F417702

General Info

Members Datasets Scaffolds Average Seq Length
348 319 696 202

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0000675|Ga0501034_0000675_50184_50915
Length 243
Sequence MMLDVPTAGTVVRAIENFVEKFQSRLGPKCRDAAGYGEGSEMRLIAEGLAGERGGEPVFSGVSFALGAGEALTITGPNGAGKSTLLRVLAGLLPAAAGAARIEGGGADRPDVAAAAHYLGHQNAMKTALTVTENLAFWRDFLGEPHCEVDEALEMVGLGDIGHLPFGYLSTGQRRRAAIARLLVSYRPVWLLDEPTAGLDKASEAQFSALMGAHLEDGGIIVAATHLPLGLAGAELRMGEGAR

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
5 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
8 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
12 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
13 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
14 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
27 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
42 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
50 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
51 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
52 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
53 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
54 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
55 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
56 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
57 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
58 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
59 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
60 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
61 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
62 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
64 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
70 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
71 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
72 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
73 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
74 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
76 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
77 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
78 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
79 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
80 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
81 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
82 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
83 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
84 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
85 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
86 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
87 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
88 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
89 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
90 2512875024
91 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
92 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
93 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
94 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
95 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
96 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
97 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
98 2738543024 Aminobacter sp. AP02 Isolate Unclassified
99 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
100 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
101 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
102 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
103 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
104 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
105 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
106 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
107 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
108 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
109 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
110 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
111 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
112 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
113 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
114 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
115 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
116 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
117 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
118 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
119 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
120 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
121 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
122 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
123 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
124 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
125 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
126 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
127 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
128 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
129 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
130 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
131 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
132 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
133 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
134 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
135 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
136 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
137 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
138 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
139 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
140 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
141 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
142 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
143 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
144 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
145 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
146 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
147 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
148 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
149 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
150 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
151 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
152 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
153 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
154 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
155 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
156 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
157 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
158 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
159 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
160 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
161 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
162 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
163 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
164 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
165 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
166 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
167 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
168 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
169 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
170 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
171 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
172 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
173 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
174 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
175 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
176 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
177 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
178 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
179 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
180 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
181 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
182 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
183 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
184 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
185 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
186 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
187 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
188 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
189 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
190 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
191 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
192 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
193 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
194 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
195 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
196 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
197 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
198 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
199 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
200 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
201 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
202 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
203 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
204 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
205 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
206 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
207 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
208 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
209 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
210 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
211 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
212 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
213 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
214 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
215 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
216 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
217 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
218 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
219 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
220 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
221 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
222 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
223 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
224 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
225 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
226 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
227 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
228 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
229 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
230 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
231 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
232 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
233 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
234 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
235 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
236 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
237 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
238 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
239 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
240 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
241 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
242 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
243 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
244 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
245 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
246 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
247 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
248 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
249 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
250 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
251 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
252 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
253 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
254 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
255 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
256 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
257 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
258 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
259 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
260 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
261 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
262 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
263 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
264 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
265 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
266 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
267 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
268 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
269 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
270 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
271 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
272 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
273 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
274 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
275 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
276 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
277 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
278 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
279 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
280 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
281 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
282 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
283 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
284 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
285 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
286 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
287 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
288 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
289 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
290 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
291 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
292 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
293 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
294 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
295 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
296 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
297 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
298 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
299 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
300 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
301 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
302 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
303 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
304 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
305 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
306 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
307 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
308 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
309 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
310 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
311 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
312 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
313 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
314 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
315 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
316 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
317 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
318 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
319 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 32.18
Metatranscriptomes 0
Isolates 67.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.05
Nodule 56.9
Rhizoplane 1.15
Rhizosphere 24.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0000675 3300049571 Bacteria 51860
2 JGI24740J21852_10035563 3300001979 Bacteria 1556
3 JGI24740J21852_10114403 3300001979 Bacteria 679
4 Ga0055542_1000859 3300003762 Bacteria 21282
5 Ga0055542_1003407 3300003762 Bacteria 4321
6 Ga0068853_100033210 3300005539 Bacteria 4376
7 Ga0070665_100131731 3300005548 Bacteria 2502
8 Ga0068856_100828651 3300005614 Bacteria 944
9 Ga0068852_100166877 3300005616 Bacteria 2060
10 Ga0081539_10002530 3300005985 Bacteria 25517
11 Ga0081539_10187664 3300005985 Bacteria 965
12 Ga0075365_10047734 3300006038 Bacteria 2815
13 Ga0075365_10206365 3300006038 Bacteria 1377
14 Ga0075365_10365454 3300006038 Bacteria 1017
15 Ga0075368_10035511 3300006042 Bacteria 1945
16 Ga0075368_10159868 3300006042 Bacteria 943
17 Ga0075364_10036155 3300006051 Bacteria 3193
18 Ga0075362_10011894 3300006177 Bacteria 3439
19 Ga0075362_10206028 3300006177 Bacteria 958
20 Ga0075367_10066813 3300006178 Bacteria 2155
21 Ga0075370_10091249 3300006353 Bacteria 1757
22 Ga0105240_10160425 3300009093 Bacteria 2671
23 Ga0105247_10587472 3300009101 Bacteria 824
24 Ga0105241_10519007 3300009174 Bacteria 1065
25 Ga0105248_10240862 3300009177 Bacteria 2036
26 Ga0105237_10225142 3300009545 Bacteria 1876
27 Ga0105239_10119148 3300010375 Bacteria 2929
28 Ga0105239_10699368 3300010375 Bacteria 1159
29 Ga0157369_10128304 3300013105 Bacteria 2688
30 Ga0157374_10918916 3300013296 Bacteria 893
31 Ga0163163_10373805 3300014325 Bacteria 1482
32 Ga0163161_10259926 3300017792 Bacteria 1356
33 Ga0209148_1000111 3300025254 Bacteria 198095
34 Ga0209233_1000118 3300025261 Bacteria 236172
35 Ga0209455_1000223 3300025272 Bacteria 77481
36 Ga0207647_10122361 3300025904 Bacteria 1533
37 Ga0207647_10169178 3300025904 Bacteria 1273
38 Ga0207695_10420866 3300025913 Bacteria 1220
39 Ga0207671_10050994 3300025914 Bacteria 3065
40 Ga0207694_10024705 3300025924 Bacteria 4564
41 Ga0207711_10140064 3300025941 Bacteria 2175
42 Ga0207667_10422554 3300025949 Bacteria 1356
43 Ga0207640_10065495 3300025981 Bacteria 2425
44 Ga0207640_10522210 3300025981 Bacteria 993
45 Ga0207639_10125763 3300026041 Bacteria 2114
46 Ga0207678_10055366 3300026067 Bacteria 3417
47 Ga0207674_10084584 3300026116 Bacteria 3170
48 Ga0207698_10526432 3300026142 Bacteria 1154
49 Ga0307408_100172937 3300031548 Bacteria 1726
50 Ga0307416_100649244 3300032002 Bacteria 1140
51 Ga0307414_10254060 3300032004 Bacteria 1463
52 Ga0316574_0250670 3300035398 Bacteria 1131
53 Ga0395900_0236601 3300037418 Bacteria 1834
54 Ga0395900_1137294 3300037418 Bacteria 697
55 Ga0395898_0215713 3300037466 Bacteria 1830
56 Ga0395905_0147811 3300037471 Bacteria 2211
57 Ga0395905_0406606 3300037471 Bacteria 1256
58 Ga0439465_0119728 3300041413 Bacteria 922
59 Ga0466965_0114744 3300044683 Bacteria 1387
60 Ga0466970_0320553 3300044765 Bacteria 876
61 Ga0495638_0040712 3300046460 Bacteria 2943
62 Ga0495668_0019307 3300046616 Bacteria 3931
63 Ga0495668_0103366 3300046616 Bacteria 1559
64 Ga0495625_0050330 3300046660 Bacteria 2990
65 Ga0495625_0176852 3300046660 Bacteria 1422
66 Ga0495625_0317215 3300046660 Bacteria 993
67 Ga0495687_023792 3300047443 Bacteria 2922
68 Ga0496112_0123520 3300048915 Bacteria 2560
69 Ga0496113_0567347 3300048916 Bacteria 910
70 Ga0496119_0219201 3300048922 Bacteria 974
71 Ga0496120_0044121 3300048923 Bacteria 2592
72 Ga0496120_0199246 3300048923 Bacteria 970
73 Ga0496121_0087694 3300048924 Bacteria 2442
74 Ga0496125_0088428 3300048928 Bacteria 2335
75 Ga0496125_0117161 3300048928 Bacteria 1911
76 Ga0501031_0007395 3300049568 Bacteria 7154
77 Ga0501032_0007442 3300049569 Bacteria 7995
78 Ga0501033_0003212 3300049570 Bacteria 13531
79 Ga0501034_0007546 3300049571 Bacteria 11569
80 Ga0501034_0081739 3300049571 Bacteria 3233
81 Ga0501034_0170540 3300049571 Bacteria 2143
82 Ga0501034_0802705 3300049571 Bacteria 834
83 Ga0501039_0006760 3300049575 Bacteria 8728
84 Ga0501039_0570854 3300049575 Bacteria 887
85 Ga0501040_0016832 3300049576 Bacteria 4848
86 Ga0501042_0009933 3300049578 Bacteria 6359
87 Ga0501043_0007371 3300049579 Bacteria 8728
88 Ga0501043_0220426 3300049579 Bacteria 1468
89 Ga0501046_0010104 3300049580 Bacteria 8124
90 Ga0501047_0008795 3300049581 Bacteria 9526
91 Ga0501047_0364740 3300049581 Bacteria 1280
92 Ga0501048_0002808 3300049582 Bacteria 13290
93 Ga0501068_0007859 3300049584 Bacteria 5910
94 Ga0501070_0010419 3300049586 Bacteria 7859
95 Ga0501073_0013994 3300049589 Bacteria 5830
96 Ga0501079_0034120 3300049741 Bacteria 3915
97 Ga0501080_0002743 3300049742 Bacteria 15460
98 Ga0501035_0003788 3300049822 Bacteria 14408
99 Ga0501044_0005319 3300049823 Bacteria 14319
100 nmdc:mga00v17_40157_c1 3300050491 Bacteria 2515
101 nmdc:mga0yw44_19693_c1 3300050492 Bacteria 3726
102 nmdc:mga0yw44_28450_c2 3300050492 Bacteria 2068
103 nmdc:mga06z11_123495_c1 3300050494 Bacteria 1447
104 nmdc:mga06z11_34987_c1 3300050494 Bacteria 2469
105 nmdc:mga04h51_22877_c1 3300050495 Bacteria 1896
106 nmdc:mga04h51_38371_c1 3300050495 Bacteria 1551
107 nmdc:mga07m45_142607_c1 3300050496 Bacteria 1388
108 Ga0500610_0295060 3300053079 Bacteria 718
109 Ga0500595_124122 3300053119 Bacteria 729
110 Ga0500616_0039940 3300053153 Bacteria 2527
111 Ga0500616_0047392 3300053153 Bacteria 2282
112 Ga0500627_0238038 3300053158 Bacteria 808
113 2509118456 2508501123 Bacteria 6283661
114 2509393897 2509276022 Bacteria 6200534
115 2510318363 2510065059 Bacteria 6847884
116 2511391837 2511231027 Bacteria 5013807
117 2512933588 2512875016 Bacteria 6529530
118 2512961727 2512875024 Bacteria 7195110
119 2514035591 2513237164 Bacteria 7563725
120 2514586626 2513237351 Bacteria 6968952
121 2588519665 2588253730 Bacteria 6881675
122 2597811964 2597489875 Bacteria 7010078
123 2644154540 2643221627 Bacteria 6761570
124 2694631635 2693429783 Bacteria 7019804
125 2694638310 2693429784 Bacteria 7241525
126 2739306035 2738543024 Bacteria 5603683
127 2756673677 2756170246 Bacteria 7451806
128 2765465725 2765235802 Bacteria 5618596
129 2770198319 2767802442 Bacteria 5747986
130 2776282499 2775506904 Bacteria 5954060
131 2792747537 2791355123 Bacteria 8049106
132 2839993369 2839993093 Bacteria 5512535
133 2840766372 2840764183 Bacteria 6358399
134 2844003146 2844002411 Bacteria 7168230
135 2844011114 2844009547 Bacteria 6728125
136 2847690221 2847686936 Bacteria 6278406
137 2856327158 2856320880 Bacteria 7263508
138 2856329775 2856328259 Bacteria 6528202
139 2856336579 2856334872 Bacteria 7037011
140 2856343504 2856342000 Bacteria 7176905
141 2856358850 2856356410 Bacteria 6297484
142 2856365089 2856364286 Bacteria 6939991
143 2857353234 2857349434 Bacteria 7926032
144 2857372233 2857367948 Bacteria 6965560
145 2869245508 2869242130 Bacteria 6609239
146 2869251998 2869249662 Bacteria 6868783
147 2869258520 2869256925 Bacteria 6981691
148 2869268776 2869264136 Bacteria 6880765
149 2869273727 2869271264 Bacteria 6908218
150 2869279611 2869278585 Bacteria 7077053
151 2869286287 2869285874 Bacteria 6901219
152 2871430256 2871429161 Bacteria 6547891
153 2871439937 2871435913 Bacteria 6880295
154 2871445061 2871444079 Bacteria 6423508
155 2871458699 2871451962 Bacteria 7336357
156 2871464855 2871459585 Bacteria 6866887
157 2871468672 2871466892 Bacteria 6923287
158 2871482657 2871481445 Bacteria 6700002
159 2871494973 2871488783 Bacteria 6929816
160 2871500146 2871495908 Bacteria 6935695
161 2874103210 2874102143 Bacteria 6342645
162 2874110673 2874109183 Bacteria 6517025
163 2874121959 2874116593 Bacteria 6674494
164 2874134208 2874131515 Bacteria 6820270
165 2874139397 2874139085 Bacteria 7021506
166 2874146673 2874146452 Bacteria 7533118
167 2874155747 2874155637 Bacteria 6724144
168 2874167818 2874162495 Bacteria 6174670
169 2874170652 2874168670 Bacteria 8062617
170 2876364158 2876363079 Bacteria 6544991
171 2876385591 2876377896 Bacteria 6565995
172 2876386999 2876386047 Bacteria 6698674
173 2876399202 2876392853 Bacteria 6660880
174 2876402423 2876399893 Bacteria 6927900
175 2876414076 2876413966 Bacteria 6831344
176 2876422768 2876420981 Bacteria 6687741
177 2878742138 2878738818 Bacteria 7136951
178 2878746452 2878745973 Bacteria 6867388
179 2878760098 2878753008 Bacteria 6922523
180 2878764268 2878760144 Bacteria 6823465
181 2878771338 2878767105 Bacteria 6898628
182 2878775991 2878774303 Bacteria 6108671
183 2881165299 2881161766 Bacteria 7127907
184 2881848735 2881845957 Bacteria 6611900
185 2881863451 2881861095 Bacteria 7128710
186 2882640389 2882632389 Bacteria 8154593
187 2885321448 2885318864 Bacteria 6729568
188 2885329073 2885326080 Bacteria 7134805
189 2888343694 2888337043 Bacteria 6629336
190 2889015219 2889010040 Bacteria 6749192
191 2889019701 2889016732 Bacteria 6700763
192 2889793090 2889790730 Bacteria 5689708
193 2889917339 2889914905 Bacteria 5702301
194 2894653761 2894652903 Bacteria 4587256
195 2903453738 2903448605 Bacteria 7357801
196 2903494332 2903492973 Bacteria 13473544
197 2903499839 2903492973 Bacteria 13473544
198 2903514684 2903513507 Bacteria 6344008
199 2903525682 2903521522 Bacteria 6525694
200 2903532771 2903528002 Bacteria 6586099
201 2903544961 2903540706 Bacteria 7062119
202 2904579982 2904578770 Bacteria 5302906
203 2904665729 2904659560 Bacteria 6685615
204 2906308853 2906308376 Bacteria 6841989
205 2906322133 2906321335 Bacteria 6579571
206 2906333919 2906328253 Bacteria 6585166
207 2906357582 2906354277 Bacteria 6991324
208 2906363424 2906363423 Bacteria 6856682
209 2906377475 2906370794 Bacteria 6881062
210 2906386026 2906378014 Bacteria 6911440
211 2906390913 2906386501 Bacteria 5977019
212 2906397297 2906393657 Bacteria 6790866
213 2906408080 2906401398 Bacteria 6693206
214 2906408450 2906408224 Bacteria 6162342
215 2906434225 2906427513 Bacteria 6375796
216 2919120346 2919119836 Bacteria 5208557
217 2922135800 2922130491 Bacteria 7173936
218 2922158459 2922151315 Bacteria 6902399
219 2922165394 2922158528 Bacteria 6573167
220 2922176076 2922172374 Bacteria 6167644
221 2922184392 2922178524 Bacteria 6025201
222 2924717566 2924710171 Bacteria 6752351
223 2924722458 2924718760 Bacteria 6331356
224 2924728352 2924726620 Bacteria 6271473
225 2924737286 2924733363 Bacteria 7574837
226 2924747615 2924741084 Bacteria 6661321
227 2924750700 2924748358 Bacteria 6154725
228 2924768600 2924762789 Bacteria 6561353
229 2924779822 2924776078 Bacteria 7492003
230 2924790901 2924784321 Bacteria 7416538
231 2928522776 2928521798 Bacteria 4960112
232 2937822192 2937813078 Bacteria 7783518
233 2937823872 2937822353 Bacteria 7290551
234 2937851685 2937848649 Bacteria 6983481
235 2937865684 2937861824 Bacteria 6660327
236 2937880590 2937877337 Bacteria 7246526
237 2937894374 2937891427 Bacteria 6357007
238 2937974220 2937972304 Bacteria 7532020
239 2937998806 2937994558 Bacteria 7036190
240 2954013857 2954011201 Bacteria 4762601
241 2958035189 2958034702 Bacteria 6989922
242 2958044221 2958041894 Bacteria 13082850
243 2958065678 2958064165 Bacteria 7158582
244 2958087723 2958084443 Bacteria 7312792
245 2958102812 2958100919 Bacteria 6800575
246 2958115100 2958108152 Bacteria 6681128
247 2958120393 2958115193 Bacteria 6923548
248 2958130214 2958122699 Bacteria 7280457
249 2958130686 2958130278 Bacteria 6897202
250 2958142058 2958137437 Bacteria 6050276
251 2958149818 2958144490 Bacteria 6677056
252 2958169281 2958165035 Bacteria 6906348
253 2958177307 2958172287 Bacteria 6716688
254 2958180025 2958179912 Bacteria 6874908
255 2961077852 2961077736 Bacteria 7079850
256 2961121072 2961114664 Bacteria 6680456
257 2961144116 2961136820 Bacteria 6775228
258 2961167743 2961163497 Bacteria 6901077
259 2961177367 2961170736 Bacteria 7072258
260 2961185086 2961183825 Bacteria 6688536
261 2963645616 2963644680 Bacteria 6530403
262 2965022562 2965018300 Bacteria 6883036
263 2965026680 2965025482 Bacteria 6532201
264 2965040044 2965032056 Bacteria 6887443
265 2965040525 2965040258 Bacteria 6855979
266 2965047919 2965047637 Bacteria 6623551
267 2965065080 2965062239 Bacteria 7412989
268 2965093546 2965089291 Bacteria 6866420
269 2965103199 2965102966 Bacteria 6800987
270 2965121104 2965119406 Bacteria 6956431
271 2968002472 2967996073 Bacteria 6787468
272 2968009703 2968003550 Bacteria 6929263
273 2968023609 2968016561 Bacteria 7022047
274 2968085048 2968083720 Bacteria 7351627
275 2968093504 2968091066 Bacteria 6052692
276 2968100222 2968097103 Bacteria 6107094
277 2968117222 2968110612 Bacteria 6814636
278 2968129627 2968128360 Bacteria 6270294
279 2968144747 2968138860 Bacteria 6605449
280 2968176144 2968171901 Bacteria 6894245
281 2970476191 2970469710 Bacteria 6969209
282 2970493792 2970489779 Bacteria 6517260
283 2970510041 2970503327 Bacteria 7099517
284 2970517305 2970510686 Bacteria 7006402
285 2970534501 2970532167 Bacteria 6553173
286 2970541822 2970540015 Bacteria 6977556
287 2970551946 2970547951 Bacteria 6931819
288 2970559112 2970554993 Bacteria 6814252
289 2970594211 2970593180 Bacteria 7073582
290 2970621889 2970619444 Bacteria 6986144
291 2970631319 2970627176 Bacteria 6680862
292 2977828619 2977821940 Bacteria 6906439
293 2977832600 2977828996 Bacteria 7007971
294 2977844311 2977843712 Bacteria 6753583
295 2977854344 2977851361 Bacteria 6694324
296 2977862085 2977858184 Bacteria 6215359
297 2977865666 2977864932 Bacteria 7534097
298 2977874342 2977872689 Bacteria 7270173
299 2977899925 2977898635 Bacteria 6675551
300 2977912913 2977907340 Bacteria 6577984
301 2977915682 2977915119 Bacteria 6829656
302 2977929541 2977922695 Bacteria 6956781
303 2977938957 2977935797 Bacteria 6252826
304 2977953545 2977950692 Bacteria 6893264
305 2977964938 2977957713 Bacteria 6877875
306 2977987990 2977986579 Bacteria 6581278
307 2979712951 2979710463 Bacteria 6785254
308 2979767621 2979764755 Bacteria 6610066
309 2979776825 2979772303 Bacteria 6618277
310 2979784496 2979779861 Bacteria 6219781
311 2979798296 2979793036 Bacteria 6808957
312 2979814917 2979808191 Bacteria 7179355
313 2987641826 2987636660 Bacteria 8088555
314 2987649233 2987645492 Bacteria 6117018
315 2987657884 2987652177 Bacteria 6969023
316 2987663750 2987659509 Bacteria 6966464
317 2987673329 2987666974 Bacteria 6509233
318 2987676490 2987673487 Bacteria 6884027
319 2996315201 2996310559 Bacteria 6357320
320 2996339465 2996336353 Bacteria 5511628
321 2996343990 2996341866 Bacteria 6643098
322 2996354775 2996348954 Bacteria 7239054
323 2996389819 2996386984 Bacteria 6978667
324 3000137679 3000135777 Bacteria 6891109
325 3002141698 3002141150 Bacteria 5254435
326 3004192807 3004188549 Bacteria 6952365
327 3004200080 3004195979 Bacteria 6776956
328 3004209362 3004203850 Bacteria 7307914
329 3004218395 3004211236 Bacteria 7417683
330 3004219508 3004218560 Bacteria 7421728
331 3004233717 3004232784 Bacteria 6662140
332 3004252163 3004248173 Bacteria 6563236
333 3004269429 3004268573 Bacteria 7043476
334 3004281423 3004275668 Bacteria 7114440
335 3004336977 3004334049 Bacteria 8449246
336 637076696 637000159 Bacteria 7596297
337 649870839 649633066 Bacteria 6690028
338 8002291852 8002285264 Bacteria 6717907
339 8004301659 8004300914 Bacteria 6132239
340 8004316224 8004312739 Bacteria 7444653
341 8004362586 8004361976 Bacteria 6858373
342 8004381596 8004374579 Bacteria 6898112
343 8004388687 8004387939 Bacteria 7049250
344 8004448269 8004445564 Bacteria 6322258
345 8004706450 8004703790 Bacteria 8006957
346 8004715109 8004714634 Bacteria 6776161
347 8004729358 8004727605 Bacteria 6643904
348 8055618213 8055617313 Bacteria 7548464
349 Ga0501034_0000675
350 JGI24740J21852_10035563
351 JGI24740J21852_10114403
352 Ga0055542_1000859
353 Ga0055542_1003407
354 Ga0068853_100033210
355 Ga0070665_100131731
356 Ga0068856_100828651
357 Ga0068852_100166877
358 Ga0081539_10002530
359 Ga0081539_10187664
360 Ga0075365_10047734
361 Ga0075365_10206365
362 Ga0075365_10365454
363 Ga0075368_10035511
364 Ga0075368_10159868
365 Ga0075364_10036155
366 Ga0075362_10011894
367 Ga0075362_10206028
368 Ga0075367_10066813
369 Ga0075370_10091249
370 Ga0105240_10160425
371 Ga0105247_10587472
372 Ga0105241_10519007
373 Ga0105248_10240862
374 Ga0105237_10225142
375 Ga0105239_10119148
376 Ga0105239_10699368
377 Ga0157369_10128304
378 Ga0157374_10918916
379 Ga0163163_10373805
380 Ga0163161_10259926
381 Ga0209148_1000111
382 Ga0209233_1000118
383 Ga0209455_1000223
384 Ga0207647_10122361
385 Ga0207647_10169178
386 Ga0207695_10420866
387 Ga0207671_10050994
388 Ga0207694_10024705
389 Ga0207711_10140064
390 Ga0207667_10422554
391 Ga0207640_10065495
392 Ga0207640_10522210
393 Ga0207639_10125763
394 Ga0207678_10055366
395 Ga0207674_10084584
396 Ga0207698_10526432
397 Ga0307408_100172937
398 Ga0307416_100649244
399 Ga0307414_10254060
400 Ga0316574_0250670
401 Ga0395900_0236601
402 Ga0395900_1137294
403 Ga0395898_0215713
404 Ga0395905_0147811
405 Ga0395905_0406606
406 Ga0439465_0119728
407 Ga0466965_0114744
408 Ga0466970_0320553
409 Ga0495638_0040712
410 Ga0495668_0019307
411 Ga0495668_0103366
412 Ga0495625_0050330
413 Ga0495625_0176852
414 Ga0495625_0317215
415 Ga0495687_023792
416 Ga0496112_0123520
417 Ga0496113_0567347
418 Ga0496119_0219201
419 Ga0496120_0044121
420 Ga0496120_0199246
421 Ga0496121_0087694
422 Ga0496125_0088428
423 Ga0496125_0117161
424 Ga0501031_0007395
425 Ga0501032_0007442
426 Ga0501033_0003212
427 Ga0501034_0007546
428 Ga0501034_0081739
429 Ga0501034_0170540
430 Ga0501034_0802705
431 Ga0501039_0006760
432 Ga0501039_0570854
433 Ga0501040_0016832
434 Ga0501042_0009933
435 Ga0501043_0007371
436 Ga0501043_0220426
437 Ga0501046_0010104
438 Ga0501047_0008795
439 Ga0501047_0364740
440 Ga0501048_0002808
441 Ga0501068_0007859
442 Ga0501070_0010419
443 Ga0501073_0013994
444 Ga0501079_0034120
445 Ga0501080_0002743
446 Ga0501035_0003788
447 Ga0501044_0005319
448 nmdc:mga00v17_40157_c1
449 nmdc:mga0yw44_19693_c1
450 nmdc:mga0yw44_28450_c2
451 nmdc:mga06z11_123495_c1
452 nmdc:mga06z11_34987_c1
453 nmdc:mga04h51_22877_c1
454 nmdc:mga04h51_38371_c1
455 nmdc:mga07m45_142607_c1
456 Ga0500610_0295060
457 Ga0500595_124122
458 Ga0500616_0039940
459 Ga0500616_0047392
460 Ga0500627_0238038
461 2509118456
462 2509393897
463 2510318363
464 2511391837
465 2512933588
466 2512961727
467 2514035591
468 2514586626
469 2588519665
470 2597811964
471 2644154540
472 2694631635
473 2694638310
474 2739306035
475 2756673677
476 2765465725
477 2770198319
478 2776282499
479 2792747537
480 2839993369
481 2840766372
482 2844003146
483 2844011114
484 2847690221
485 2856327158
486 2856329775
487 2856336579
488 2856343504
489 2856358850
490 2856365089
491 2857353234
492 2857372233
493 2869245508
494 2869251998
495 2869258520
496 2869268776
497 2869273727
498 2869279611
499 2869286287
500 2871430256
501 2871439937
502 2871445061
503 2871458699
504 2871464855
505 2871468672
506 2871482657
507 2871494973
508 2871500146
509 2874103210
510 2874110673
511 2874121959
512 2874134208
513 2874139397
514 2874146673
515 2874155747
516 2874167818
517 2874170652
518 2876364158
519 2876385591
520 2876386999
521 2876399202
522 2876402423
523 2876414076
524 2876422768
525 2878742138
526 2878746452
527 2878760098
528 2878764268
529 2878771338
530 2878775991
531 2881165299
532 2881848735
533 2881863451
534 2882640389
535 2885321448
536 2885329073
537 2888343694
538 2889015219
539 2889019701
540 2889793090
541 2889917339
542 2894653761
543 2903453738
544 2903494332
545 2903499839
546 2903514684
547 2903525682
548 2903532771
549 2903544961
550 2904579982
551 2904665729
552 2906308853
553 2906322133
554 2906333919
555 2906357582
556 2906363424
557 2906377475
558 2906386026
559 2906390913
560 2906397297
561 2906408080
562 2906408450
563 2906434225
564 2919120346
565 2922135800
566 2922158459
567 2922165394
568 2922176076
569 2922184392
570 2924717566
571 2924722458
572 2924728352
573 2924737286
574 2924747615
575 2924750700
576 2924768600
577 2924779822
578 2924790901
579 2928522776
580 2937822192
581 2937823872
582 2937851685
583 2937865684
584 2937880590
585 2937894374
586 2937974220
587 2937998806
588 2954013857
589 2958035189
590 2958044221
591 2958065678
592 2958087723
593 2958102812
594 2958115100
595 2958120393
596 2958130214
597 2958130686
598 2958142058
599 2958149818
600 2958169281
601 2958177307
602 2958180025
603 2961077852
604 2961121072
605 2961144116
606 2961167743
607 2961177367
608 2961185086
609 2963645616
610 2965022562
611 2965026680
612 2965040044
613 2965040525
614 2965047919
615 2965065080
616 2965093546
617 2965103199
618 2965121104
619 2968002472
620 2968009703
621 2968023609
622 2968085048
623 2968093504
624 2968100222
625 2968117222
626 2968129627
627 2968144747
628 2968176144
629 2970476191
630 2970493792
631 2970510041
632 2970517305
633 2970534501
634 2970541822
635 2970551946
636 2970559112
637 2970594211
638 2970621889
639 2970631319
640 2977828619
641 2977832600
642 2977844311
643 2977854344
644 2977862085
645 2977865666
646 2977874342
647 2977899925
648 2977912913
649 2977915682
650 2977929541
651 2977938957
652 2977953545
653 2977964938
654 2977987990
655 2979712951
656 2979767621
657 2979776825
658 2979784496
659 2979798296
660 2979814917
661 2987641826
662 2987649233
663 2987657884
664 2987663750
665 2987673329
666 2987676490
667 2996315201
668 2996339465
669 2996343990
670 2996354775
671 2996389819
672 3000137679
673 3002141698
674 3004192807
675 3004200080
676 3004209362
677 3004218395
678 3004219508
679 3004233717
680 3004252163
681 3004269429
682 3004281423
683 3004336977
684 637076696
685 649870839
686 8002291852
687 8004301659
688 8004316224
689 8004362586
690 8004381596
691 8004388687
692 8004448269
693 8004706450
694 8004715109
695 8004729358
696 8055618213

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

59

197

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o17-assembly1.cif.gz_B abc transporter nosdfy e154q, atp-bound in lipid nanodisc 0.8939 1 186
7e7q-assembly1.cif.gz_A cryo-em structure of human abca4 in atp-bound state 0.8864 3 197
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.8858 1 186
8ce5-assembly1.cif.gz_A cytochrome c maturation complex ccmabcd, e154q, atp-bound 0.8778 3 197
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.8778 3 197
ID Description Score Start End Superfamily
af_A0A096TX75_2_202_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8977 3 195 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8877 3 197 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.887 3 197 3.40.50.300
4rvcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8858 1 186 3.40.50.300
af_Q2FVB4_1_230_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8853 1 197 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A0K2VP24-F1-model_v4 Heme exporter subunit ATP-binding component of ABC superfamily 0.9853 1 198 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-A0A6G4W577-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9847 1 197 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004
AF-A0A527Y2W6-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9826 18 197 GO:0005524
GO:0016020
GO:0016887
GO:0017004
GO:0022857
AF-A0A434EMT4-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA (EC 3.6.3.41) 0.9808 1 178 GO:0005524
GO:0016020
GO:0016887
GO:0017004
GO:0022857
AF-A0A2P7SHW4-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9798 1 198 GO:0005524
GO:0015439
GO:0016020
GO:0016887
GO:0017004

Map