F417712

General Info

Members Datasets Scaffolds Average Seq Length
348 145 696 143

Family's Representative Sequence

Representative Sequence 3300049704|Ga0501221_222406|Ga0501221_222406_41_469
Length 142
Sequence MLSITSSTAIKAVIYLANLDRSDKASIRDIAAAVGGSEHTVGKLLQALVKAGLVCSYKGPTGGFYLTTRQMNQPIIHIINAIDGRQVFDQCGLGLSKCSAAHPCPIHDEYMVIRNEFKALCQRNTINNLRETVDEGLSYLVV

Samples

Sample ID Description Type Environment
1 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
96 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
97 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
98 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
99 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
120 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
121 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
122 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
123 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
124 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
125 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
126 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
127 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
128 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
129 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
130 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
134 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
135 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
136 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
137 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
138 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 0
Rhizosphere 99.14
Stem 0
Stem Tuber 0
Unclassified 17.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501221_222406 3300049704 Viruses 533
2 JGI24736J21556_1008437 3300001904 Unclassified 1713
3 Ga0055535_1002458 3300003761 Bacteria 6448
4 Ga0065715_10476210 3300005293 Bacteria 767
5 Ga0070658_10000019 3300005327 Bacteria 194742
6 Ga0070658_10382041 3300005327 Bacteria 1208
7 Ga0070658_10458850 3300005327 Unclassified 1098
8 Ga0070658_11099579 3300005327 Bacteria 691
9 Ga0070683_100393701 3300005329 Bacteria 1321
10 Ga0070683_100559758 3300005329 Bacteria 1093
11 Ga0070670_100072328 3300005331 Bacteria 2961
12 Ga0070677_10134791 3300005333 Bacteria 1132
13 Ga0070677_10278982 3300005333 Bacteria 841
14 Ga0070680_100061507 3300005336 Bacteria 3074
15 Ga0070680_100580698 3300005336 Bacteria 961
16 Ga0070682_100085879 3300005337 Bacteria 2048
17 Ga0070682_100238659 3300005337 Bacteria 1304
18 Ga0070660_100003976 3300005339 Bacteria 10216
19 Ga0070660_100214072 3300005339 Bacteria 1565
20 Ga0070660_100425101 3300005339 Bacteria 1100
21 Ga0070660_100659133 3300005339 Bacteria 877
22 Ga0070661_100950271 3300005344 Bacteria 711
23 Ga0070692_10069222 3300005345 Bacteria 1877
24 Ga0070692_10288297 3300005345 Bacteria 998
25 Ga0070669_101616416 3300005353 Unclassified 564
26 Ga0070675_100711643 3300005354 Bacteria 915
27 Ga0070671_100291765 3300005355 Unclassified 1388
28 Ga0070674_100408422 3300005356 Bacteria 1111
29 Ga0070673_100047674 3300005364 Bacteria 3335
30 Ga0070659_100104364 3300005366 Unclassified 2283
31 Ga0070659_100233068 3300005366 Bacteria 1522
32 Ga0070659_100427771 3300005366 Bacteria 1120
33 Ga0070659_100497901 3300005366 Bacteria 1038
34 Ga0070659_101729384 3300005366 Bacteria 560
35 Ga0070714_101362361 3300005435 Bacteria 693
36 Ga0070663_100014149 3300005455 Bacteria 5114
37 Ga0070663_100074391 3300005455 Bacteria 2481
38 Ga0070678_100062013 3300005456 Bacteria 2758
39 Ga0070678_100611099 3300005456 Bacteria 974
40 Ga0070681_10002858 3300005458 Bacteria 15964
41 Ga0070681_10141321 3300005458 Bacteria 2337
42 Ga0070681_10154384 3300005458 Bacteria 2221
43 Ga0070681_10896049 3300005458 Bacteria 805
44 Ga0068867_100329162 3300005459 Unclassified 1268
45 Ga0068867_100458641 3300005459 Bacteria 1088
46 Ga0070679_100000437 3300005530 Bacteria 35450
47 Ga0070679_100001254 3300005530 Bacteria 22385
48 Ga0070679_100207131 3300005530 Bacteria 1925
49 Ga0070679_100817940 3300005530 Bacteria 875
50 Ga0070679_100901805 3300005530 Unclassified 827
51 Ga0070679_101101604 3300005530 Bacteria 739
52 Ga0070679_101472573 3300005530 Unclassified 627
53 Ga0070679_102020510 3300005530 Unclassified 525
54 Ga0068853_100028746 3300005539 Bacteria 4679
55 Ga0068853_100182895 3300005539 Bacteria 1901
56 Ga0070672_100412562 3300005543 Unclassified 1159
57 Ga0070672_100748979 3300005543 Bacteria 857
58 Ga0070672_100798919 3300005543 Bacteria 830
59 Ga0070672_100904932 3300005543 Unclassified 779
60 Ga0068855_100011848 3300005563 Bacteria 10543
61 Ga0068855_100012847 3300005563 Bacteria 10103
62 Ga0068855_100082492 3300005563 Bacteria 3726
63 Ga0068855_100208671 3300005563 Bacteria 2196
64 Ga0068855_101438258 3300005563 Unclassified 709
65 Ga0068855_101787938 3300005563 Unclassified 625
66 Ga0068855_102048879 3300005563 Unclassified 577
67 Ga0068857_100110628 3300005577 Bacteria 2469
68 Ga0068857_100178973 3300005577 Unclassified 1929
69 Ga0068854_100051590 3300005578 Bacteria 2948
70 Ga0068856_100042472 3300005614 Bacteria 4473
71 Ga0068856_100222678 3300005614 Bacteria 1902
72 Ga0068852_100004426 3300005616 Bacteria 9930
73 Ga0068852_100007776 3300005616 Bacteria 7847
74 Ga0068852_100092711 3300005616 Bacteria 2706
75 Ga0068858_100366421 3300005842 Unclassified 1381
76 Ga0068860_100000034 3300005843 Bacteria 243128
77 Ga0097621_100173046 3300006237 Unclassified 1862
78 Ga0068871_100297558 3300006358 Bacteria 1416
79 Ga0068871_100481645 3300006358 Bacteria 1116
80 Ga0068871_100723934 3300006358 Bacteria 913
81 Ga0105240_10330016 3300009093 Bacteria 1736
82 Ga0105240_10428472 3300009093 Bacteria 1485
83 Ga0111539_10179030 3300009094 Bacteria 2477
84 Ga0111539_10198896 3300009094 Bacteria 2337
85 Ga0111539_10882771 3300009094 Bacteria 1040
86 Ga0105241_10025980 3300009174 Bacteria 4355
87 Ga0105241_11071309 3300009174 Bacteria 757
88 Ga0105237_10039362 3300009545 Bacteria 4772
89 Ga0105237_10084200 3300009545 Bacteria 3171
90 Ga0105238_10043542 3300009551 Bacteria 4542
91 Ga0105238_11804883 3300009551 Unclassified 644
92 Ga0105249_12881156 3300009553 Bacteria 552
93 Ga0105239_10156376 3300010375 Bacteria 2546
94 Ga0105239_10246434 3300010375 Bacteria 2006
95 Ga0157373_10022186 3300013100 Bacteria 4606
96 Ga0157373_10028636 3300013100 Bacteria 4018
97 Ga0157373_10037257 3300013100 Bacteria 3487
98 Ga0157373_10052245 3300013100 Bacteria 2909
99 Ga0157373_10052592 3300013100 Bacteria 2898
100 Ga0157373_10366354 3300013100 Bacteria 1029
101 Ga0157373_10391340 3300013100 Unclassified 995
102 Ga0157373_10846345 3300013100 Bacteria 676
103 Ga0157371_10003669 3300013102 Bacteria 13798
104 Ga0157371_10007478 3300013102 Bacteria 8842
105 Ga0157371_10010599 3300013102 Bacteria 7162
106 Ga0157371_10010910 3300013102 Bacteria 7045
107 Ga0157371_10011496 3300013102 Bacteria 6810
108 Ga0157371_10016576 3300013102 Bacteria 5496
109 Ga0157371_10048439 3300013102 Bacteria 3020
110 Ga0157371_10050970 3300013102 Bacteria 2941
111 Ga0157371_10062314 3300013102 Unclassified 2644
112 Ga0157371_10070445 3300013102 Unclassified 2475
113 Ga0157371_10120752 3300013102 Unclassified 1863
114 Ga0157371_10228587 3300013102 Bacteria 1337
115 Ga0157371_10490828 3300013102 Bacteria 906
116 Ga0157371_10969596 3300013102 Unclassified 647
117 Ga0157371_11097458 3300013102 Unclassified 610
118 Ga0157370_10000651 3300013104 Bacteria 43302
119 Ga0157370_10051456 3300013104 Bacteria 3935
120 Ga0157370_10134793 3300013104 Bacteria 2302
121 Ga0157370_10141726 3300013104 Bacteria 2240
122 Ga0157370_10170245 3300013104 Bacteria 2025
123 Ga0157370_10204485 3300013104 Bacteria 1831
124 Ga0157370_10395142 3300013104 Bacteria 1273
125 Ga0157370_10634304 3300013104 Unclassified 977
126 Ga0157369_10036108 3300013105 Bacteria 5416
127 Ga0157369_10154298 3300013105 Bacteria 2426
128 Ga0157369_10163344 3300013105 Bacteria 2350
129 Ga0157369_10185458 3300013105 Bacteria 2188
130 Ga0157369_10223440 3300013105 Unclassified 1970
131 Ga0157369_10403297 3300013105 Bacteria 1418
132 Ga0157369_11280171 3300013105 Bacteria 747
133 Ga0163162_10002889 3300013306 Bacteria 16357
134 Ga0163162_10121689 3300013306 Bacteria 2714
135 Ga0157372_10020406 3300013307 Bacteria 7149
136 Ga0157372_10052805 3300013307 Bacteria 4527
137 Ga0157372_10065824 3300013307 Bacteria 4070
138 Ga0157372_10067360 3300013307 Bacteria 4023
139 Ga0157372_10080680 3300013307 Bacteria 3682
140 Ga0157372_10124945 3300013307 Bacteria 2958
141 Ga0157372_10130392 3300013307 Bacteria 2892
142 Ga0157372_10147117 3300013307 Bacteria 2717
143 Ga0157372_10161142 3300013307 Unclassified 2593
144 Ga0157372_10178550 3300013307 Bacteria 2458
145 Ga0157372_10203345 3300013307 Bacteria 2295
146 Ga0157372_10205760 3300013307 Bacteria 2280
147 Ga0157372_10216120 3300013307 Bacteria 2222
148 Ga0157372_10260620 3300013307 Unclassified 2013
149 Ga0157372_10458670 3300013307 Bacteria 1485
150 Ga0157372_10479872 3300013307 Bacteria 1449
151 Ga0157372_10552001 3300013307 Bacteria 1343
152 Ga0157372_10903256 3300013307 Unclassified 1025
153 Ga0157372_11122641 3300013307 Unclassified 909
154 Ga0157372_11319027 3300013307 Bacteria 833
155 Ga0157372_12072866 3300013307 Bacteria 654
156 Ga0157375_10380621 3300013308 Bacteria 1578
157 Ga0157375_11457634 3300013308 Unclassified 807
158 Ga0157375_11875380 3300013308 Bacteria 711
159 Ga0163163_10406177 3300014325 Unclassified 1420
160 Ga0157380_10062864 3300014326 Bacteria 2975
161 Ga0157380_10166407 3300014326 Bacteria 1922
162 Ga0157380_10626534 3300014326 Bacteria 1069
163 Ga0157380_10961643 3300014326 Bacteria 885
164 Ga0157380_11640256 3300014326 Bacteria 699
165 Ga0157376_10228395 3300014969 Bacteria 1728
166 Ga0163161_10060875 3300017792 Bacteria 2748
167 Ga0163161_11551318 3300017792 Bacteria 583
168 Ga0209258_100234 3300025242 Bacteria 103648
169 Ga0209148_1000234 3300025254 Bacteria 90627
170 Ga0207682_10112326 3300025893 Bacteria 1201
171 Ga0207647_10000045 3300025904 Bacteria 90413
172 Ga0207647_10027762 3300025904 Bacteria 3687
173 Ga0207647_10162414 3300025904 Bacteria 1303
174 Ga0207705_10000015 3300025909 Bacteria 382901
175 Ga0207705_10004238 3300025909 Bacteria 10863
176 Ga0207705_10049356 3300025909 Bacteria 3029
177 Ga0207705_10070539 3300025909 Bacteria 2532
178 Ga0207705_10474841 3300025909 Bacteria 970
179 Ga0207705_10746766 3300025909 Bacteria 760
180 Ga0207654_10063061 3300025911 Bacteria 2174
181 Ga0207707_10035237 3300025912 Bacteria 4377
182 Ga0207707_10077152 3300025912 Bacteria 2908
183 Ga0207707_10287276 3300025912 Bacteria 1423
184 Ga0207707_11199924 3300025912 Bacteria 614
185 Ga0207695_10046191 3300025913 Bacteria 4617
186 Ga0207695_10283007 3300025913 Bacteria 1552
187 Ga0207671_10095471 3300025914 Bacteria 2245
188 Ga0207671_10238467 3300025914 Bacteria 1428
189 Ga0207660_10001832 3300025917 Bacteria 14156
190 Ga0207660_10224375 3300025917 Bacteria 1476
191 Ga0207660_10616153 3300025917 Unclassified 884
192 Ga0207657_10008745 3300025919 Bacteria 10248
193 Ga0207657_10042659 3300025919 Bacteria 4001
194 Ga0207657_10052161 3300025919 Bacteria 3551
195 Ga0207657_10141757 3300025919 Bacteria 1963
196 Ga0207657_10350149 3300025919 Bacteria 1165
197 Ga0207652_10000055 3300025921 Bacteria 115420
198 Ga0207652_10000337 3300025921 Bacteria 48786
199 Ga0207652_10007751 3300025921 Bacteria 8623
200 Ga0207652_10222144 3300025921 Bacteria 1702
201 Ga0207652_10513598 3300025921 Bacteria 1078
202 Ga0207652_10658257 3300025921 Bacteria 936
203 Ga0207694_10092364 3300025924 Unclassified 2389
204 Ga0207650_10247052 3300025925 Bacteria 1444
205 Ga0207650_10874934 3300025925 Bacteria 763
206 Ga0207644_10526144 3300025931 Unclassified 977
207 Ga0207690_10082508 3300025932 Unclassified 2249
208 Ga0207690_10140206 3300025932 Bacteria 1780
209 Ga0207690_10144969 3300025932 Bacteria 1754
210 Ga0207690_10401833 3300025932 Bacteria 1093
211 Ga0207706_10732682 3300025933 Bacteria 843
212 Ga0207669_10844083 3300025937 Bacteria 762
213 Ga0207691_10079577 3300025940 Bacteria 2949
214 Ga0207691_10697893 3300025940 Bacteria 856
215 Ga0207661_10558311 3300025944 Bacteria 1049
216 Ga0207667_10020878 3300025949 Bacteria 7270
217 Ga0207667_10061089 3300025949 Bacteria 3943
218 Ga0207667_10111384 3300025949 Bacteria 2823
219 Ga0207667_10119679 3300025949 Bacteria 2714
220 Ga0207667_10531549 3300025949 Bacteria 1191
221 Ga0207667_10579609 3300025949 Bacteria 1133
222 Ga0207667_10645549 3300025949 Bacteria 1064
223 Ga0207667_10756379 3300025949 Bacteria 971
224 Ga0207668_10165981 3300025972 Bacteria 1726
225 Ga0207703_11314558 3300026035 Unclassified 695
226 Ga0207639_10134320 3300026041 Bacteria 2052
227 Ga0207639_10484137 3300026041 Bacteria 1128
228 Ga0207678_10064090 3300026067 Bacteria 3158
229 Ga0207678_10208852 3300026067 Bacteria 1670
230 Ga0207702_10019666 3300026078 Bacteria 5590
231 Ga0207702_10166693 3300026078 Bacteria 2016
232 Ga0207648_10149987 3300026089 Unclassified 2057
233 Ga0207648_10638348 3300026089 Bacteria 983
234 Ga0207674_10033630 3300026116 Bacteria 5366
235 Ga0207674_10106898 3300026116 Bacteria 2775
236 Ga0207675_101784661 3300026118 Unclassified 634
237 Ga0207683_10301774 3300026121 Bacteria 1465
238 Ga0207698_10043978 3300026142 Unclassified 3351
239 Ga0207698_10248009 3300026142 Bacteria 1627
240 Ga0207698_10309216 3300026142 Bacteria 1475
241 Ga0268264_10000052 3300028381 Bacteria 321218
242 Ga0307413_11424339 3300031824 Bacteria 610
243 Ga0307414_10101954 3300032004 Bacteria 2162
244 Ga0307414_10383482 3300032004 Bacteria 1216
245 Ga0307414_10407618 3300032004 Bacteria 1182
246 Ga0307414_11740584 3300032004 Bacteria 581
247 Ga0307411_10859350 3300032005 Unclassified 803
248 Ga0395899_0052125 3300037312 Bacteria 3034
249 Ga0395899_0130017 3300037312 Bacteria 1798
250 Ga0395899_0132112 3300037312 Bacteria 1781
251 Ga0395899_0275401 3300037312 Unclassified 1147
252 Ga0395899_0553969 3300037312 Bacteria 738
253 Ga0395899_1009408 3300037312 Unclassified 501
254 Ga0395900_0006852 3300037418 Bacteria 11822
255 Ga0395900_0014389 3300037418 Bacteria 8075
256 Ga0395900_0085337 3300037418 Unclassified 3244
257 Ga0395900_0378595 3300037418 Bacteria 1384
258 Ga0395900_0647577 3300037418 Bacteria 993
259 Ga0395900_1062450 3300037418 Unclassified 728
260 Ga0395900_1624775 3300037418 Bacteria 557
261 Ga0395898_0006647 3300037466 Bacteria 12330
262 Ga0395898_0022416 3300037466 Bacteria 6396
263 Ga0395898_0033896 3300037466 Bacteria 5092
264 Ga0395898_0082422 3300037466 Bacteria 3100
265 Ga0395898_0247380 3300037466 Bacteria 1700
266 Ga0395905_0008670 3300037471 Bacteria 10015
267 Ga0395905_0027091 3300037471 Bacteria 5405
268 Ga0395905_0089119 3300037471 Bacteria 2892
269 Ga0395905_0106920 3300037471 Bacteria 2627
270 Ga0395905_0355578 3300037471 Bacteria 1357
271 Ga0395905_0600903 3300037471 Bacteria 1002
272 Ga0395901_0020279 3300038443 Bacteria 6805
273 Ga0395901_0028266 3300038443 Bacteria 5768
274 Ga0395901_0040885 3300038443 Bacteria 4803
275 Ga0395901_0048844 3300038443 Bacteria 4395
276 Ga0395901_0687133 3300038443 Bacteria 1022
277 Ga0395901_1468617 3300038443 Bacteria 638
278 Ga0450894_014015 3300042131 Unclassified 1056
279 Ga0450899_046114 3300042135 Bacteria 551
280 Ga0495598_0156669 3300046537 Bacteria 799
281 Ga0495674_0433387 3300047319 Bacteria 1058
282 Ga0501290_016946 3300049513 Bacteria 974
283 Ga0501032_0000752 3300049569 Bacteria 26329
284 Ga0501033_0040431 3300049570 Bacteria 3481
285 Ga0501033_0505813 3300049570 Unclassified 835
286 Ga0501034_0018839 3300049571 Bacteria 7074
287 Ga0501034_0045864 3300049571 Bacteria 4416
288 Ga0501034_0049424 3300049571 Bacteria 4243
289 Ga0501036_0002122 3300049572 Bacteria 15480
290 Ga0501037_0044578 3300049573 Bacteria 3257
291 Ga0501038_0013627 3300049574 Bacteria 7409
292 Ga0501039_0023382 3300049575 Bacteria 4745
293 Ga0501042_0181631 3300049578 Bacteria 1518
294 Ga0501043_0001684 3300049579 Bacteria 19180
295 Ga0501043_0073386 3300049579 Bacteria 2688
296 Ga0501046_0028731 3300049580 Bacteria 4526
297 Ga0501047_0006526 3300049581 Bacteria 10980
298 Ga0501047_0072249 3300049581 Bacteria 3321
299 Ga0501047_1254310 3300049581 Unclassified 555
300 Ga0501048_0024572 3300049582 Bacteria 4397
301 Ga0501067_0020155 3300049583 Bacteria 3689
302 Ga0501068_0031776 3300049584 Bacteria 3137
303 Ga0501068_0056794 3300049584 Bacteria 2373
304 Ga0501070_0002176 3300049586 Bacteria 17235
305 Ga0501070_0130770 3300049586 Bacteria 2074
306 Ga0501070_0157876 3300049586 Bacteria 1870
307 Ga0501072_0330663 3300049588 Bacteria 1211
308 Ga0501072_0647546 3300049588 Unclassified 832
309 Ga0501072_0743593 3300049588 Unclassified 770
310 Ga0501073_0001022 3300049589 Bacteria 20240
311 Ga0501073_0061069 3300049589 Bacteria 2630
312 Ga0501074_0000557 3300049590 Bacteria 23017
313 Ga0501202_003510 3300049652 Unclassified 2691
314 Ga0501222_008467 3300049662 Bacteria 1365
315 Ga0501223_093251 3300049663 Unclassified 614
316 Ga0501239_038407 3300049672 Unclassified 654
317 Ga0501240_001771 3300049673 Bacteria 2175
318 Ga0501243_032134 3300049675 Unclassified 899
319 Ga0501246_034776 3300049676 Unclassified 581
320 Ga0501250_005403 3300049680 Bacteria 1311
321 Ga0501251_017970 3300049681 Bacteria 913
322 Ga0501252_005533 3300049682 Bacteria 1377
323 Ga0501257_016232 3300049686 Bacteria 1726
324 Ga0501259_009200 3300049688 Bacteria 1600
325 Ga0501245_029109 3300049708 Bacteria 904
326 Ga0501079_0044053 3300049741 Bacteria 3444
327 Ga0501079_0083648 3300049741 Bacteria 2469
328 Ga0501080_0057823 3300049742 Bacteria 3609
329 Ga0501080_0932596 3300049742 Unclassified 755
330 Ga0501083_0001422 3300049744 Bacteria 16331
331 Ga0501083_0366765 3300049744 Bacteria 936
332 Ga0501083_0817821 3300049744 Bacteria 606
333 Ga0501241_025789 3300049758 Unclassified 1095
334 Ga0501263_003002 3300049760 Bacteria 1770
335 Ga0501266_001237 3300049763 Unclassified 3249
336 Ga0501268_013472 3300049765 Bacteria 1321
337 Ga0501272_018387 3300049769 Unclassified 827
338 Ga0501035_0003231 3300049822 Bacteria 15614
339 Ga0501035_0098866 3300049822 Bacteria 2562
340 Ga0501035_0159360 3300049822 Bacteria 1954
341 Ga0501044_0001260 3300049823 Bacteria 29948
342 Ga0501044_0042293 3300049823 Bacteria 4740
343 Ga0501044_0043080 3300049823 Unclassified 4691
344 Ga0501045_1181845 3300049824 Unclassified 558
345 nmdc:mga08y16_358562_c1 3300050511 Bacteria 1497
346 Ga0501084_0093736 3300054114 Bacteria 2521
347 Ga0501082_0525549 3300060353 Bacteria 1034
348 2898714533 2898713307 Bacteria 4110805
349 Ga0501221_222406
350 JGI24736J21556_1008437
351 Ga0055535_1002458
352 Ga0065715_10476210
353 Ga0070658_10000019
354 Ga0070658_10382041
355 Ga0070658_10458850
356 Ga0070658_11099579
357 Ga0070683_100393701
358 Ga0070683_100559758
359 Ga0070670_100072328
360 Ga0070677_10134791
361 Ga0070677_10278982
362 Ga0070680_100061507
363 Ga0070680_100580698
364 Ga0070682_100085879
365 Ga0070682_100238659
366 Ga0070660_100003976
367 Ga0070660_100214072
368 Ga0070660_100425101
369 Ga0070660_100659133
370 Ga0070661_100950271
371 Ga0070692_10069222
372 Ga0070692_10288297
373 Ga0070669_101616416
374 Ga0070675_100711643
375 Ga0070671_100291765
376 Ga0070674_100408422
377 Ga0070673_100047674
378 Ga0070659_100104364
379 Ga0070659_100233068
380 Ga0070659_100427771
381 Ga0070659_100497901
382 Ga0070659_101729384
383 Ga0070714_101362361
384 Ga0070663_100014149
385 Ga0070663_100074391
386 Ga0070678_100062013
387 Ga0070678_100611099
388 Ga0070681_10002858
389 Ga0070681_10141321
390 Ga0070681_10154384
391 Ga0070681_10896049
392 Ga0068867_100329162
393 Ga0068867_100458641
394 Ga0070679_100000437
395 Ga0070679_100001254
396 Ga0070679_100207131
397 Ga0070679_100817940
398 Ga0070679_100901805
399 Ga0070679_101101604
400 Ga0070679_101472573
401 Ga0070679_102020510
402 Ga0068853_100028746
403 Ga0068853_100182895
404 Ga0070672_100412562
405 Ga0070672_100748979
406 Ga0070672_100798919
407 Ga0070672_100904932
408 Ga0068855_100011848
409 Ga0068855_100012847
410 Ga0068855_100082492
411 Ga0068855_100208671
412 Ga0068855_101438258
413 Ga0068855_101787938
414 Ga0068855_102048879
415 Ga0068857_100110628
416 Ga0068857_100178973
417 Ga0068854_100051590
418 Ga0068856_100042472
419 Ga0068856_100222678
420 Ga0068852_100004426
421 Ga0068852_100007776
422 Ga0068852_100092711
423 Ga0068858_100366421
424 Ga0068860_100000034
425 Ga0097621_100173046
426 Ga0068871_100297558
427 Ga0068871_100481645
428 Ga0068871_100723934
429 Ga0105240_10330016
430 Ga0105240_10428472
431 Ga0111539_10179030
432 Ga0111539_10198896
433 Ga0111539_10882771
434 Ga0105241_10025980
435 Ga0105241_11071309
436 Ga0105237_10039362
437 Ga0105237_10084200
438 Ga0105238_10043542
439 Ga0105238_11804883
440 Ga0105249_12881156
441 Ga0105239_10156376
442 Ga0105239_10246434
443 Ga0157373_10022186
444 Ga0157373_10028636
445 Ga0157373_10037257
446 Ga0157373_10052245
447 Ga0157373_10052592
448 Ga0157373_10366354
449 Ga0157373_10391340
450 Ga0157373_10846345
451 Ga0157371_10003669
452 Ga0157371_10007478
453 Ga0157371_10010599
454 Ga0157371_10010910
455 Ga0157371_10011496
456 Ga0157371_10016576
457 Ga0157371_10048439
458 Ga0157371_10050970
459 Ga0157371_10062314
460 Ga0157371_10070445
461 Ga0157371_10120752
462 Ga0157371_10228587
463 Ga0157371_10490828
464 Ga0157371_10969596
465 Ga0157371_11097458
466 Ga0157370_10000651
467 Ga0157370_10051456
468 Ga0157370_10134793
469 Ga0157370_10141726
470 Ga0157370_10170245
471 Ga0157370_10204485
472 Ga0157370_10395142
473 Ga0157370_10634304
474 Ga0157369_10036108
475 Ga0157369_10154298
476 Ga0157369_10163344
477 Ga0157369_10185458
478 Ga0157369_10223440
479 Ga0157369_10403297
480 Ga0157369_11280171
481 Ga0163162_10002889
482 Ga0163162_10121689
483 Ga0157372_10020406
484 Ga0157372_10052805
485 Ga0157372_10065824
486 Ga0157372_10067360
487 Ga0157372_10080680
488 Ga0157372_10124945
489 Ga0157372_10130392
490 Ga0157372_10147117
491 Ga0157372_10161142
492 Ga0157372_10178550
493 Ga0157372_10203345
494 Ga0157372_10205760
495 Ga0157372_10216120
496 Ga0157372_10260620
497 Ga0157372_10458670
498 Ga0157372_10479872
499 Ga0157372_10552001
500 Ga0157372_10903256
501 Ga0157372_11122641
502 Ga0157372_11319027
503 Ga0157372_12072866
504 Ga0157375_10380621
505 Ga0157375_11457634
506 Ga0157375_11875380
507 Ga0163163_10406177
508 Ga0157380_10062864
509 Ga0157380_10166407
510 Ga0157380_10626534
511 Ga0157380_10961643
512 Ga0157380_11640256
513 Ga0157376_10228395
514 Ga0163161_10060875
515 Ga0163161_11551318
516 Ga0209258_100234
517 Ga0209148_1000234
518 Ga0207682_10112326
519 Ga0207647_10000045
520 Ga0207647_10027762
521 Ga0207647_10162414
522 Ga0207705_10000015
523 Ga0207705_10004238
524 Ga0207705_10049356
525 Ga0207705_10070539
526 Ga0207705_10474841
527 Ga0207705_10746766
528 Ga0207654_10063061
529 Ga0207707_10035237
530 Ga0207707_10077152
531 Ga0207707_10287276
532 Ga0207707_11199924
533 Ga0207695_10046191
534 Ga0207695_10283007
535 Ga0207671_10095471
536 Ga0207671_10238467
537 Ga0207660_10001832
538 Ga0207660_10224375
539 Ga0207660_10616153
540 Ga0207657_10008745
541 Ga0207657_10042659
542 Ga0207657_10052161
543 Ga0207657_10141757
544 Ga0207657_10350149
545 Ga0207652_10000055
546 Ga0207652_10000337
547 Ga0207652_10007751
548 Ga0207652_10222144
549 Ga0207652_10513598
550 Ga0207652_10658257
551 Ga0207694_10092364
552 Ga0207650_10247052
553 Ga0207650_10874934
554 Ga0207644_10526144
555 Ga0207690_10082508
556 Ga0207690_10140206
557 Ga0207690_10144969
558 Ga0207690_10401833
559 Ga0207706_10732682
560 Ga0207669_10844083
561 Ga0207691_10079577
562 Ga0207691_10697893
563 Ga0207661_10558311
564 Ga0207667_10020878
565 Ga0207667_10061089
566 Ga0207667_10111384
567 Ga0207667_10119679
568 Ga0207667_10531549
569 Ga0207667_10579609
570 Ga0207667_10645549
571 Ga0207667_10756379
572 Ga0207668_10165981
573 Ga0207703_11314558
574 Ga0207639_10134320
575 Ga0207639_10484137
576 Ga0207678_10064090
577 Ga0207678_10208852
578 Ga0207702_10019666
579 Ga0207702_10166693
580 Ga0207648_10149987
581 Ga0207648_10638348
582 Ga0207674_10033630
583 Ga0207674_10106898
584 Ga0207675_101784661
585 Ga0207683_10301774
586 Ga0207698_10043978
587 Ga0207698_10248009
588 Ga0207698_10309216
589 Ga0268264_10000052
590 Ga0307413_11424339
591 Ga0307414_10101954
592 Ga0307414_10383482
593 Ga0307414_10407618
594 Ga0307414_11740584
595 Ga0307411_10859350
596 Ga0395899_0052125
597 Ga0395899_0130017
598 Ga0395899_0132112
599 Ga0395899_0275401
600 Ga0395899_0553969
601 Ga0395899_1009408
602 Ga0395900_0006852
603 Ga0395900_0014389
604 Ga0395900_0085337
605 Ga0395900_0378595
606 Ga0395900_0647577
607 Ga0395900_1062450
608 Ga0395900_1624775
609 Ga0395898_0006647
610 Ga0395898_0022416
611 Ga0395898_0033896
612 Ga0395898_0082422
613 Ga0395898_0247380
614 Ga0395905_0008670
615 Ga0395905_0027091
616 Ga0395905_0089119
617 Ga0395905_0106920
618 Ga0395905_0355578
619 Ga0395905_0600903
620 Ga0395901_0020279
621 Ga0395901_0028266
622 Ga0395901_0040885
623 Ga0395901_0048844
624 Ga0395901_0687133
625 Ga0395901_1468617
626 Ga0450894_014015
627 Ga0450899_046114
628 Ga0495598_0156669
629 Ga0495674_0433387
630 Ga0501290_016946
631 Ga0501032_0000752
632 Ga0501033_0040431
633 Ga0501033_0505813
634 Ga0501034_0018839
635 Ga0501034_0045864
636 Ga0501034_0049424
637 Ga0501036_0002122
638 Ga0501037_0044578
639 Ga0501038_0013627
640 Ga0501039_0023382
641 Ga0501042_0181631
642 Ga0501043_0001684
643 Ga0501043_0073386
644 Ga0501046_0028731
645 Ga0501047_0006526
646 Ga0501047_0072249
647 Ga0501047_1254310
648 Ga0501048_0024572
649 Ga0501067_0020155
650 Ga0501068_0031776
651 Ga0501068_0056794
652 Ga0501070_0002176
653 Ga0501070_0130770
654 Ga0501070_0157876
655 Ga0501072_0330663
656 Ga0501072_0647546
657 Ga0501072_0743593
658 Ga0501073_0001022
659 Ga0501073_0061069
660 Ga0501074_0000557
661 Ga0501202_003510
662 Ga0501222_008467
663 Ga0501223_093251
664 Ga0501239_038407
665 Ga0501240_001771
666 Ga0501243_032134
667 Ga0501246_034776
668 Ga0501250_005403
669 Ga0501251_017970
670 Ga0501252_005533
671 Ga0501257_016232
672 Ga0501259_009200
673 Ga0501245_029109
674 Ga0501079_0044053
675 Ga0501079_0083648
676 Ga0501080_0057823
677 Ga0501080_0932596
678 Ga0501083_0001422
679 Ga0501083_0366765
680 Ga0501083_0817821
681 Ga0501241_025789
682 Ga0501263_003002
683 Ga0501266_001237
684 Ga0501268_013472
685 Ga0501272_018387
686 Ga0501035_0003231
687 Ga0501035_0098866
688 Ga0501035_0159360
689 Ga0501044_0001260
690 Ga0501044_0042293
691 Ga0501044_0043080
692 Ga0501045_1181845
693 nmdc:mga08y16_358562_c1
694 Ga0501084_0093736
695 Ga0501082_0525549
696 2898714533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02082

Rrf2

Iron-dependent Transcriptional regulator

2

132

0.96

PF03444

HrcA_DNA-bdg

Winged helix-turn-helix transcription repressor, HrcA DNA-binding

1

78

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zup-assembly1.cif.gz_B crystal structure of bz junction in diverse sequence 0.9064 23 67
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.8985 7 68
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.8948 7 68
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.8917 26 67
3f23-assembly1.cif.gz_A crystal structure of zalpha in complex with d(cggccg) 0.8913 3 68
ID Description Score Start End Superfamily
4wcgB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8984 7 68 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8935 3 68 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8917 26 67 1.10.10.10
3f22A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8809 3 68 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8803 26 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3M1LGR5-F1-model_v4 Rrf2 family transcriptional regulator 0.9321 1 131 GO:0003700
GO:0005829
AF-A0A4V3E1D5-F1-model_v4 BadM/Rrf2 family transcriptional regulator 0.9319 1 131 GO:0003700
GO:0005829
AF-A0A2T0TW17-F1-model_v4 BadM/Rrf2 family transcriptional regulator 0.931 1 135 GO:0003700
GO:0005829
AF-A0A849MDF9-F1-model_v4 Rrf2 family transcriptional regulator 0.9304 1 131 GO:0003700
GO:0005829
AF-A0A2T4WZI9-F1-model_v4 Transcriptional regulator 0.9301 1 131 GO:0003700
GO:0005829

Map