Ga0068859_101197974
424 Ga0068864_100069738
425 Ga0068864_100161158
426 Ga0068861_100050725
427 Ga0068870_10146060
428 Ga0068863_100003607
429 Ga0068863_100063255
430 Ga0068863_100241018
431 Ga0068858_100137393
432 Ga0068858_101045604
433 Ga0068860_100121225
434 Ga0068860_100129993
435 Ga0068860_101074123
436 Ga0070712_100092766
437 Ga0097621_101715762
438 Ga0068871_100689084
439 Ga0068871_102187000
440 Ga0075430_100266864
441 Ga0075431_100285512
442 Ga0075429_100692251
443 Ga0068865_100255822
444 Ga0097620_101197993
445 Ga0105251_10636342
446 Ga0105250_10595285
447 Ga0111539_10006924
448 Ga0105245_10069645
449 Ga0105243_11827412
450 Ga0105241_10130164
451 Ga0105242_10447479
452 Ga0105248_10048817
453 Ga0105248_10122385
454 Ga0105248_10160898
455 Ga0105237_10445837
456 Ga0105237_12603000
457 Ga0105239_10892446
458 Ga0105239_10920099
459 Ga0105239_11155337
460 Ga0105239_12214380
461 Ga0157370_10430497
462 Ga0157369_10906229
463 Ga0157372_11742869
464 Ga0157372_11832831
465 Ga0157372_11894778
466 Ga0157375_10354679
467 Ga0163163_10004571
468 Ga0163163_10015648
469 Ga0163163_10171482
470 Ga0163163_10478577
471 Ga0163163_10918066
472 Ga0163163_13198320
473 Ga0157380_10281894
474 Ga0157380_10471837
475 Ga0157377_10013431
476 Ga0157377_10782838
477 Ga0157379_10384249
478 Ga0157379_10485635
479 Ga0206354_10686940
480 Ga0206353_10475108
481 Ga0206353_10830031
482 Ga0224712_10119513
483 Ga0207692_10663848
484 Ga0207688_10072357
485 Ga0207699_10301019
486 Ga0207643_10195599
487 Ga0207705_10512186
488 Ga0207654_10235768
489 Ga0207707_10372579
490 Ga0207707_10733907
491 Ga0207660_11741613
492 Ga0207662_10232993
493 Ga0207649_10030913
494 Ga0207649_10486021
495 Ga0207649_10596973
496 Ga0207652_10654588
497 Ga0207652_10750227
498 Ga0207652_10834189
499 Ga0207652_11669610
500 Ga0207681_10036262
501 Ga0207650_10300606
502 Ga0207659_10002478
503 Ga0207687_10100409
504 Ga0207700_10039437
505 Ga0207700_10430192
506 Ga0207700_11132785
507 Ga0207664_10154952
508 Ga0207664_10212559
509 Ga0207664_11047195
510 Ga0207690_10058595
511 Ga0207690_10164541
512 Ga0207706_10007095
513 Ga0207709_10088685
514 Ga0207669_11078277
515 Ga0207691_10121171
516 Ga0207711_10007526
517 Ga0207711_10323036
518 Ga0207711_10398387
519 Ga0207689_10011315
520 Ga0207661_10005907
521 Ga0207661_10016740
522 Ga0207661_10057720
523 Ga0207661_11575270
524 Ga0207679_10021569
525 Ga0207679_10149682
526 Ga0207679_10263431
527 Ga0207679_10475334
528 Ga0207651_11459734
529 Ga0207668_10000596
530 Ga0207668_10026238
531 Ga0207668_10087012
532 Ga0207677_10006013
533 Ga0207677_12257987
534 Ga0207703_10065849
535 Ga0207703_11913815
536 Ga0207678_10026779
537 Ga0207708_10098964
538 Ga0207702_10341072
539 Ga0207702_11063265
540 Ga0207702_11173644
541 Ga0207641_10008874
542 Ga0207641_10203983
543 Ga0207641_10553069
544 Ga0207641_12110296
545 Ga0207648_10297925
546 Ga0207676_10089656
547 Ga0207674_10023560
548 Ga0207674_10090376
549 Ga0207674_10129699
550 Ga0207674_10300754
551 Ga0207674_10449586
552 Ga0207675_100033593
553 Ga0207698_10069291
554 Ga0268266_10044505
555 Ga0268266_10541779
556 Ga0268266_11835543
557 Ga0268265_10060270
558 Ga0268264_10074921
559 Ga0268264_10874869
560 Ga0268264_10939670
561 Ga0307515_10002222
562 Ga0307515_10026760
563 Ga0307512_10015741
564 Ga0307513_10004690
565 Ga0307513_10134459
566 Ga0307513_10533082
567 Ga0307509_10114918
568 Ga0307508_10034957
569 Ga0307508_10421007
570 Ga0307508_10548364
571 Ga0307514_10412785
572 Ga0307516_10006730
573 Ga0307516_10008204
574 Ga0307516_10008925
575 Ga0307405_10022073
576 Ga0307405_10434980
577 Ga0307405_11220908
578 Ga0307405_11351967
579 Ga0307413_10194731
580 Ga0307413_10644477
581 Ga0307413_11320678
582 Ga0307410_10120871
583 Ga0307410_10235793
584 Ga0307410_10471881
585 Ga0307410_10778499
586 Ga0307406_10029500
587 Ga0307406_10051978
588 Ga0307406_10977539
589 Ga0307406_11031964
590 Ga0307406_11286011
591 Ga0307407_10012438
592 Ga0307407_10054716
593 Ga0307407_10680591
594 Ga0307412_10018137
595 Ga0307412_10432945
596 Ga0307409_100005930
597 Ga0307409_100092938
598 Ga0307409_100366465
599 Ga0307409_101787751
600 Ga0307409_101832464
601 Ga0307409_102830093
602 Ga0307416_100021488
603 Ga0307416_100271667
604 Ga0307416_101851309
605 Ga0307414_10461111
606 Ga0307411_10759833
607 Ga0307415_100000031
608 Ga0307415_100038820
609 Ga0307415_100233213
610 Ga0307415_100287061
611 Ga0307415_100485895
612 Ga0307415_100692647
613 Ga0307415_101749745
614 Ga0307415_101908228
615 Ga0307507_10291299
616 Ga0307507_10502128
617 Ga0307510_10386863
618 Ga0373941_0138024
619 Ga0373942_0111810
620 Ga0373962_0005896
621 Ga0373935_0045978
622 Ga0373935_1052177
623 Ga0373947_0830799
624 Ga0373937_0238032
625 Ga0395900_0124130
626 Ga0395898_0869494
627 Ga0395898_1688193
628 Ga0395905_0899827
629 Ga0395901_0016606
630 Ga0451798_0146417
631 Ga0451802_0704916
632 Ga0451853_0994605
633 Ga0451853_1195617
634 Ga0466957_0158190
635 Ga0495629_0346289
636 Ga0495638_0394244
637 Ga0495582_0354794
638 Ga0495594_0526768
639 Ga0495594_0875303
640 Ga0495608_0550854
641 Ga0495632_0008726
642 Ga0495632_0083026
643 Ga0495635_0128739
644 Ga0495657_0728004
645 Ga0495658_0785223
646 Ga0495636_0489678
647 Ga0496104_0021280
648 Ga0496104_1850251
649 Ga0496105_0050944
650 Ga0496105_0263318
651 Ga0496108_0005257
652 Ga0496109_0049048
653 Ga0496110_0153365
654 Ga0496111_0061758
655 Ga0496112_0021701
656 Ga0496112_0099725
657 Ga0496112_0100345
658 Ga0496112_0184239
659 Ga0496112_0472082
660 Ga0496113_0006089
661 Ga0496113_0089856
662 Ga0496114_1487775
663 Ga0501071_0652620
664 Ga0501075_0553359
665 Ga0501081_0825460
666 Ga0501264_063885
667 nmdc:mga0qj67_1429942_c1
668 nmdc:mga0qj67_238030_c1
669 nmdc:mga06r32_557218_c1
670 nmdc:mga08y16_14025_c1
671 nmdc:mga0n895_2083365_c1
672 Ga0500644_0417648
673 Ga0500646_0001039
674 Ga0500583_0361747
675 Ga0500583_0432010
676 Ga0500651_0160587
677 Ga0500641_0169454
678 Ga0500650_0316186
679 Ga0500594_0011966
680 Ga0500652_052004
681 Ga0500577_0153938
682 Ga0500600_0324154
683 Ga0500633_0301237
684 2623589324
685 2623590082
686 2676484743
687 2753265939
688 2855677527
689 2858853370
690 2858891412
691 2867309043
692 2869053735
693 2880493847
694 2880502398
695 2996225309
696 8003863392
697 8003871958
698 8055416876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

29

76

0.98

PF12840

HTH_20

Helix-turn-helix domain

27

78

0.97

PF09339

HTH_IclR

IclR helix-turn-helix domain

33

79

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j0e-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9589 11 82
1r1u-assembly1.cif.gz_B crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form 0.9536 7 82
1u2w-assembly1.cif.gz_B crystal structure of the staphylococcus aureus pi258 cadc 0.945 11 82
1r1u-assembly2.cif.gz_D crystal structure of the metal-sensing transcriptional repressor czra from staphylococcus aureus in the apo-form 0.9449 7 82
4ggg-assembly2.cif.gz_B crystal structure of v66a/l68v czra in the zn(ii)bound state. 0.9393 7 82
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9635 23 81 1.10.10.10
af_Q58721_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9626 9 82 1.10.10.10
af_P9WMI5_37_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9572 7 82 1.10.10.10
af_O53921_2_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9511 8 82 1.10.10.10
af_Q58948_3_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.947 23 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1V4ZUB5-F1-model_v4 Uncharacterized protein 0.9833 23 82
AF-A0A5C8JUC8-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9826 4 110 GO:0003700
AF-A0A2H9MBY5-F1-model_v4 HTH arsR-type domain-containing protein 0.9799 14 82 GO:0003700
AF-A0A7C2ZWW4-F1-model_v4 MarR family transcriptional regulator 0.9796 25 84 GO:0003677
GO:0016020
AF-X1AS84-F1-model_v4 HTH arsR-type domain-containing protein 0.9794 23 84 GO:0003700

Map