F417916

General Info

Members Datasets Scaffolds Average Seq Length
349 173 698 305

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10006112|Ga0207695_1000611213
Length 330
Sequence LPIPVHSRSSAPKGLLKLRVIFLGTPSFAVPTLERLVESGHNVLAVYTQPDRPKGRGQHVAFSPVKQAALRLGLTVHQPERIRRPEVVAELKAMAADAMVVVGYGQIIPQSIIDLPPIGIINVHGSLLPKYRGAAPIQWAIANGETMTGVTTMRIDAGLDTGDMLLKSKMEIGPDENAEQLSARLAPLGAELLAETLGGLEAQTIVPEPQNNAEATYAPILKKEDGQIDWTRPAQEIYNRMRGFTPWPGAYSTFRGQAIHIWKAKPAIDIDSGTPGSIHVRKRGAAVLCGSHTALELLEVQLEGRKRMSAEAFCNGQHLTATDRLGDMTN

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 8007371054 Clostridium sp. YIM B02515 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.72
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10006112 3300025913 Bacteria 15710
2 Ga0070658_10000944 3300005327 Bacteria 24840
3 Ga0070683_100000035 3300005329 Bacteria 122362
4 Ga0070683_100008651 3300005329 Bacteria 8652
5 Ga0070683_100078867 3300005329 Bacteria 3081
6 Ga0070666_10009199 3300005335 Bacteria 6158
7 Ga0070680_100016760 3300005336 Bacteria 5766
8 Ga0070680_100089413 3300005336 Bacteria 2548
9 Ga0070680_100195974 3300005336 Bacteria 1703
10 Ga0068868_100043783 3300005338 Bacteria 3497
11 Ga0068868_100046800 3300005338 Bacteria 3386
12 Ga0068868_100069082 3300005338 Bacteria 2815
13 Ga0070660_100000964 3300005339 Bacteria 19258
14 Ga0070660_100006653 3300005339 Bacteria 8018
15 Ga0070691_10004660 3300005341 Bacteria 6236
16 Ga0070691_10103333 3300005341 Unclassified 1418
17 Ga0070661_100077289 3300005344 Bacteria 2454
18 Ga0070667_100164146 3300005367 Bacteria 1958
19 Ga0070709_10007870 3300005434 Bacteria 5853
20 Ga0070714_100001316 3300005435 Bacteria 17938
21 Ga0070714_100251294 3300005435 Unclassified 1635
22 Ga0070713_100005251 3300005436 Bacteria 8830
23 Ga0070713_100318201 3300005436 Bacteria 1436
24 Ga0070708_100182288 3300005445 Bacteria 1963
25 Ga0070663_100310097 3300005455 Bacteria 1266
26 Ga0070681_10002161 3300005458 Bacteria 17886
27 Ga0070681_10019157 3300005458 Bacteria 6848
28 Ga0070681_10030484 3300005458 Bacteria 5412
29 Ga0070707_100377027 3300005468 Bacteria 1378
30 Ga0070698_100094040 3300005471 Bacteria 2977
31 Ga0070699_100030549 3300005518 Bacteria 4652
32 Ga0070679_100001185 3300005530 Bacteria 22886
33 Ga0070679_100001395 3300005530 Bacteria 21281
34 Ga0070679_100004611 3300005530 Bacteria 12725
35 Ga0070679_100024699 3300005530 Bacteria 5888
36 Ga0070684_100000037 3300005535 Bacteria 95058
37 Ga0070684_100028468 3300005535 Bacteria 4727
38 Ga0070697_100000694 3300005536 Bacteria 25190
39 Ga0070665_100009759 3300005548 Bacteria 9708
40 Ga0070665_100013679 3300005548 Bacteria 8165
41 Ga0070665_100133650 3300005548 Bacteria 2483
42 Ga0068855_100003034 3300005563 Bacteria 20553
43 Ga0068855_100012148 3300005563 Bacteria 10405
44 Ga0068855_100052088 3300005563 Bacteria 4819
45 Ga0068855_100109597 3300005563 Bacteria 3170
46 Ga0068857_100017037 3300005577 Bacteria 6364
47 Ga0068857_100022792 3300005577 Bacteria 5509
48 Ga0068857_100025040 3300005577 Bacteria 5256
49 Ga0068857_100111085 3300005577 Bacteria 2464
50 Ga0068856_100025657 3300005614 Bacteria 5747
51 Ga0068856_100064897 3300005614 Bacteria 3608
52 Ga0068856_100108538 3300005614 Bacteria 2772
53 Ga0068856_100210745 3300005614 Bacteria 1958
54 Ga0068852_100319766 3300005616 Unclassified 1507
55 Ga0068859_100076870 3300005617 Bacteria 3379
56 Ga0068859_100089422 3300005617 Bacteria 3130
57 Ga0068859_100216902 3300005617 Bacteria 2001
58 Ga0068864_100283501 3300005618 Bacteria 1547
59 Ga0068864_100292413 3300005618 Bacteria 1523
60 Ga0068863_100058799 3300005841 Unclassified 3638
61 Ga0068863_100140646 3300005841 Bacteria 2307
62 Ga0068858_100020811 3300005842 Bacteria 6132
63 Ga0068860_100030529 3300005843 Bacteria 5183
64 Ga0081455_10032643 3300005937 Bacteria 4689
65 Ga0070717_10005514 3300006028 Bacteria 9235
66 Ga0070712_100034335 3300006175 Bacteria 3437
67 Ga0097621_100057496 3300006237 Bacteria 3181
68 Ga0097621_100058819 3300006237 Bacteria 3145
69 Ga0097621_100315628 3300006237 Bacteria 1383
70 Ga0068871_100066082 3300006358 Bacteria 2964
71 Ga0068871_100250476 3300006358 Bacteria 1543
72 Ga0068871_100262128 3300006358 Bacteria 1508
73 Ga0068871_100434730 3300006358 Bacteria 1174
74 Ga0075428_100115988 3300006844 Bacteria 2917
75 Ga0075431_100035636 3300006847 Bacteria 5123
76 Ga0075433_10000676 3300006852 Bacteria 23175
77 Ga0075434_100000454 3300006871 Bacteria 30504
78 Ga0075429_100207730 3300006880 Bacteria 1715
79 Ga0075429_100280178 3300006880 Bacteria 1460
80 Ga0068865_100109542 3300006881 Bacteria 2035
81 Ga0097620_100076873 3300006931 Bacteria 3379
82 Ga0097620_100089420 3300006931 Bacteria 3130
83 Ga0097620_100216904 3300006931 Bacteria 2001
84 Ga0075435_100004663 3300007076 Bacteria 9448
85 Ga0105240_10000904 3300009093 Bacteria 53010
86 Ga0105240_10001456 3300009093 Bacteria 40471
87 Ga0105240_10002048 3300009093 Bacteria 33181
88 Ga0105240_10003229 3300009093 Bacteria 25527
89 Ga0105240_10099435 3300009093 Bacteria 3540
90 Ga0105240_10174958 3300009093 Bacteria 2538
91 Ga0105240_10261214 3300009093 Bacteria 1997
92 Ga0105240_10322718 3300009093 Bacteria 1759
93 Ga0105240_10446070 3300009093 Bacteria 1449
94 Ga0105240_10571551 3300009093 Bacteria 1248
95 Ga0111539_10043434 3300009094 Bacteria 5388
96 Ga0111539_10117007 3300009094 Bacteria 3125
97 Ga0105245_10002156 3300009098 Bacteria 17826
98 Ga0105245_10012128 3300009098 Bacteria 7494
99 Ga0105245_10018896 3300009098 Bacteria 6030
100 Ga0105245_10028926 3300009098 Bacteria 4892
101 Ga0114129_10355418 3300009147 Bacteria 1940
102 Ga0105243_10081801 3300009148 Unclassified 2638
103 Ga0105241_10004691 3300009174 Bacteria 10092
104 Ga0105241_10019492 3300009174 Bacteria 5002
105 Ga0105241_10025526 3300009174 Bacteria 4391
106 Ga0105241_10058284 3300009174 Bacteria 2966
107 Ga0105241_10107535 3300009174 Bacteria 2228
108 Ga0105241_10267198 3300009174 Bacteria 1456
109 Ga0105242_10011241 3300009176 Bacteria 6881
110 Ga0105242_10113453 3300009176 Bacteria 2314
111 Ga0105242_10195283 3300009176 Unclassified 1794
112 Ga0105242_10320963 3300009176 Bacteria 1420
113 Ga0105248_10080095 3300009177 Bacteria 3670
114 Ga0105237_10003893 3300009545 Bacteria 17520
115 Ga0105237_10007736 3300009545 Bacteria 11734
116 Ga0105237_10010226 3300009545 Bacteria 9998
117 Ga0105237_10029243 3300009545 Bacteria 5605
118 Ga0105237_10037792 3300009545 Bacteria 4878
119 Ga0105237_10265275 3300009545 Bacteria 1720
120 Ga0105237_10471415 3300009545 Unclassified 1261
121 Ga0105238_10025711 3300009551 Bacteria 6003
122 Ga0105238_10032757 3300009551 Bacteria 5290
123 Ga0105238_10064506 3300009551 Bacteria 3663
124 Ga0105238_10071939 3300009551 Bacteria 3455
125 Ga0105249_10009429 3300009553 Bacteria 8544
126 Ga0105249_10339080 3300009553 Bacteria 1519
127 Ga0105239_10010547 3300010375 Bacteria 10332
128 Ga0105239_10020556 3300010375 Bacteria 7283
129 Ga0105239_10091793 3300010375 Bacteria 3351
130 Ga0105239_10198660 3300010375 Bacteria 2246
131 Ga0105246_10004304 3300011119 Bacteria 8660
132 Ga0105246_10015302 3300011119 Bacteria 4842
133 Ga0105246_10146269 3300011119 Bacteria 1783
134 Ga0157370_10003670 3300013104 Bacteria 17924
135 Ga0157370_10004975 3300013104 Bacteria 15044
136 Ga0157370_10062329 3300013104 Bacteria 3537
137 Ga0157370_10074183 3300013104 Bacteria 3209
138 Ga0157370_10547722 3300013104 Bacteria 1061
139 Ga0157369_10003469 3300013105 Bacteria 18709
140 Ga0157369_10003568 3300013105 Bacteria 18484
141 Ga0157369_10018639 3300013105 Bacteria 7781
142 Ga0157369_10101577 3300013105 Bacteria 3065
143 Ga0157369_10143159 3300013105 Bacteria 2529
144 Ga0157374_10045733 3300013296 Bacteria 4051
145 Ga0157374_10084966 3300013296 Unclassified 3009
146 Ga0157374_10139231 3300013296 Bacteria 2355
147 Ga0157374_10406909 3300013296 Bacteria 1358
148 Ga0157378_10276771 3300013297 Bacteria 1616
149 Ga0157378_10472245 3300013297 Bacteria 1248
150 Ga0163162_10020819 3300013306 Bacteria 6448
151 Ga0163162_10042380 3300013306 Bacteria 4556
152 Ga0163162_10750684 3300013306 Bacteria 1095
153 Ga0157372_10005248 3300013307 Bacteria 13762
154 Ga0157372_10118138 3300013307 Bacteria 3042
155 Ga0157375_10060699 3300013308 Bacteria 3751
156 Ga0157375_10419455 3300013308 Unclassified 1504
157 Ga0163163_10049024 3300014325 Bacteria 4155
158 Ga0163163_10083023 3300014325 Bacteria 3209
159 Ga0163163_10178213 3300014325 Bacteria 2172
160 Ga0163163_10304263 3300014325 Bacteria 1647
161 Ga0157379_10039454 3300014968 Bacteria 4213
162 Ga0157379_10080240 3300014968 Unclassified 2923
163 Ga0157379_10133636 3300014968 Bacteria 2234
164 Ga0157376_10059744 3300014969 Bacteria 3197
165 Ga0157376_10156254 3300014969 Bacteria 2063
166 Ga0213876_10006177 3300021384 Bacteria 6535
167 Ga0213875_10004172 3300021388 Bacteria 7999
168 Ga0213875_10010459 3300021388 Bacteria 4642
169 Ga0207680_10001465 3300025903 Bacteria 11179
170 Ga0207705_10005460 3300025909 Bacteria 9505
171 Ga0207684_10027576 3300025910 Bacteria 4837
172 Ga0207654_10037446 3300025911 Bacteria 2716
173 Ga0207707_10001469 3300025912 Bacteria 21804
174 Ga0207707_10002540 3300025912 Bacteria 16376
175 Ga0207707_10013981 3300025912 Bacteria 6999
176 Ga0207707_10024120 3300025912 Bacteria 5320
177 Ga0207707_10300983 3300025912 Bacteria 1387
178 Ga0207695_10000770 3300025913 Bacteria 60994
179 Ga0207695_10003871 3300025913 Bacteria 20713
180 Ga0207695_10015143 3300025913 Bacteria 9095
181 Ga0207695_10114870 3300025913 Bacteria 2667
182 Ga0207695_10197582 3300025913 Bacteria 1927
183 Ga0207695_10266068 3300025913 Bacteria 1611
184 Ga0207695_10437618 3300025913 Bacteria 1191
185 Ga0207671_10005189 3300025914 Bacteria 12108
186 Ga0207671_10015635 3300025914 Bacteria 5933
187 Ga0207671_10047579 3300025914 Bacteria 3175
188 Ga0207671_10196651 3300025914 Bacteria 1573
189 Ga0207660_10001026 3300025917 Bacteria 18496
190 Ga0207660_10024648 3300025917 Bacteria 4075
191 Ga0207657_10002306 3300025919 Bacteria 20684
192 Ga0207657_10116390 3300025919 Bacteria 2203
193 Ga0207649_10113926 3300025920 Bacteria 1812
194 Ga0207652_10000885 3300025921 Bacteria 28349
195 Ga0207652_10006572 3300025921 Bacteria 9372
196 Ga0207652_10009897 3300025921 Bacteria 7671
197 Ga0207694_10000484 3300025924 Bacteria 36222
198 Ga0207694_10005449 3300025924 Bacteria 9789
199 Ga0207694_10046448 3300025924 Bacteria 3356
200 Ga0207694_10136435 3300025924 Bacteria 1971
201 Ga0207687_10058699 3300025927 Bacteria 2708
202 Ga0207687_10081065 3300025927 Bacteria 2344
203 Ga0207687_10161699 3300025927 Bacteria 1719
204 Ga0207700_10002914 3300025928 Bacteria 9859
205 Ga0207700_10100364 3300025928 Bacteria 2307
206 Ga0207686_10017121 3300025934 Bacteria 4078
207 Ga0207686_10024345 3300025934 Bacteria 3507
208 Ga0207686_10032314 3300025934 Bacteria 3114
209 Ga0207686_10043339 3300025934 Bacteria 2756
210 Ga0207686_10052481 3300025934 Bacteria 2545
211 Ga0207686_10181786 3300025934 Bacteria 1492
212 Ga0207670_10022647 3300025936 Bacteria 3897
213 Ga0207704_10113279 3300025938 Bacteria 1839
214 Ga0207665_10115658 3300025939 Bacteria 1890
215 Ga0207691_10371096 3300025940 Unclassified 1222
216 Ga0207711_10000701 3300025941 Bacteria 33020
217 Ga0207711_10092261 3300025941 Bacteria 2665
218 Ga0207711_10137510 3300025941 Bacteria 2195
219 Ga0207661_10000008 3300025944 Bacteria 451211
220 Ga0207661_10002207 3300025944 Bacteria 13431
221 Ga0207667_10001669 3300025949 Bacteria 27969
222 Ga0207667_10005331 3300025949 Bacteria 15672
223 Ga0207667_10022036 3300025949 Bacteria 7049
224 Ga0207651_10189121 3300025960 Bacteria 1641
225 Ga0207640_10078651 3300025981 Bacteria 2246
226 Ga0207677_10019576 3300026023 Bacteria 4091
227 Ga0207677_10040980 3300026023 Bacteria 3059
228 Ga0207677_10127425 3300026023 Bacteria 1926
229 Ga0207703_10038231 3300026035 Bacteria 3828
230 Ga0207703_10096815 3300026035 Bacteria 2492
231 Ga0207703_10281080 3300026035 Bacteria 1511
232 Ga0207639_10070705 3300026041 Bacteria 2727
233 Ga0207678_10008013 3300026067 Bacteria 9316
234 Ga0207702_10026789 3300026078 Bacteria 4787
235 Ga0207702_10068219 3300026078 Bacteria 3055
236 Ga0207702_10143972 3300026078 Bacteria 2160
237 Ga0207641_10058025 3300026088 Bacteria 3293
238 Ga0207648_10020471 3300026089 Bacteria 5957
239 Ga0207674_10006628 3300026116 Bacteria 13604
240 Ga0207674_10010952 3300026116 Bacteria 10207
241 Ga0207674_10018657 3300026116 Bacteria 7535
242 Ga0207674_10038585 3300026116 Bacteria 4955
243 Ga0207674_10088817 3300026116 Bacteria 3083
244 Ga0207674_10373723 3300026116 Bacteria 1378
245 Ga0207698_10345241 3300026142 Unclassified 1404
246 Ga0207428_10111921 3300027907 Bacteria 2100
247 Ga0268266_10008821 3300028379 Bacteria 8928
248 Ga0268266_10115168 3300028379 Bacteria 2386
249 Ga0268266_10176606 3300028379 Bacteria 1942
250 Ga0268264_10014414 3300028381 Bacteria 6496
251 Ga0268264_10284304 3300028381 Bacteria 1551
252 Ga0265323_10000697 3300028653 Bacteria 18238
253 Ga0265338_10000497 3300028800 Bacteria 70113
254 Ga0265338_10188100 3300028800 Bacteria 1567
255 Ga0265338_10205595 3300028800 Unclassified 1482
256 Ga0265338_10304015 3300028800 Bacteria 1159
257 Ga0265320_10009889 3300031240 Bacteria 5714
258 Ga0265325_10089857 3300031241 Bacteria 1516
259 Ga0265339_10060070 3300031249 Bacteria 2049
260 Ga0265331_10006153 3300031250 Bacteria 7136
261 Ga0265316_10006205 3300031344 Bacteria 11456
262 Ga0265316_10022182 3300031344 Bacteria 5361
263 Ga0265316_10041585 3300031344 Bacteria 3677
264 Ga0265316_10204955 3300031344 Bacteria 1461
265 Ga0265313_10002310 3300031595 Bacteria 16709
266 Ga0265313_10073807 3300031595 Bacteria 1565
267 Ga0265314_10000961 3300031711 Bacteria 33842
268 Ga0265314_10001577 3300031711 Bacteria 25037
269 Ga0265314_10008835 3300031711 Bacteria 8606
270 Ga0265342_10199880 3300031712 Bacteria 1087
271 Ga0373923_0072145 3300035111 Unclassified 1484
272 Ga0373953_0014045 3300035117 Bacteria 2873
273 Ga0373953_0090206 3300035117 Bacteria 1281
274 Ga0373954_0079414 3300035118 Bacteria 1566
275 Ga0373955_0055891 3300035172 Bacteria 2163
276 Ga0373927_0000212 3300035695 Bacteria 46178
277 Ga0373933_0015424 3300035724 Bacteria 4258
278 Ga0373947_0026681 3300035725 Bacteria 3378
279 Ga0373937_0006149 3300036401 Bacteria 10338
280 Ga0373937_0006208 3300036401 Bacteria 10296
281 Ga0373937_0059532 3300036401 Bacteria 3510
282 Ga0373937_0313702 3300036401 Bacteria 1483
283 Ga0373925_0024436 3300037068 Bacteria 4412
284 Ga0373925_0285987 3300037068 Bacteria 1329
285 Ga0436364_0660056 3300037853 Bacteria 4490
286 Ga0436364_0806365 3300037853 Bacteria 2209
287 Ga0436364_1194151 3300037853 Bacteria 7993
288 Ga0436364_1438291 3300037853 Bacteria 2015
289 Ga0395901_0268788 3300038443 Bacteria 1774
290 Ga0436365_0516192 3300039437 Bacteria 4349
291 Ga0436365_0950800 3300039437 Bacteria 4309
292 Ga0436365_1228907 3300039437 Bacteria 1084
293 Ga0436365_1330341 3300039437 Bacteria 32804
294 Ga0436365_1751127 3300039437 Bacteria 5277
295 Ga0451807_2368605 3300041486 Bacteria 1164
296 Ga0451849_0311353 3300041505 Bacteria 1347
297 Ga0451576_0097819 3300045051 Unclassified 3052
298 Ga0466967_0039208 3300045976 Bacteria 4070
299 Ga0495651_0216700 3300046462 Bacteria 1328
300 Ga0495580_0031984 3300046472 Bacteria 3799
301 Ga0495634_0056329 3300046642 Bacteria 2627
302 Ga0495658_0013003 3300046683 Bacteria 4229
303 Ga0495658_0190452 3300046683 Bacteria 1275
304 Ga0495674_0207527 3300047319 Bacteria 1624
305 Ga0495675_0089437 3300047444 Bacteria 1933
306 Ga0496102_0422560 3300048905 Bacteria 1252
307 Ga0496104_0408537 3300048907 Bacteria 1270
308 Ga0496112_0007563 3300048915 Bacteria 9651
309 Ga0496112_0076027 3300048915 Bacteria 3321
310 Ga0496115_0106533 3300048918 Bacteria 2301
311 Ga0496116_0107523 3300048919 Bacteria 1649
312 Ga0496122_0013980 3300048925 Bacteria 7802
313 Ga0496126_0181806 3300048929 Bacteria 1786
314 Ga0501031_0017604 3300049568 Bacteria 4645
315 Ga0501032_0004566 3300049569 Bacteria 10416
316 Ga0501033_0005926 3300049570 Bacteria 9593
317 Ga0501033_0108275 3300049570 Bacteria 2024
318 Ga0501034_0060903 3300049571 Bacteria 3792
319 Ga0501034_0166746 3300049571 Bacteria 2171
320 Ga0501038_0010069 3300049574 Bacteria 8655
321 Ga0501039_0006052 3300049575 Bacteria 9184
322 Ga0501043_0063593 3300049579 Bacteria 2898
323 Ga0501046_0005846 3300049580 Bacteria 10972
324 Ga0501046_0035547 3300049580 Bacteria 4015
325 Ga0501046_0283349 3300049580 Unclassified 1214
326 Ga0501047_0022941 3300049581 Bacteria 5992
327 Ga0501068_0028782 3300049584 Bacteria 3288
328 Ga0501069_0002023 3300049585 Bacteria 10158
329 Ga0501070_0244838 3300049586 Bacteria 1467
330 Ga0501071_0321874 3300049587 Bacteria 1174
331 Ga0501072_0007636 3300049588 Bacteria 8209
332 Ga0501077_0007750 3300049593 Bacteria 6626
333 Ga0501080_0002097 3300049742 Bacteria 17309
334 Ga0501035_0012948 3300049822 Bacteria 7699
335 Ga0501044_0002122 3300049823 Bacteria 22757
336 Ga0501044_0006793 3300049823 Bacteria 12609
337 Ga0501044_0233634 3300049823 Bacteria 1785
338 Ga0501045_0068888 3300049824 Bacteria 2600
339 nmdc:mga05p37_248162_c2 3300050507 Bacteria 1534
340 nmdc:mga09592_136436_c1 3300050508 Bacteria 2113
341 nmdc:mga06r32_70506_c1 3300050510 Bacteria 3380
342 nmdc:mga08y16_105977_c1 3300050511 Bacteria 2926
343 nmdc:mga08y16_196565_c1 3300050511 Bacteria 2090
344 nmdc:mga0n895_32136_c1 3300050512 Bacteria 5035
345 nmdc:mga0rr50_5376_c1 3300050513 Bacteria 7631
346 nmdc:mga0a205_2300_c1 3300050515 Bacteria 16858
347 Ga0495601_0089897 3300053077 Bacteria 1975
348 Ga0501084_0003103 3300054114 Bacteria 13470
349 8007373346 8007371054 Bacteria 4849201
350 Ga0207695_10006112
351 Ga0070658_10000944
352 Ga0070683_100000035
353 Ga0070683_100008651
354 Ga0070683_100078867
355 Ga0070666_10009199
356 Ga0070680_100016760
357 Ga0070680_100089413
358 Ga0070680_100195974
359 Ga0068868_100043783
360 Ga0068868_100046800
361 Ga0068868_100069082
362 Ga0070660_100000964
363 Ga0070660_100006653
364 Ga0070691_10004660
365 Ga0070691_10103333
366 Ga0070661_100077289
367 Ga0070667_100164146
368 Ga0070709_10007870
369 Ga0070714_100001316
370 Ga0070714_100251294
371 Ga0070713_100005251
372 Ga0070713_100318201
373 Ga0070708_100182288
374 Ga0070663_100310097
375 Ga0070681_10002161
376 Ga0070681_10019157
377 Ga0070681_10030484
378 Ga0070707_100377027
379 Ga0070698_100094040
380 Ga0070699_100030549
381 Ga0070679_100001185
382 Ga0070679_100001395
383 Ga0070679_100004611
384 Ga0070679_100024699
385 Ga0070684_100000037
386 Ga0070684_100028468
387 Ga0070697_100000694
388 Ga0070665_100009759
389 Ga0070665_100013679
390 Ga0070665_100133650
391 Ga0068855_100003034
392 Ga0068855_100012148
393 Ga0068855_100052088
394 Ga0068855_100109597
395 Ga0068857_100017037
396 Ga0068857_100022792
397 Ga0068857_100025040
398 Ga0068857_100111085
399 Ga0068856_100025657
400 Ga0068856_100064897
401 Ga0068856_100108538
402 Ga0068856_100210745
403 Ga0068852_100319766
404 Ga0068859_100076870
405 Ga0068859_100089422
406 Ga0068859_100216902
407 Ga0068864_100283501
408 Ga0068864_100292413
409 Ga0068863_100058799
410 Ga0068863_100140646
411 Ga0068858_100020811
412 Ga0068860_100030529
413 Ga0081455_10032643
414 Ga0070717_10005514
415 Ga0070712_100034335
416 Ga0097621_100057496
417 Ga0097621_100058819
418 Ga0097621_100315628
419 Ga0068871_100066082
420 Ga0068871_100250476
421 Ga0068871_100262128
422 Ga0068871_100434730
423 Ga0075428_100115988
424 Ga0075431_100035636
425 Ga0075433_10000676
426 Ga0075434_100000454
427 Ga0075429_100207730
428 Ga0075429_100280178
429 Ga0068865_100109542
430 Ga0097620_100076873
431 Ga0097620_100089420
432 Ga0097620_100216904
433 Ga0075435_100004663
434 Ga0105240_10000904
435 Ga0105240_10001456
436 Ga0105240_10002048
437 Ga0105240_10003229
438 Ga0105240_10099435
439 Ga0105240_10174958
440 Ga0105240_10261214
441 Ga0105240_10322718
442 Ga0105240_10446070
443 Ga0105240_10571551
444 Ga0111539_10043434
445 Ga0111539_10117007
446 Ga0105245_10002156
447 Ga0105245_10012128
448 Ga0105245_10018896
449 Ga0105245_10028926
450 Ga0114129_10355418
451 Ga0105243_10081801
452 Ga0105241_10004691
453 Ga0105241_10019492
454 Ga0105241_10025526
455 Ga0105241_10058284
456 Ga0105241_10107535
457 Ga0105241_10267198
458 Ga0105242_10011241
459 Ga0105242_10113453
460 Ga0105242_10195283
461 Ga0105242_10320963
462 Ga0105248_10080095
463 Ga0105237_10003893
464 Ga0105237_10007736
465 Ga0105237_10010226
466 Ga0105237_10029243
467 Ga0105237_10037792
468 Ga0105237_10265275
469 Ga0105237_10471415
470 Ga0105238_10025711
471 Ga0105238_10032757
472 Ga0105238_10064506
473 Ga0105238_10071939
474 Ga0105249_10009429
475 Ga0105249_10339080
476 Ga0105239_10010547
477 Ga0105239_10020556
478 Ga0105239_10091793
479 Ga0105239_10198660
480 Ga0105246_10004304
481 Ga0105246_10015302
482 Ga0105246_10146269
483 Ga0157370_10003670
484 Ga0157370_10004975
485 Ga0157370_10062329
486 Ga0157370_10074183
487 Ga0157370_10547722
488 Ga0157369_10003469
489 Ga0157369_10003568
490 Ga0157369_10018639
491 Ga0157369_10101577
492 Ga0157369_10143159
493 Ga0157374_10045733
494 Ga0157374_10084966
495 Ga0157374_10139231
496 Ga0157374_10406909
497 Ga0157378_10276771
498 Ga0157378_10472245
499 Ga0163162_10020819
500 Ga0163162_10042380
501 Ga0163162_10750684
502 Ga0157372_10005248
503 Ga0157372_10118138
504 Ga0157375_10060699
505 Ga0157375_10419455
506 Ga0163163_10049024
507 Ga0163163_10083023
508 Ga0163163_10178213
509 Ga0163163_10304263
510 Ga0157379_10039454
511 Ga0157379_10080240
512 Ga0157379_10133636
513 Ga0157376_10059744
514 Ga0157376_10156254
515 Ga0213876_10006177
516 Ga0213875_10004172
517 Ga0213875_10010459
518 Ga0207680_10001465
519 Ga0207705_10005460
520 Ga0207684_10027576
521 Ga0207654_10037446
522 Ga0207707_10001469
523 Ga0207707_10002540
524 Ga0207707_10013981
525 Ga0207707_10024120
526 Ga0207707_10300983
527 Ga0207695_10000770
528 Ga0207695_10003871
529 Ga0207695_10015143
530 Ga0207695_10114870
531 Ga0207695_10197582
532 Ga0207695_10266068
533 Ga0207695_10437618
534 Ga0207671_10005189
535 Ga0207671_10015635
536 Ga0207671_10047579
537 Ga0207671_10196651
538 Ga0207660_10001026
539 Ga0207660_10024648
540 Ga0207657_10002306
541 Ga0207657_10116390
542 Ga0207649_10113926
543 Ga0207652_10000885
544 Ga0207652_10006572
545 Ga0207652_10009897
546 Ga0207694_10000484
547 Ga0207694_10005449
548 Ga0207694_10046448
549 Ga0207694_10136435
550 Ga0207687_10058699
551 Ga0207687_10081065
552 Ga0207687_10161699
553 Ga0207700_10002914
554 Ga0207700_10100364
555 Ga0207686_10017121
556 Ga0207686_10024345
557 Ga0207686_10032314
558 Ga0207686_10043339
559 Ga0207686_10052481
560 Ga0207686_10181786
561 Ga0207670_10022647
562 Ga0207704_10113279
563 Ga0207665_10115658
564 Ga0207691_10371096
565 Ga0207711_10000701
566 Ga0207711_10092261
567 Ga0207711_10137510
568 Ga0207661_10000008
569 Ga0207661_10002207
570 Ga0207667_10001669
571 Ga0207667_10005331
572 Ga0207667_10022036
573 Ga0207651_10189121
574 Ga0207640_10078651
575 Ga0207677_10019576
576 Ga0207677_10040980
577 Ga0207677_10127425
578 Ga0207703_10038231
579 Ga0207703_10096815
580 Ga0207703_10281080
581 Ga0207639_10070705
582 Ga0207678_10008013
583 Ga0207702_10026789
584 Ga0207702_10068219
585 Ga0207702_10143972
586 Ga0207641_10058025
587 Ga0207648_10020471
588 Ga0207674_10006628
589 Ga0207674_10010952
590 Ga0207674_10018657
591 Ga0207674_10038585
592 Ga0207674_10088817
593 Ga0207674_10373723
594 Ga0207698_10345241
595 Ga0207428_10111921
596 Ga0268266_10008821
597 Ga0268266_10115168
598 Ga0268266_10176606
599 Ga0268264_10014414
600 Ga0268264_10284304
601 Ga0265323_10000697
602 Ga0265338_10000497
603 Ga0265338_10188100
604 Ga0265338_10205595
605 Ga0265338_10304015
606 Ga0265320_10009889
607 Ga0265325_10089857
608 Ga0265339_10060070
609 Ga0265331_10006153
610 Ga0265316_10006205
611 Ga0265316_10022182
612 Ga0265316_10041585
613 Ga0265316_10204955
614 Ga0265313_10002310
615 Ga0265313_10073807
616 Ga0265314_10000961
617 Ga0265314_10001577
618 Ga0265314_10008835
619 Ga0265342_10199880
620 Ga0373923_0072145
621 Ga0373953_0014045
622 Ga0373953_0090206
623 Ga0373954_0079414
624 Ga0373955_0055891
625 Ga0373927_0000212
626 Ga0373933_0015424
627 Ga0373947_0026681
628 Ga0373937_0006149
629 Ga0373937_0006208
630 Ga0373937_0059532
631 Ga0373937_0313702
632 Ga0373925_0024436
633 Ga0373925_0285987
634 Ga0436364_0660056
635 Ga0436364_0806365
636 Ga0436364_1194151
637 Ga0436364_1438291
638 Ga0395901_0268788
639 Ga0436365_0516192
640 Ga0436365_0950800
641 Ga0436365_1228907
642 Ga0436365_1330341
643 Ga0436365_1751127
644 Ga0451807_2368605
645 Ga0451849_0311353
646 Ga0451576_0097819
647 Ga0466967_0039208
648 Ga0495651_0216700
649 Ga0495580_0031984
650 Ga0495634_0056329
651 Ga0495658_0013003
652 Ga0495658_0190452
653 Ga0495674_0207527
654 Ga0495675_0089437
655 Ga0496102_0422560
656 Ga0496104_0408537
657 Ga0496112_0007563
658 Ga0496112_0076027
659 Ga0496115_0106533
660 Ga0496116_0107523
661 Ga0496122_0013980
662 Ga0496126_0181806
663 Ga0501031_0017604
664 Ga0501032_0004566
665 Ga0501033_0005926
666 Ga0501033_0108275
667 Ga0501034_0060903
668 Ga0501034_0166746
669 Ga0501038_0010069
670 Ga0501039_0006052
671 Ga0501043_0063593
672 Ga0501046_0005846
673 Ga0501046_0035547
674 Ga0501046_0283349
675 Ga0501047_0022941
676 Ga0501068_0028782
677 Ga0501069_0002023
678 Ga0501070_0244838
679 Ga0501071_0321874
680 Ga0501072_0007636
681 Ga0501077_0007750
682 Ga0501080_0002097
683 Ga0501035_0012948
684 Ga0501044_0002122
685 Ga0501044_0006793
686 Ga0501044_0233634
687 Ga0501045_0068888
688 nmdc:mga05p37_248162_c2
689 nmdc:mga09592_136436_c1
690 nmdc:mga06r32_70506_c1
691 nmdc:mga08y16_105977_c1
692 nmdc:mga08y16_196565_c1
693 nmdc:mga0n895_32136_c1
694 nmdc:mga0rr50_5376_c1
695 nmdc:mga0a205_2300_c1
696 Ga0495601_0089897
697 Ga0501084_0003103
698 8007373346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

17

197

0.97

PF02911

Formyl_trans_C

Formyl transferase, C-terminal domain

220

318

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9588 1 303
4iqf-assembly2.cif.gz_B crystal structure of methyionyl-trna formyltransferase from bacillus anthracis 0.9466 1 303
3tqq-assembly1.cif.gz_A structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii 0.9431 2 306
5uai-assembly1.cif.gz_A crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa 0.935 2 306
2fmt-assembly2.cif.gz_B methionyl-trnafmet formyltransferase complexed with formyl-methionyl-trnafmet 0.9345 2 304
ID Description Score Start End Superfamily
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9723 2 203 3.40.50.170
af_B4FRN6_28_246_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9613 2 203 3.40.50.170
3rfoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9607 2 203 3.40.50.170
3tqqA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9574 2 203 3.40.50.170
af_P9WND3_1_310_3.40.50.12230 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9467 1 302 3.40.50.12230
ID Description Score Start End GO Terms
AF-A0A2V7K666-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9909 1 124 GO:0004479
GO:0005829
AF-A0A3B9VCC8-F1-model_v4 Methionyl-tRNA formyltransferase 0.9872 1 96 GO:0004479
GO:0005829
AF-A0A3B9LRQ6-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9858 1 244 GO:0004479
GO:0005829
AF-A0A3B8JDQ4-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9851 1 223 GO:0004479
GO:0005829
AF-A0A7C7KXL8-F1-model_v4 methionyl-tRNA formyltransferase (EC 2.1.2.9) 0.9845 1 239 GO:0004479
GO:0005829

Map