F417702
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 348 | 319 | 696 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0000675|Ga0501034_0000675_50184_50915 |
| Length | 243 |
| Sequence | MMLDVPTAGTVVRAIENFVEKFQSRLGPKCRDAAGYGEGSEMRLIAEGLAGERGGEPVFSGVSFALGAGEALTITGPNGAGKSTLLRVLAGLLPAAAGAARIEGGGADRPDVAAAAHYLGHQNAMKTALTVTENLAFWRDFLGEPHCEVDEALEMVGLGDIGHLPFGYLSTGQRRRAAIARLLVSYRPVWLLDEPTAGLDKASEAQFSALMGAHLEDGGIIVAATHLPLGLAGAELRMGEGAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 5 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 7 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 8 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 10 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 11 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 12 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 13 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 14 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 15 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 17 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 18 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 26 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 27 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 28 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 40 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 41 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 42 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 43 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 44 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 45 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 46 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 47 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 48 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 49 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 50 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 51 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 52 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 53 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 54 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 55 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 56 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 57 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 58 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 59 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 60 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 61 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 62 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 63 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 64 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 65 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 66 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 67 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 68 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 69 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 70 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 71 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 72 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 73 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 74 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 75 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 76 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 77 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 78 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 79 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 80 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 81 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 82 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 83 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 84 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 85 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 86 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 87 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 88 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 89 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 90 | 2512875024 | |||
| 91 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 92 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 93 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 94 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 95 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 96 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 97 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 98 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 99 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 100 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 101 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 102 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 103 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 104 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 105 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 106 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 107 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 108 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 109 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 110 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 111 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 112 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 113 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 114 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 115 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 116 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 117 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 118 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 119 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 120 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 121 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 122 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 123 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 124 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 125 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 126 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 127 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 128 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 129 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 130 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 131 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 132 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 133 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 134 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 135 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 136 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 137 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 138 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 139 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 140 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 141 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 142 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 143 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 144 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 145 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 146 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 147 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 148 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 149 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 150 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 151 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 152 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 153 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 154 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 155 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 156 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 157 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 158 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 159 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 160 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 161 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 162 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 163 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 164 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 165 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 166 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 167 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 168 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 169 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 170 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 171 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 172 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 173 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 174 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 175 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 176 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 177 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 178 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 179 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 180 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 181 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 182 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 183 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 184 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 185 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 186 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 187 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 188 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 189 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 190 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 191 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 192 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 193 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 194 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 195 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 196 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 197 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 198 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 199 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 200 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 201 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 202 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 203 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 204 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 205 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 206 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 207 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 208 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 209 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 210 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 211 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 212 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 213 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 214 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 215 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 216 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 217 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 218 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 219 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 220 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 221 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 222 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 223 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 224 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 225 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 226 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 227 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 228 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 229 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 230 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 231 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 232 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 233 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 234 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 235 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 236 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 237 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 238 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 239 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 240 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 241 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 242 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 243 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 244 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 245 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 246 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 247 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 248 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 249 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 250 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 251 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 252 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 253 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 254 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 255 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 256 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 257 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 258 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 259 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 260 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 261 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 262 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 263 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 264 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 265 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 266 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 267 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 268 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 269 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 270 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 271 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 272 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 273 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 274 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 275 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 276 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 277 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 278 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 279 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 280 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 281 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 282 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 283 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 284 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 285 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 286 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 287 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 288 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 289 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 290 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 291 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 292 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 293 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 294 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 295 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 296 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 297 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 298 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 299 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 300 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 301 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 302 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 303 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 304 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 305 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 306 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 307 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 308 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 309 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 310 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 311 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 312 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 313 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 314 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 315 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 316 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 317 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 318 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 319 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 32.18 |
| Metatranscriptomes | 0 |
| Isolates | 67.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.05 |
| Nodule | 56.9 |
| Rhizoplane | 1.15 |
| Rhizosphere | 24.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0000675 | 3300049571 | Bacteria | 51860 |
| 2 | JGI24740J21852_10035563 | 3300001979 | Bacteria | 1556 |
| 3 | JGI24740J21852_10114403 | 3300001979 | Bacteria | 679 |
| 4 | Ga0055542_1000859 | 3300003762 | Bacteria | 21282 |
| 5 | Ga0055542_1003407 | 3300003762 | Bacteria | 4321 |
| 6 | Ga0068853_100033210 | 3300005539 | Bacteria | 4376 |
| 7 | Ga0070665_100131731 | 3300005548 | Bacteria | 2502 |
| 8 | Ga0068856_100828651 | 3300005614 | Bacteria | 944 |
| 9 | Ga0068852_100166877 | 3300005616 | Bacteria | 2060 |
| 10 | Ga0081539_10002530 | 3300005985 | Bacteria | 25517 |
| 11 | Ga0081539_10187664 | 3300005985 | Bacteria | 965 |
| 12 | Ga0075365_10047734 | 3300006038 | Bacteria | 2815 |
| 13 | Ga0075365_10206365 | 3300006038 | Bacteria | 1377 |
| 14 | Ga0075365_10365454 | 3300006038 | Bacteria | 1017 |
| 15 | Ga0075368_10035511 | 3300006042 | Bacteria | 1945 |
| 16 | Ga0075368_10159868 | 3300006042 | Bacteria | 943 |
| 17 | Ga0075364_10036155 | 3300006051 | Bacteria | 3193 |
| 18 | Ga0075362_10011894 | 3300006177 | Bacteria | 3439 |
| 19 | Ga0075362_10206028 | 3300006177 | Bacteria | 958 |
| 20 | Ga0075367_10066813 | 3300006178 | Bacteria | 2155 |
| 21 | Ga0075370_10091249 | 3300006353 | Bacteria | 1757 |
| 22 | Ga0105240_10160425 | 3300009093 | Bacteria | 2671 |
| 23 | Ga0105247_10587472 | 3300009101 | Bacteria | 824 |
| 24 | Ga0105241_10519007 | 3300009174 | Bacteria | 1065 |
| 25 | Ga0105248_10240862 | 3300009177 | Bacteria | 2036 |
| 26 | Ga0105237_10225142 | 3300009545 | Bacteria | 1876 |
| 27 | Ga0105239_10119148 | 3300010375 | Bacteria | 2929 |
| 28 | Ga0105239_10699368 | 3300010375 | Bacteria | 1159 |
| 29 | Ga0157369_10128304 | 3300013105 | Bacteria | 2688 |
| 30 | Ga0157374_10918916 | 3300013296 | Bacteria | 893 |
| 31 | Ga0163163_10373805 | 3300014325 | Bacteria | 1482 |
| 32 | Ga0163161_10259926 | 3300017792 | Bacteria | 1356 |
| 33 | Ga0209148_1000111 | 3300025254 | Bacteria | 198095 |
| 34 | Ga0209233_1000118 | 3300025261 | Bacteria | 236172 |
| 35 | Ga0209455_1000223 | 3300025272 | Bacteria | 77481 |
| 36 | Ga0207647_10122361 | 3300025904 | Bacteria | 1533 |
| 37 | Ga0207647_10169178 | 3300025904 | Bacteria | 1273 |
| 38 | Ga0207695_10420866 | 3300025913 | Bacteria | 1220 |
| 39 | Ga0207671_10050994 | 3300025914 | Bacteria | 3065 |
| 40 | Ga0207694_10024705 | 3300025924 | Bacteria | 4564 |
| 41 | Ga0207711_10140064 | 3300025941 | Bacteria | 2175 |
| 42 | Ga0207667_10422554 | 3300025949 | Bacteria | 1356 |
| 43 | Ga0207640_10065495 | 3300025981 | Bacteria | 2425 |
| 44 | Ga0207640_10522210 | 3300025981 | Bacteria | 993 |
| 45 | Ga0207639_10125763 | 3300026041 | Bacteria | 2114 |
| 46 | Ga0207678_10055366 | 3300026067 | Bacteria | 3417 |
| 47 | Ga0207674_10084584 | 3300026116 | Bacteria | 3170 |
| 48 | Ga0207698_10526432 | 3300026142 | Bacteria | 1154 |
| 49 | Ga0307408_100172937 | 3300031548 | Bacteria | 1726 |
| 50 | Ga0307416_100649244 | 3300032002 | Bacteria | 1140 |
| 51 | Ga0307414_10254060 | 3300032004 | Bacteria | 1463 |
| 52 | Ga0316574_0250670 | 3300035398 | Bacteria | 1131 |
| 53 | Ga0395900_0236601 | 3300037418 | Bacteria | 1834 |
| 54 | Ga0395900_1137294 | 3300037418 | Bacteria | 697 |
| 55 | Ga0395898_0215713 | 3300037466 | Bacteria | 1830 |
| 56 | Ga0395905_0147811 | 3300037471 | Bacteria | 2211 |
| 57 | Ga0395905_0406606 | 3300037471 | Bacteria | 1256 |
| 58 | Ga0439465_0119728 | 3300041413 | Bacteria | 922 |
| 59 | Ga0466965_0114744 | 3300044683 | Bacteria | 1387 |
| 60 | Ga0466970_0320553 | 3300044765 | Bacteria | 876 |
| 61 | Ga0495638_0040712 | 3300046460 | Bacteria | 2943 |
| 62 | Ga0495668_0019307 | 3300046616 | Bacteria | 3931 |
| 63 | Ga0495668_0103366 | 3300046616 | Bacteria | 1559 |
| 64 | Ga0495625_0050330 | 3300046660 | Bacteria | 2990 |
| 65 | Ga0495625_0176852 | 3300046660 | Bacteria | 1422 |
| 66 | Ga0495625_0317215 | 3300046660 | Bacteria | 993 |
| 67 | Ga0495687_023792 | 3300047443 | Bacteria | 2922 |
| 68 | Ga0496112_0123520 | 3300048915 | Bacteria | 2560 |
| 69 | Ga0496113_0567347 | 3300048916 | Bacteria | 910 |
| 70 | Ga0496119_0219201 | 3300048922 | Bacteria | 974 |
| 71 | Ga0496120_0044121 | 3300048923 | Bacteria | 2592 |
| 72 | Ga0496120_0199246 | 3300048923 | Bacteria | 970 |
| 73 | Ga0496121_0087694 | 3300048924 | Bacteria | 2442 |
| 74 | Ga0496125_0088428 | 3300048928 | Bacteria | 2335 |
| 75 | Ga0496125_0117161 | 3300048928 | Bacteria | 1911 |
| 76 | Ga0501031_0007395 | 3300049568 | Bacteria | 7154 |
| 77 | Ga0501032_0007442 | 3300049569 | Bacteria | 7995 |
| 78 | Ga0501033_0003212 | 3300049570 | Bacteria | 13531 |
| 79 | Ga0501034_0007546 | 3300049571 | Bacteria | 11569 |
| 80 | Ga0501034_0081739 | 3300049571 | Bacteria | 3233 |
| 81 | Ga0501034_0170540 | 3300049571 | Bacteria | 2143 |
| 82 | Ga0501034_0802705 | 3300049571 | Bacteria | 834 |
| 83 | Ga0501039_0006760 | 3300049575 | Bacteria | 8728 |
| 84 | Ga0501039_0570854 | 3300049575 | Bacteria | 887 |
| 85 | Ga0501040_0016832 | 3300049576 | Bacteria | 4848 |
| 86 | Ga0501042_0009933 | 3300049578 | Bacteria | 6359 |
| 87 | Ga0501043_0007371 | 3300049579 | Bacteria | 8728 |
| 88 | Ga0501043_0220426 | 3300049579 | Bacteria | 1468 |
| 89 | Ga0501046_0010104 | 3300049580 | Bacteria | 8124 |
| 90 | Ga0501047_0008795 | 3300049581 | Bacteria | 9526 |
| 91 | Ga0501047_0364740 | 3300049581 | Bacteria | 1280 |
| 92 | Ga0501048_0002808 | 3300049582 | Bacteria | 13290 |
| 93 | Ga0501068_0007859 | 3300049584 | Bacteria | 5910 |
| 94 | Ga0501070_0010419 | 3300049586 | Bacteria | 7859 |
| 95 | Ga0501073_0013994 | 3300049589 | Bacteria | 5830 |
| 96 | Ga0501079_0034120 | 3300049741 | Bacteria | 3915 |
| 97 | Ga0501080_0002743 | 3300049742 | Bacteria | 15460 |
| 98 | Ga0501035_0003788 | 3300049822 | Bacteria | 14408 |
| 99 | Ga0501044_0005319 | 3300049823 | Bacteria | 14319 |
| 100 | nmdc:mga00v17_40157_c1 | 3300050491 | Bacteria | 2515 |
| 101 | nmdc:mga0yw44_19693_c1 | 3300050492 | Bacteria | 3726 |
| 102 | nmdc:mga0yw44_28450_c2 | 3300050492 | Bacteria | 2068 |
| 103 | nmdc:mga06z11_123495_c1 | 3300050494 | Bacteria | 1447 |
| 104 | nmdc:mga06z11_34987_c1 | 3300050494 | Bacteria | 2469 |
| 105 | nmdc:mga04h51_22877_c1 | 3300050495 | Bacteria | 1896 |
| 106 | nmdc:mga04h51_38371_c1 | 3300050495 | Bacteria | 1551 |
| 107 | nmdc:mga07m45_142607_c1 | 3300050496 | Bacteria | 1388 |
| 108 | Ga0500610_0295060 | 3300053079 | Bacteria | 718 |
| 109 | Ga0500595_124122 | 3300053119 | Bacteria | 729 |
| 110 | Ga0500616_0039940 | 3300053153 | Bacteria | 2527 |
| 111 | Ga0500616_0047392 | 3300053153 | Bacteria | 2282 |
| 112 | Ga0500627_0238038 | 3300053158 | Bacteria | 808 |
| 113 | 2509118456 | 2508501123 | Bacteria | 6283661 |
| 114 | 2509393897 | 2509276022 | Bacteria | 6200534 |
| 115 | 2510318363 | 2510065059 | Bacteria | 6847884 |
| 116 | 2511391837 | 2511231027 | Bacteria | 5013807 |
| 117 | 2512933588 | 2512875016 | Bacteria | 6529530 |
| 118 | 2512961727 | 2512875024 | Bacteria | 7195110 |
| 119 | 2514035591 | 2513237164 | Bacteria | 7563725 |
| 120 | 2514586626 | 2513237351 | Bacteria | 6968952 |
| 121 | 2588519665 | 2588253730 | Bacteria | 6881675 |
| 122 | 2597811964 | 2597489875 | Bacteria | 7010078 |
| 123 | 2644154540 | 2643221627 | Bacteria | 6761570 |
| 124 | 2694631635 | 2693429783 | Bacteria | 7019804 |
| 125 | 2694638310 | 2693429784 | Bacteria | 7241525 |
| 126 | 2739306035 | 2738543024 | Bacteria | 5603683 |
| 127 | 2756673677 | 2756170246 | Bacteria | 7451806 |
| 128 | 2765465725 | 2765235802 | Bacteria | 5618596 |
| 129 | 2770198319 | 2767802442 | Bacteria | 5747986 |
| 130 | 2776282499 | 2775506904 | Bacteria | 5954060 |
| 131 | 2792747537 | 2791355123 | Bacteria | 8049106 |
| 132 | 2839993369 | 2839993093 | Bacteria | 5512535 |
| 133 | 2840766372 | 2840764183 | Bacteria | 6358399 |
| 134 | 2844003146 | 2844002411 | Bacteria | 7168230 |
| 135 | 2844011114 | 2844009547 | Bacteria | 6728125 |
| 136 | 2847690221 | 2847686936 | Bacteria | 6278406 |
| 137 | 2856327158 | 2856320880 | Bacteria | 7263508 |
| 138 | 2856329775 | 2856328259 | Bacteria | 6528202 |
| 139 | 2856336579 | 2856334872 | Bacteria | 7037011 |
| 140 | 2856343504 | 2856342000 | Bacteria | 7176905 |
| 141 | 2856358850 | 2856356410 | Bacteria | 6297484 |
| 142 | 2856365089 | 2856364286 | Bacteria | 6939991 |
| 143 | 2857353234 | 2857349434 | Bacteria | 7926032 |
| 144 | 2857372233 | 2857367948 | Bacteria | 6965560 |
| 145 | 2869245508 | 2869242130 | Bacteria | 6609239 |
| 146 | 2869251998 | 2869249662 | Bacteria | 6868783 |
| 147 | 2869258520 | 2869256925 | Bacteria | 6981691 |
| 148 | 2869268776 | 2869264136 | Bacteria | 6880765 |
| 149 | 2869273727 | 2869271264 | Bacteria | 6908218 |
| 150 | 2869279611 | 2869278585 | Bacteria | 7077053 |
| 151 | 2869286287 | 2869285874 | Bacteria | 6901219 |
| 152 | 2871430256 | 2871429161 | Bacteria | 6547891 |
| 153 | 2871439937 | 2871435913 | Bacteria | 6880295 |
| 154 | 2871445061 | 2871444079 | Bacteria | 6423508 |
| 155 | 2871458699 | 2871451962 | Bacteria | 7336357 |
| 156 | 2871464855 | 2871459585 | Bacteria | 6866887 |
| 157 | 2871468672 | 2871466892 | Bacteria | 6923287 |
| 158 | 2871482657 | 2871481445 | Bacteria | 6700002 |
| 159 | 2871494973 | 2871488783 | Bacteria | 6929816 |
| 160 | 2871500146 | 2871495908 | Bacteria | 6935695 |
| 161 | 2874103210 | 2874102143 | Bacteria | 6342645 |
| 162 | 2874110673 | 2874109183 | Bacteria | 6517025 |
| 163 | 2874121959 | 2874116593 | Bacteria | 6674494 |
| 164 | 2874134208 | 2874131515 | Bacteria | 6820270 |
| 165 | 2874139397 | 2874139085 | Bacteria | 7021506 |
| 166 | 2874146673 | 2874146452 | Bacteria | 7533118 |
| 167 | 2874155747 | 2874155637 | Bacteria | 6724144 |
| 168 | 2874167818 | 2874162495 | Bacteria | 6174670 |
| 169 | 2874170652 | 2874168670 | Bacteria | 8062617 |
| 170 | 2876364158 | 2876363079 | Bacteria | 6544991 |
| 171 | 2876385591 | 2876377896 | Bacteria | 6565995 |
| 172 | 2876386999 | 2876386047 | Bacteria | 6698674 |
| 173 | 2876399202 | 2876392853 | Bacteria | 6660880 |
| 174 | 2876402423 | 2876399893 | Bacteria | 6927900 |
| 175 | 2876414076 | 2876413966 | Bacteria | 6831344 |
| 176 | 2876422768 | 2876420981 | Bacteria | 6687741 |
| 177 | 2878742138 | 2878738818 | Bacteria | 7136951 |
| 178 | 2878746452 | 2878745973 | Bacteria | 6867388 |
| 179 | 2878760098 | 2878753008 | Bacteria | 6922523 |
| 180 | 2878764268 | 2878760144 | Bacteria | 6823465 |
| 181 | 2878771338 | 2878767105 | Bacteria | 6898628 |
| 182 | 2878775991 | 2878774303 | Bacteria | 6108671 |
| 183 | 2881165299 | 2881161766 | Bacteria | 7127907 |
| 184 | 2881848735 | 2881845957 | Bacteria | 6611900 |
| 185 | 2881863451 | 2881861095 | Bacteria | 7128710 |
| 186 | 2882640389 | 2882632389 | Bacteria | 8154593 |
| 187 | 2885321448 | 2885318864 | Bacteria | 6729568 |
| 188 | 2885329073 | 2885326080 | Bacteria | 7134805 |
| 189 | 2888343694 | 2888337043 | Bacteria | 6629336 |
| 190 | 2889015219 | 2889010040 | Bacteria | 6749192 |
| 191 | 2889019701 | 2889016732 | Bacteria | 6700763 |
| 192 | 2889793090 | 2889790730 | Bacteria | 5689708 |
| 193 | 2889917339 | 2889914905 | Bacteria | 5702301 |
| 194 | 2894653761 | 2894652903 | Bacteria | 4587256 |
| 195 | 2903453738 | 2903448605 | Bacteria | 7357801 |
| 196 | 2903494332 | 2903492973 | Bacteria | 13473544 |
| 197 | 2903499839 | 2903492973 | Bacteria | 13473544 |
| 198 | 2903514684 | 2903513507 | Bacteria | 6344008 |
| 199 | 2903525682 | 2903521522 | Bacteria | 6525694 |
| 200 | 2903532771 | 2903528002 | Bacteria | 6586099 |
| 201 | 2903544961 | 2903540706 | Bacteria | 7062119 |
| 202 | 2904579982 | 2904578770 | Bacteria | 5302906 |
| 203 | 2904665729 | 2904659560 | Bacteria | 6685615 |
| 204 | 2906308853 | 2906308376 | Bacteria | 6841989 |
| 205 | 2906322133 | 2906321335 | Bacteria | 6579571 |
| 206 | 2906333919 | 2906328253 | Bacteria | 6585166 |
| 207 | 2906357582 | 2906354277 | Bacteria | 6991324 |
| 208 | 2906363424 | 2906363423 | Bacteria | 6856682 |
| 209 | 2906377475 | 2906370794 | Bacteria | 6881062 |
| 210 | 2906386026 | 2906378014 | Bacteria | 6911440 |
| 211 | 2906390913 | 2906386501 | Bacteria | 5977019 |
| 212 | 2906397297 | 2906393657 | Bacteria | 6790866 |
| 213 | 2906408080 | 2906401398 | Bacteria | 6693206 |
| 214 | 2906408450 | 2906408224 | Bacteria | 6162342 |
| 215 | 2906434225 | 2906427513 | Bacteria | 6375796 |
| 216 | 2919120346 | 2919119836 | Bacteria | 5208557 |
| 217 | 2922135800 | 2922130491 | Bacteria | 7173936 |
| 218 | 2922158459 | 2922151315 | Bacteria | 6902399 |
| 219 | 2922165394 | 2922158528 | Bacteria | 6573167 |
| 220 | 2922176076 | 2922172374 | Bacteria | 6167644 |
| 221 | 2922184392 | 2922178524 | Bacteria | 6025201 |
| 222 | 2924717566 | 2924710171 | Bacteria | 6752351 |
| 223 | 2924722458 | 2924718760 | Bacteria | 6331356 |
| 224 | 2924728352 | 2924726620 | Bacteria | 6271473 |
| 225 | 2924737286 | 2924733363 | Bacteria | 7574837 |
| 226 | 2924747615 | 2924741084 | Bacteria | 6661321 |
| 227 | 2924750700 | 2924748358 | Bacteria | 6154725 |
| 228 | 2924768600 | 2924762789 | Bacteria | 6561353 |
| 229 | 2924779822 | 2924776078 | Bacteria | 7492003 |
| 230 | 2924790901 | 2924784321 | Bacteria | 7416538 |
| 231 | 2928522776 | 2928521798 | Bacteria | 4960112 |
| 232 | 2937822192 | 2937813078 | Bacteria | 7783518 |
| 233 | 2937823872 | 2937822353 | Bacteria | 7290551 |
| 234 | 2937851685 | 2937848649 | Bacteria | 6983481 |
| 235 | 2937865684 | 2937861824 | Bacteria | 6660327 |
| 236 | 2937880590 | 2937877337 | Bacteria | 7246526 |
| 237 | 2937894374 | 2937891427 | Bacteria | 6357007 |
| 238 | 2937974220 | 2937972304 | Bacteria | 7532020 |
| 239 | 2937998806 | 2937994558 | Bacteria | 7036190 |
| 240 | 2954013857 | 2954011201 | Bacteria | 4762601 |
| 241 | 2958035189 | 2958034702 | Bacteria | 6989922 |
| 242 | 2958044221 | 2958041894 | Bacteria | 13082850 |
| 243 | 2958065678 | 2958064165 | Bacteria | 7158582 |
| 244 | 2958087723 | 2958084443 | Bacteria | 7312792 |
| 245 | 2958102812 | 2958100919 | Bacteria | 6800575 |
| 246 | 2958115100 | 2958108152 | Bacteria | 6681128 |
| 247 | 2958120393 | 2958115193 | Bacteria | 6923548 |
| 248 | 2958130214 | 2958122699 | Bacteria | 7280457 |
| 249 | 2958130686 | 2958130278 | Bacteria | 6897202 |
| 250 | 2958142058 | 2958137437 | Bacteria | 6050276 |
| 251 | 2958149818 | 2958144490 | Bacteria | 6677056 |
| 252 | 2958169281 | 2958165035 | Bacteria | 6906348 |
| 253 | 2958177307 | 2958172287 | Bacteria | 6716688 |
| 254 | 2958180025 | 2958179912 | Bacteria | 6874908 |
| 255 | 2961077852 | 2961077736 | Bacteria | 7079850 |
| 256 | 2961121072 | 2961114664 | Bacteria | 6680456 |
| 257 | 2961144116 | 2961136820 | Bacteria | 6775228 |
| 258 | 2961167743 | 2961163497 | Bacteria | 6901077 |
| 259 | 2961177367 | 2961170736 | Bacteria | 7072258 |
| 260 | 2961185086 | 2961183825 | Bacteria | 6688536 |
| 261 | 2963645616 | 2963644680 | Bacteria | 6530403 |
| 262 | 2965022562 | 2965018300 | Bacteria | 6883036 |
| 263 | 2965026680 | 2965025482 | Bacteria | 6532201 |
| 264 | 2965040044 | 2965032056 | Bacteria | 6887443 |
| 265 | 2965040525 | 2965040258 | Bacteria | 6855979 |
| 266 | 2965047919 | 2965047637 | Bacteria | 6623551 |
| 267 | 2965065080 | 2965062239 | Bacteria | 7412989 |
| 268 | 2965093546 | 2965089291 | Bacteria | 6866420 |
| 269 | 2965103199 | 2965102966 | Bacteria | 6800987 |
| 270 | 2965121104 | 2965119406 | Bacteria | 6956431 |
| 271 | 2968002472 | 2967996073 | Bacteria | 6787468 |
| 272 | 2968009703 | 2968003550 | Bacteria | 6929263 |
| 273 | 2968023609 | 2968016561 | Bacteria | 7022047 |
| 274 | 2968085048 | 2968083720 | Bacteria | 7351627 |
| 275 | 2968093504 | 2968091066 | Bacteria | 6052692 |
| 276 | 2968100222 | 2968097103 | Bacteria | 6107094 |
| 277 | 2968117222 | 2968110612 | Bacteria | 6814636 |
| 278 | 2968129627 | 2968128360 | Bacteria | 6270294 |
| 279 | 2968144747 | 2968138860 | Bacteria | 6605449 |
| 280 | 2968176144 | 2968171901 | Bacteria | 6894245 |
| 281 | 2970476191 | 2970469710 | Bacteria | 6969209 |
| 282 | 2970493792 | 2970489779 | Bacteria | 6517260 |
| 283 | 2970510041 | 2970503327 | Bacteria | 7099517 |
| 284 | 2970517305 | 2970510686 | Bacteria | 7006402 |
| 285 | 2970534501 | 2970532167 | Bacteria | 6553173 |
| 286 | 2970541822 | 2970540015 | Bacteria | 6977556 |
| 287 | 2970551946 | 2970547951 | Bacteria | 6931819 |
| 288 | 2970559112 | 2970554993 | Bacteria | 6814252 |
| 289 | 2970594211 | 2970593180 | Bacteria | 7073582 |
| 290 | 2970621889 | 2970619444 | Bacteria | 6986144 |
| 291 | 2970631319 | 2970627176 | Bacteria | 6680862 |
| 292 | 2977828619 | 2977821940 | Bacteria | 6906439 |
| 293 | 2977832600 | 2977828996 | Bacteria | 7007971 |
| 294 | 2977844311 | 2977843712 | Bacteria | 6753583 |
| 295 | 2977854344 | 2977851361 | Bacteria | 6694324 |
| 296 | 2977862085 | 2977858184 | Bacteria | 6215359 |
| 297 | 2977865666 | 2977864932 | Bacteria | 7534097 |
| 298 | 2977874342 | 2977872689 | Bacteria | 7270173 |
| 299 | 2977899925 | 2977898635 | Bacteria | 6675551 |
| 300 | 2977912913 | 2977907340 | Bacteria | 6577984 |
| 301 | 2977915682 | 2977915119 | Bacteria | 6829656 |
| 302 | 2977929541 | 2977922695 | Bacteria | 6956781 |
| 303 | 2977938957 | 2977935797 | Bacteria | 6252826 |
| 304 | 2977953545 | 2977950692 | Bacteria | 6893264 |
| 305 | 2977964938 | 2977957713 | Bacteria | 6877875 |
| 306 | 2977987990 | 2977986579 | Bacteria | 6581278 |
| 307 | 2979712951 | 2979710463 | Bacteria | 6785254 |
| 308 | 2979767621 | 2979764755 | Bacteria | 6610066 |
| 309 | 2979776825 | 2979772303 | Bacteria | 6618277 |
| 310 | 2979784496 | 2979779861 | Bacteria | 6219781 |
| 311 | 2979798296 | 2979793036 | Bacteria | 6808957 |
| 312 | 2979814917 | 2979808191 | Bacteria | 7179355 |
| 313 | 2987641826 | 2987636660 | Bacteria | 8088555 |
| 314 | 2987649233 | 2987645492 | Bacteria | 6117018 |
| 315 | 2987657884 | 2987652177 | Bacteria | 6969023 |
| 316 | 2987663750 | 2987659509 | Bacteria | 6966464 |
| 317 | 2987673329 | 2987666974 | Bacteria | 6509233 |
| 318 | 2987676490 | 2987673487 | Bacteria | 6884027 |
| 319 | 2996315201 | 2996310559 | Bacteria | 6357320 |
| 320 | 2996339465 | 2996336353 | Bacteria | 5511628 |
| 321 | 2996343990 | 2996341866 | Bacteria | 6643098 |
| 322 | 2996354775 | 2996348954 | Bacteria | 7239054 |
| 323 | 2996389819 | 2996386984 | Bacteria | 6978667 |
| 324 | 3000137679 | 3000135777 | Bacteria | 6891109 |
| 325 | 3002141698 | 3002141150 | Bacteria | 5254435 |
| 326 | 3004192807 | 3004188549 | Bacteria | 6952365 |
| 327 | 3004200080 | 3004195979 | Bacteria | 6776956 |
| 328 | 3004209362 | 3004203850 | Bacteria | 7307914 |
| 329 | 3004218395 | 3004211236 | Bacteria | 7417683 |
| 330 | 3004219508 | 3004218560 | Bacteria | 7421728 |
| 331 | 3004233717 | 3004232784 | Bacteria | 6662140 |
| 332 | 3004252163 | 3004248173 | Bacteria | 6563236 |
| 333 | 3004269429 | 3004268573 | Bacteria | 7043476 |
| 334 | 3004281423 | 3004275668 | Bacteria | 7114440 |
| 335 | 3004336977 | 3004334049 | Bacteria | 8449246 |
| 336 | 637076696 | 637000159 | Bacteria | 7596297 |
| 337 | 649870839 | 649633066 | Bacteria | 6690028 |
| 338 | 8002291852 | 8002285264 | Bacteria | 6717907 |
| 339 | 8004301659 | 8004300914 | Bacteria | 6132239 |
| 340 | 8004316224 | 8004312739 | Bacteria | 7444653 |
| 341 | 8004362586 | 8004361976 | Bacteria | 6858373 |
| 342 | 8004381596 | 8004374579 | Bacteria | 6898112 |
| 343 | 8004388687 | 8004387939 | Bacteria | 7049250 |
| 344 | 8004448269 | 8004445564 | Bacteria | 6322258 |
| 345 | 8004706450 | 8004703790 | Bacteria | 8006957 |
| 346 | 8004715109 | 8004714634 | Bacteria | 6776161 |
| 347 | 8004729358 | 8004727605 | Bacteria | 6643904 |
| 348 | 8055618213 | 8055617313 | Bacteria | 7548464 |
| 349 | Ga0501034_0000675 | |||
| 350 | JGI24740J21852_10035563 | |||
| 351 | JGI24740J21852_10114403 | |||
| 352 | Ga0055542_1000859 | |||
| 353 | Ga0055542_1003407 | |||
| 354 | Ga0068853_100033210 | |||
| 355 | Ga0070665_100131731 | |||
| 356 | Ga0068856_100828651 | |||
| 357 | Ga0068852_100166877 | |||
| 358 | Ga0081539_10002530 | |||
| 359 | Ga0081539_10187664 | |||
| 360 | Ga0075365_10047734 | |||
| 361 | Ga0075365_10206365 | |||
| 362 | Ga0075365_10365454 | |||
| 363 | Ga0075368_10035511 | |||
| 364 | Ga0075368_10159868 | |||
| 365 | Ga0075364_10036155 | |||
| 366 | Ga0075362_10011894 | |||
| 367 | Ga0075362_10206028 | |||
| 368 | Ga0075367_10066813 | |||
| 369 | Ga0075370_10091249 | |||
| 370 | Ga0105240_10160425 | |||
| 371 | Ga0105247_10587472 | |||
| 372 | Ga0105241_10519007 | |||
| 373 | Ga0105248_10240862 | |||
| 374 | Ga0105237_10225142 | |||
| 375 | Ga0105239_10119148 | |||
| 376 | Ga0105239_10699368 | |||
| 377 | Ga0157369_10128304 | |||
| 378 | Ga0157374_10918916 | |||
| 379 | Ga0163163_10373805 | |||
| 380 | Ga0163161_10259926 | |||
| 381 | Ga0209148_1000111 | |||
| 382 | Ga0209233_1000118 | |||
| 383 | Ga0209455_1000223 | |||
| 384 | Ga0207647_10122361 | |||
| 385 | Ga0207647_10169178 | |||
| 386 | Ga0207695_10420866 | |||
| 387 | Ga0207671_10050994 | |||
| 388 | Ga0207694_10024705 | |||
| 389 | Ga0207711_10140064 | |||
| 390 | Ga0207667_10422554 | |||
| 391 | Ga0207640_10065495 | |||
| 392 | Ga0207640_10522210 | |||
| 393 | Ga0207639_10125763 | |||
| 394 | Ga0207678_10055366 | |||
| 395 | Ga0207674_10084584 | |||
| 396 | Ga0207698_10526432 | |||
| 397 | Ga0307408_100172937 | |||
| 398 | Ga0307416_100649244 | |||
| 399 | Ga0307414_10254060 | |||
| 400 | Ga0316574_0250670 | |||
| 401 | Ga0395900_0236601 | |||
| 402 | Ga0395900_1137294 | |||
| 403 | Ga0395898_0215713 | |||
| 404 | Ga0395905_0147811 | |||
| 405 | Ga0395905_0406606 | |||
| 406 | Ga0439465_0119728 | |||
| 407 | Ga0466965_0114744 | |||
| 408 | Ga0466970_0320553 | |||
| 409 | Ga0495638_0040712 | |||
| 410 | Ga0495668_0019307 | |||
| 411 | Ga0495668_0103366 | |||
| 412 | Ga0495625_0050330 | |||
| 413 | Ga0495625_0176852 | |||
| 414 | Ga0495625_0317215 | |||
| 415 | Ga0495687_023792 | |||
| 416 | Ga0496112_0123520 | |||
| 417 | Ga0496113_0567347 | |||
| 418 | Ga0496119_0219201 | |||
| 419 | Ga0496120_0044121 | |||
| 420 | Ga0496120_0199246 | |||
| 421 | Ga0496121_0087694 | |||
| 422 | Ga0496125_0088428 | |||
| 423 | Ga0496125_0117161 | |||
| 424 | Ga0501031_0007395 | |||
| 425 | Ga0501032_0007442 | |||
| 426 | Ga0501033_0003212 | |||
| 427 | Ga0501034_0007546 | |||
| 428 | Ga0501034_0081739 | |||
| 429 | Ga0501034_0170540 | |||
| 430 | Ga0501034_0802705 | |||
| 431 | Ga0501039_0006760 | |||
| 432 | Ga0501039_0570854 | |||
| 433 | Ga0501040_0016832 | |||
| 434 | Ga0501042_0009933 | |||
| 435 | Ga0501043_0007371 | |||
| 436 | Ga0501043_0220426 | |||
| 437 | Ga0501046_0010104 | |||
| 438 | Ga0501047_0008795 | |||
| 439 | Ga0501047_0364740 | |||
| 440 | Ga0501048_0002808 | |||
| 441 | Ga0501068_0007859 | |||
| 442 | Ga0501070_0010419 | |||
| 443 | Ga0501073_0013994 | |||
| 444 | Ga0501079_0034120 | |||
| 445 | Ga0501080_0002743 | |||
| 446 | Ga0501035_0003788 | |||
| 447 | Ga0501044_0005319 | |||
| 448 | nmdc:mga00v17_40157_c1 | |||
| 449 | nmdc:mga0yw44_19693_c1 | |||
| 450 | nmdc:mga0yw44_28450_c2 | |||
| 451 | nmdc:mga06z11_123495_c1 | |||
| 452 | nmdc:mga06z11_34987_c1 | |||
| 453 | nmdc:mga04h51_22877_c1 | |||
| 454 | nmdc:mga04h51_38371_c1 | |||
| 455 | nmdc:mga07m45_142607_c1 | |||
| 456 | Ga0500610_0295060 | |||
| 457 | Ga0500595_124122 | |||
| 458 | Ga0500616_0039940 | |||
| 459 | Ga0500616_0047392 | |||
| 460 | Ga0500627_0238038 | |||
| 461 | 2509118456 | |||
| 462 | 2509393897 | |||
| 463 | 2510318363 | |||
| 464 | 2511391837 | |||
| 465 | 2512933588 | |||
| 466 | 2512961727 | |||
| 467 | 2514035591 | |||
| 468 | 2514586626 | |||
| 469 | 2588519665 | |||
| 470 | 2597811964 | |||
| 471 | 2644154540 | |||
| 472 | 2694631635 | |||
| 473 | 2694638310 | |||
| 474 | 2739306035 | |||
| 475 | 2756673677 | |||
| 476 | 2765465725 | |||
| 477 | 2770198319 | |||
| 478 | 2776282499 | |||
| 479 | 2792747537 | |||
| 480 | 2839993369 | |||
| 481 | 2840766372 | |||
| 482 | 2844003146 | |||
| 483 | 2844011114 | |||
| 484 | 2847690221 | |||
| 485 | 2856327158 | |||
| 486 | 2856329775 | |||
| 487 | 2856336579 | |||
| 488 | 2856343504 | |||
| 489 | 2856358850 | |||
| 490 | 2856365089 | |||
| 491 | 2857353234 | |||
| 492 | 2857372233 | |||
| 493 | 2869245508 | |||
| 494 | 2869251998 | |||
| 495 | 2869258520 | |||
| 496 | 2869268776 | |||
| 497 | 2869273727 | |||
| 498 | 2869279611 | |||
| 499 | 2869286287 | |||
| 500 | 2871430256 | |||
| 501 | 2871439937 | |||
| 502 | 2871445061 | |||
| 503 | 2871458699 | |||
| 504 | 2871464855 | |||
| 505 | 2871468672 | |||
| 506 | 2871482657 | |||
| 507 | 2871494973 | |||
| 508 | 2871500146 | |||
| 509 | 2874103210 | |||
| 510 | 2874110673 | |||
| 511 | 2874121959 | |||
| 512 | 2874134208 | |||
| 513 | 2874139397 | |||
| 514 | 2874146673 | |||
| 515 | 2874155747 | |||
| 516 | 2874167818 | |||
| 517 | 2874170652 | |||
| 518 | 2876364158 | |||
| 519 | 2876385591 | |||
| 520 | 2876386999 | |||
| 521 | 2876399202 | |||
| 522 | 2876402423 | |||
| 523 | 2876414076 | |||
| 524 | 2876422768 | |||
| 525 | 2878742138 | |||
| 526 | 2878746452 | |||
| 527 | 2878760098 | |||
| 528 | 2878764268 | |||
| 529 | 2878771338 | |||
| 530 | 2878775991 | |||
| 531 | 2881165299 | |||
| 532 | 2881848735 | |||
| 533 | 2881863451 | |||
| 534 | 2882640389 | |||
| 535 | 2885321448 | |||
| 536 | 2885329073 | |||
| 537 | 2888343694 | |||
| 538 | 2889015219 | |||
| 539 | 2889019701 | |||
| 540 | 2889793090 | |||
| 541 | 2889917339 | |||
| 542 | 2894653761 | |||
| 543 | 2903453738 | |||
| 544 | 2903494332 | |||
| 545 | 2903499839 | |||
| 546 | 2903514684 | |||
| 547 | 2903525682 | |||
| 548 | 2903532771 | |||
| 549 | 2903544961 | |||
| 550 | 2904579982 | |||
| 551 | 2904665729 | |||
| 552 | 2906308853 | |||
| 553 | 2906322133 | |||
| 554 | 2906333919 | |||
| 555 | 2906357582 | |||
| 556 | 2906363424 | |||
| 557 | 2906377475 | |||
| 558 | 2906386026 | |||
| 559 | 2906390913 | |||
| 560 | 2906397297 | |||
| 561 | 2906408080 | |||
| 562 | 2906408450 | |||
| 563 | 2906434225 | |||
| 564 | 2919120346 | |||
| 565 | 2922135800 | |||
| 566 | 2922158459 | |||
| 567 | 2922165394 | |||
| 568 | 2922176076 | |||
| 569 | 2922184392 | |||
| 570 | 2924717566 | |||
| 571 | 2924722458 | |||
| 572 | 2924728352 | |||
| 573 | 2924737286 | |||
| 574 | 2924747615 | |||
| 575 | 2924750700 | |||
| 576 | 2924768600 | |||
| 577 | 2924779822 | |||
| 578 | 2924790901 | |||
| 579 | 2928522776 | |||
| 580 | 2937822192 | |||
| 581 | 2937823872 | |||
| 582 | 2937851685 | |||
| 583 | 2937865684 | |||
| 584 | 2937880590 | |||
| 585 | 2937894374 | |||
| 586 | 2937974220 | |||
| 587 | 2937998806 | |||
| 588 | 2954013857 | |||
| 589 | 2958035189 | |||
| 590 | 2958044221 | |||
| 591 | 2958065678 | |||
| 592 | 2958087723 | |||
| 593 | 2958102812 | |||
| 594 | 2958115100 | |||
| 595 | 2958120393 | |||
| 596 | 2958130214 | |||
| 597 | 2958130686 | |||
| 598 | 2958142058 | |||
| 599 | 2958149818 | |||
| 600 | 2958169281 | |||
| 601 | 2958177307 | |||
| 602 | 2958180025 | |||
| 603 | 2961077852 | |||
| 604 | 2961121072 | |||
| 605 | 2961144116 | |||
| 606 | 2961167743 | |||
| 607 | 2961177367 | |||
| 608 | 2961185086 | |||
| 609 | 2963645616 | |||
| 610 | 2965022562 | |||
| 611 | 2965026680 | |||
| 612 | 2965040044 | |||
| 613 | 2965040525 | |||
| 614 | 2965047919 | |||
| 615 | 2965065080 | |||
| 616 | 2965093546 | |||
| 617 | 2965103199 | |||
| 618 | 2965121104 | |||
| 619 | 2968002472 | |||
| 620 | 2968009703 | |||
| 621 | 2968023609 | |||
| 622 | 2968085048 | |||
| 623 | 2968093504 | |||
| 624 | 2968100222 | |||
| 625 | 2968117222 | |||
| 626 | 2968129627 | |||
| 627 | 2968144747 | |||
| 628 | 2968176144 | |||
| 629 | 2970476191 | |||
| 630 | 2970493792 | |||
| 631 | 2970510041 | |||
| 632 | 2970517305 | |||
| 633 | 2970534501 | |||
| 634 | 2970541822 | |||
| 635 | 2970551946 | |||
| 636 | 2970559112 | |||
| 637 | 2970594211 | |||
| 638 | 2970621889 | |||
| 639 | 2970631319 | |||
| 640 | 2977828619 | |||
| 641 | 2977832600 | |||
| 642 | 2977844311 | |||
| 643 | 2977854344 | |||
| 644 | 2977862085 | |||
| 645 | 2977865666 | |||
| 646 | 2977874342 | |||
| 647 | 2977899925 | |||
| 648 | 2977912913 | |||
| 649 | 2977915682 | |||
| 650 | 2977929541 | |||
| 651 | 2977938957 | |||
| 652 | 2977953545 | |||
| 653 | 2977964938 | |||
| 654 | 2977987990 | |||
| 655 | 2979712951 | |||
| 656 | 2979767621 | |||
| 657 | 2979776825 | |||
| 658 | 2979784496 | |||
| 659 | 2979798296 | |||
| 660 | 2979814917 | |||
| 661 | 2987641826 | |||
| 662 | 2987649233 | |||
| 663 | 2987657884 | |||
| 664 | 2987663750 | |||
| 665 | 2987673329 | |||
| 666 | 2987676490 | |||
| 667 | 2996315201 | |||
| 668 | 2996339465 | |||
| 669 | 2996343990 | |||
| 670 | 2996354775 | |||
| 671 | 2996389819 | |||
| 672 | 3000137679 | |||
| 673 | 3002141698 | |||
| 674 | 3004192807 | |||
| 675 | 3004200080 | |||
| 676 | 3004209362 | |||
| 677 | 3004218395 | |||
| 678 | 3004219508 | |||
| 679 | 3004233717 | |||
| 680 | 3004252163 | |||
| 681 | 3004269429 | |||
| 682 | 3004281423 | |||
| 683 | 3004336977 | |||
| 684 | 637076696 | |||
| 685 | 649870839 | |||
| 686 | 8002291852 | |||
| 687 | 8004301659 | |||
| 688 | 8004316224 | |||
| 689 | 8004362586 | |||
| 690 | 8004381596 | |||
| 691 | 8004388687 | |||
| 692 | 8004448269 | |||
| 693 | 8004706450 | |||
| 694 | 8004715109 | |||
| 695 | 8004729358 | |||
| 696 | 8055618213 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7o17-assembly1.cif.gz_B | abc transporter nosdfy e154q, atp-bound in lipid nanodisc | 0.8939 | 1 | 186 |
| 7e7q-assembly1.cif.gz_A | cryo-em structure of human abca4 in atp-bound state | 0.8864 | 3 | 197 |
| 4rvc-assembly1.cif.gz_A | structure of atp binding subunit of abc transporter | 0.8858 | 1 | 186 |
| 8ce5-assembly1.cif.gz_A | cytochrome c maturation complex ccmabcd, e154q, atp-bound | 0.8778 | 3 | 197 |
| 7lkz-assembly1.cif.gz_A | structure of atp-bound human abca4 | 0.8778 | 3 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A096TX75_2_202_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8977 | 3 | 195 | 3.40.50.300 |
| af_O53149_2_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8877 | 3 | 197 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.887 | 3 | 197 | 3.40.50.300 |
| 4rvcA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8858 | 1 | 186 | 3.40.50.300 |
| af_Q2FVB4_1_230_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8853 | 1 | 197 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0K2VP24-F1-model_v4 | Heme exporter subunit ATP-binding component of ABC superfamily | 0.9853 | 1 | 198 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |
| AF-A0A6G4W577-F1-model_v4 | Heme ABC exporter ATP-binding protein CcmA | 0.9847 | 1 | 197 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |
| AF-A0A527Y2W6-F1-model_v4 | Heme ABC exporter ATP-binding protein CcmA | 0.9826 | 18 | 197 |
GO:0005524
GO:0016020 GO:0016887 GO:0017004 GO:0022857 |
| AF-A0A434EMT4-F1-model_v4 | Heme ABC exporter ATP-binding protein CcmA (EC 3.6.3.41) | 0.9808 | 1 | 178 |
GO:0005524
GO:0016020 GO:0016887 GO:0017004 GO:0022857 |
| AF-A0A2P7SHW4-F1-model_v4 | Heme ABC exporter ATP-binding protein CcmA | 0.9798 | 1 | 198 |
GO:0005524
GO:0015439 GO:0016020 GO:0016887 GO:0017004 |