F417430

General Info

Members Datasets Scaffolds Average Seq Length
348 248 696 155

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100047922|Ga0070714_1000479223
Length 184
Sequence MRKTTPRRREYDAAAPGATKTRKDMQIGRARHTAAMEIKELGHLVLYVRNLQRSVAFYRDVLGWKQVVPDVPGMPASAFSSGRTHHELLLIEVGENAQPIPGGRRVGMYHFGLKVGDSDDDLRAALGRLEEAGVRVVGASDHTVTHSLYILDPDGNEIELYVDTGVDWKADPMAIMAPTRPLAL

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
96 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
97 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
123 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
124 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
125 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
126 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
127 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
185 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
220 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
221 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
222 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 2508501039 Frankia saprophytica CN3 Isolate Nodule
228 2527291627 Frankia casuarinae Thr Isolate Nodule
229 2527291629 Frankia sp. BMG5.23 Isolate Nodule
230 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
231 2576861822 Frankia sp. CeD Isolate Nodule
232 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
233 2619618881 Frankia sp. ACN1ag Isolate Unclassified
234 2619619003 Frankia sp. CpI1-P Isolate Nodule
235 2626541554 Frankia sp. AvcI.1 Isolate Nodule
236 2671180195 Frankia sp. CcI49 Isolate Nodule
237 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
238 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
239 2684623036 Frankia sp. CgIM4 Isolate Nodule
240 2687453737 Frankia sp. BMG5.36 Isolate Nodule
241 2710264753 Frankia sp. KB5 Isolate Nodule
242 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
243 2773857922 Frankia sp. CcI49 Isolate Nodule
244 2773857924 Frankia sp. CgIS1 Isolate Nodule
245 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
246 637000116 Frankia casuarinae CcI3 Isolate Nodule
247 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
248 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.39
Metatranscriptomes 0.29
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.31
Nodule 4.89
Rhizoplane 9.77
Rhizosphere 76.44
Stem 0
Stem Tuber 0
Unclassified 1.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100047922 3300005435 Bacteria 3632
2 JGI25407J50210_10019322 3300003373 Bacteria 1771
3 Ga0070683_100595775 3300005329 Bacteria 1058
4 Ga0070677_10137604 3300005333 Bacteria 1122
5 Ga0070677_10777447 3300005333 Bacteria 545
6 Ga0070682_100978833 3300005337 Bacteria 701
7 Ga0070668_100182665 3300005347 Unclassified 1714
8 Ga0070671_101816340 3300005355 Bacteria 542
9 Ga0070709_10001569 3300005434 Bacteria 12332
10 Ga0070709_10900590 3300005434 Bacteria 699
11 Ga0070714_100054650 3300005435 Bacteria 3412
12 Ga0070714_100164836 3300005435 Bacteria 2008
13 Ga0070714_100299364 3300005435 Bacteria 1499
14 Ga0070714_100366474 3300005435 Bacteria 1356
15 Ga0070714_100889323 3300005435 Bacteria 864
16 Ga0070713_100002702 3300005436 Bacteria 11569
17 Ga0070713_100253993 3300005436 Bacteria 1604
18 Ga0070713_100653918 3300005436 Bacteria 1001
19 Ga0070710_10006656 3300005437 Bacteria 5561
20 Ga0070711_100210549 3300005439 Bacteria 1505
21 Ga0070705_100115818 3300005440 Bacteria 1721
22 Ga0070700_101041413 3300005441 Bacteria 675
23 Ga0070708_101166251 3300005445 Bacteria 721
24 Ga0068867_100956289 3300005459 Bacteria 774
25 Ga0070706_100018854 3300005467 Bacteria 6364
26 Ga0070707_100135165 3300005468 Bacteria 2399
27 Ga0070698_100037672 3300005471 Bacteria 4985
28 Ga0070698_100126227 3300005471 Bacteria 2515
29 Ga0070686_101009764 3300005544 Bacteria 683
30 Ga0070686_101290397 3300005544 Bacteria 609
31 Ga0070696_101282955 3300005546 Bacteria 621
32 Ga0070704_100451384 3300005549 Bacteria 1107
33 Ga0068856_100015885 3300005614 Bacteria 7278
34 Ga0068859_100000073 3300005617 Bacteria 93018
35 Ga0068859_100011409 3300005617 Bacteria 8933
36 Ga0068864_100088803 3300005618 Bacteria 2723
37 Ga0068864_101037509 3300005618 Bacteria 814
38 Ga0068863_100000219 3300005841 Bacteria 61378
39 Ga0068858_100000237 3300005842 Bacteria 59734
40 Ga0068858_100010981 3300005842 Bacteria 8559
41 Ga0068858_102448272 3300005842 Bacteria 516
42 Ga0068862_100000226 3300005844 Bacteria 62735
43 Ga0081455_10007241 3300005937 Bacteria 11718
44 Ga0081455_10008314 3300005937 Bacteria 10812
45 Ga0081455_10029432 3300005937 Bacteria 5007
46 Ga0081538_10003089 3300005981 Bacteria 15834
47 Ga0081538_10038606 3300005981 Bacteria 3077
48 Ga0070717_10026765 3300006028 Bacteria 4604
49 Ga0070717_10059710 3300006028 Bacteria 3156
50 Ga0070717_10596222 3300006028 Bacteria 1002
51 Ga0075365_10057319 3300006038 Bacteria 2591
52 Ga0075365_10615751 3300006038 Bacteria 768
53 Ga0075364_10337050 3300006051 Bacteria 1028
54 Ga0075364_10563777 3300006051 Bacteria 778
55 Ga0070715_10007264 3300006163 Bacteria 3808
56 Ga0070716_100005804 3300006173 Bacteria 5994
57 Ga0070716_100015466 3300006173 Bacteria 3920
58 Ga0070712_101231038 3300006175 Bacteria 651
59 Ga0075367_10154434 3300006178 Bacteria 1425
60 Ga0075428_100071186 3300006844 Bacteria 3801
61 Ga0075430_100066631 3300006846 Bacteria 3024
62 Ga0075431_100665192 3300006847 Bacteria 1021
63 Ga0075431_100674712 3300006847 Bacteria 1012
64 Ga0075429_100059512 3300006880 Bacteria 3328
65 Ga0068865_100282384 3300006881 Bacteria 1322
66 Ga0097620_100000073 3300006931 Bacteria 93018
67 Ga0097620_100011408 3300006931 Bacteria 8933
68 Ga0075435_100861431 3300007076 Bacteria 790
69 Ga0099794_10241986 3300007265 Bacteria 930
70 Ga0105240_10837811 3300009093 Bacteria 994
71 Ga0105245_10009984 3300009098 Bacteria 8266
72 Ga0105245_10498554 3300009098 Bacteria 1233
73 Ga0105245_11062141 3300009098 Bacteria 855
74 Ga0105245_11100370 3300009098 Bacteria 841
75 Ga0105247_10001833 3300009101 Bacteria 14883
76 Ga0105247_10153677 3300009101 Bacteria 1518
77 Ga0114129_10933961 3300009147 Bacteria 1097
78 Ga0114129_11845043 3300009147 Bacteria 734
79 Ga0105241_11061091 3300009174 Bacteria 761
80 Ga0105242_10151221 3300009176 Bacteria 2024
81 Ga0105242_10401756 3300009176 Bacteria 1279
82 Ga0105249_10015207 3300009553 Bacteria 6810
83 Ga0099796_10383466 3300010159 Unclassified 613
84 Ga0105239_12642764 3300010375 Bacteria 586
85 Ga0105246_10134205 3300011119 Bacteria 1853
86 Ga0157370_10559453 3300013104 Bacteria 1048
87 Ga0157369_10677396 3300013105 Bacteria 1063
88 Ga0157369_11309307 3300013105 Bacteria 738
89 Ga0157375_10097468 3300013308 Bacteria 3015
90 Ga0163163_10002132 3300014325 Bacteria 16703
91 Ga0157379_10006719 3300014968 Bacteria 9937
92 Ga0163161_10045276 3300017792 Bacteria 3172
93 Ga0206353_10399142 3300020082 Bacteria 570
94 Ga0213871_10246425 3300021441 Bacteria 567
95 Ga0207692_10034055 3300025898 Bacteria 2463
96 Ga0207710_10000032 3300025900 Bacteria 274354
97 Ga0207710_10071870 3300025900 Bacteria 1588
98 Ga0207685_10026438 3300025905 Bacteria 2019
99 Ga0207699_10000094 3300025906 Bacteria 65720
100 Ga0207699_10065376 3300025906 Bacteria 2204
101 Ga0207684_10000574 3300025910 Bacteria 44726
102 Ga0207654_11085882 3300025911 Bacteria 583
103 Ga0207707_10407435 3300025912 Bacteria 1167
104 Ga0207695_10689373 3300025913 Bacteria 902
105 Ga0207693_10077406 3300025915 Bacteria 2604
106 Ga0207663_10273397 3300025916 Bacteria 1252
107 Ga0207652_10355658 3300025921 Bacteria 1322
108 Ga0207646_10080065 3300025922 Bacteria 2921
109 Ga0207687_10019311 3300025927 Bacteria 4515
110 Ga0207687_10418459 3300025927 Bacteria 1105
111 Ga0207687_10844196 3300025927 Bacteria 782
112 Ga0207700_10001999 3300025928 Bacteria 11625
113 Ga0207700_10016925 3300025928 Bacteria 4855
114 Ga0207700_11173602 3300025928 Bacteria 686
115 Ga0207664_10003251 3300025929 Bacteria 10787
116 Ga0207664_10107938 3300025929 Bacteria 2310
117 Ga0207664_10112720 3300025929 Bacteria 2264
118 Ga0207664_11666322 3300025929 Bacteria 560
119 Ga0207686_10076087 3300025934 Bacteria 2175
120 Ga0207686_10224792 3300025934 Bacteria 1357
121 Ga0207665_10001880 3300025939 Bacteria 14150
122 Ga0207665_10029392 3300025939 Bacteria 3632
123 Ga0207661_11380341 3300025944 Bacteria 647
124 Ga0207712_10015319 3300025961 Bacteria 4942
125 Ga0207668_11090203 3300025972 Bacteria 716
126 Ga0207677_11430062 3300026023 Bacteria 637
127 Ga0207703_10000003 3300026035 Bacteria 532213
128 Ga0207708_11132062 3300026075 Bacteria 683
129 Ga0207702_10069284 3300026078 Bacteria 3032
130 Ga0207641_10009089 3300026088 Bacteria 8207
131 Ga0207676_10595591 3300026095 Bacteria 1061
132 Ga0207683_11127316 3300026121 Bacteria 727
133 Ga0268266_10676579 3300028379 Bacteria 994
134 Ga0268265_10000015 3300028380 Bacteria 322854
135 Ga0265338_10003034 3300028800 Bacteria 24169
136 Ga0307509_10503551 3300031507 Bacteria 895
137 Ga0316578_10017369 3300031728 Bacteria 3913
138 Ga0316577_10483267 3300031733 Bacteria 704
139 Ga0316580_10036006 3300032139 Bacteria 1532
140 Ga0373944_0094693 3300035089 Bacteria 1002
141 Ga0373923_0112786 3300035111 Bacteria 1209
142 Ga0373936_0361965 3300035113 Bacteria 662
143 Ga0373945_0143528 3300035116 Bacteria 964
144 Ga0373954_0080052 3300035118 Bacteria 1560
145 Ga0373946_0163322 3300035171 Bacteria 1047
146 Ga0373955_0609934 3300035172 Bacteria 668
147 Ga0316574_0014516 3300035398 Bacteria 4554
148 Ga0373935_0369610 3300035692 Bacteria 1025
149 Ga0373935_0503293 3300035692 Bacteria 880
150 Ga0373927_0087993 3300035695 Bacteria 2016
151 Ga0373947_1125367 3300035725 Bacteria 535
152 Ga0373937_0010166 3300036401 Bacteria 8208
153 Ga0373937_1119316 3300036401 Bacteria 736
154 Ga0316584_0173040 3300036712 Bacteria 1600
155 Ga0373925_0007822 3300037068 Bacteria 7784
156 Ga0373925_0301706 3300037068 Bacteria 1293
157 Ga0373925_0517263 3300037068 Bacteria 980
158 Ga0395900_0031444 3300037418 Bacteria 5454
159 Ga0395900_0390356 3300037418 Unclassified 1358
160 Ga0395898_0263137 3300037466 Bacteria 1645
161 Ga0395905_0305091 3300037471 Bacteria 1480
162 Ga0395901_0209435 3300038443 Bacteria 2041
163 Ga0395901_0723068 3300038443 Unclassified 991
164 Ga0436365_0431776 3300039437 Bacteria 1946
165 Ga0436360_1169676 3300039438 Bacteria 784
166 Ga0451807_1313167 3300041486 Bacteria 605
167 Ga0451841_1116952 3300041498 Bacteria 814
168 Ga0451853_1303083 3300041512 Bacteria 1583
169 Ga0439443_022868 3300042003 Bacteria 995
170 Ga0439448_0001608 3300042005 Bacteria 5919
171 Ga0439450_000461 3300042008 Bacteria 5286
172 Ga0439454_030121 3300042011 Bacteria 846
173 Ga0439456_058211 3300042013 Bacteria 848
174 Ga0439463_005356 3300042016 Bacteria 3186
175 Ga0439458_0139862 3300042157 Bacteria 645
176 Ga0439444_0011123 3300042437 Bacteria 1452
177 Ga0439464_0001366 3300042439 Bacteria 5717
178 Ga0439460_0002958 3300042461 Bacteria 4093
179 Ga0466966_0044996 3300044684 Bacteria 2823
180 Ga0466963_0561698 3300044694 Bacteria 806
181 Ga0466964_0216944 3300044706 Bacteria 927
182 Ga0466960_0456760 3300044901 Bacteria 743
183 Ga0466959_0111852 3300045049 Bacteria 1948
184 Ga0466967_0107509 3300045976 Bacteria 2559
185 Ga0466967_0327030 3300045976 Bacteria 1480
186 Ga0495592_0209812 3300046454 Bacteria 1309
187 Ga0495629_0132752 3300046459 Bacteria 1734
188 Ga0495651_0005471 3300046462 Bacteria 9690
189 Ga0495653_0350317 3300046463 Bacteria 950
190 Ga0495653_0471823 3300046463 Bacteria 786
191 Ga0495662_0282357 3300046476 Bacteria 817
192 Ga0495664_0130417 3300046477 Bacteria 1522
193 Ga0495608_0281571 3300046511 Bacteria 1032
194 Ga0495618_0115471 3300046514 Bacteria 1719
195 Ga0495628_0649171 3300046516 Bacteria 749
196 Ga0495628_1122003 3300046516 Bacteria 536
197 Ga0495630_0487085 3300046517 Bacteria 946
198 Ga0495652_0442523 3300046529 Bacteria 911
199 Ga0495640_0032960 3300046533 Bacteria 3685
200 Ga0495640_0539811 3300046533 Bacteria 707
201 Ga0495586_0016035 3300046535 Bacteria 3987
202 Ga0495587_0053981 3300046536 Bacteria 2368
203 Ga0495645_0255001 3300046543 Bacteria 1164
204 Ga0495645_0515601 3300046543 Bacteria 745
205 Ga0495667_0073188 3300046559 Bacteria 2232
206 Ga0495634_0216007 3300046642 Bacteria 1185
207 Ga0495634_0663906 3300046642 Bacteria 601
208 Ga0495635_0073597 3300046663 Bacteria 2340
209 Ga0495635_0442234 3300046663 Bacteria 860
210 Ga0495635_0633613 3300046663 Bacteria 696
211 Ga0495635_0688373 3300046663 Bacteria 663
212 Ga0495657_0170005 3300046675 Bacteria 1343
213 Ga0495599_0295674 3300046678 Bacteria 978
214 Ga0495599_0645511 3300046678 Bacteria 613
215 Ga0495623_0322468 3300046679 Bacteria 848
216 Ga0495646_0119573 3300046680 Bacteria 1492
217 Ga0495613_0004347 3300046689 Bacteria 10607
218 Ga0495624_0377926 3300046690 Bacteria 851
219 Ga0495600_0373926 3300046809 Bacteria 890
220 Ga0495604_0509771 3300047317 Bacteria 779
221 Ga0495674_0004251 3300047319 Bacteria 13794
222 Ga0495674_0431766 3300047319 Bacteria 1060
223 Ga0495676_0313917 3300047321 Bacteria 1054
224 Ga0495680_0080105 3300047322 Bacteria 2468
225 Ga0495675_0476523 3300047444 Bacteria 719
226 Ga0495684_0377150 3300047471 Bacteria 1001
227 Ga0495684_0557315 3300047471 Bacteria 779
228 Ga0495602_0765694 3300048088 Bacteria 650
229 Ga0496100_0200919 3300048903 Bacteria 1453
230 Ga0496101_0188687 3300048904 Bacteria 1590
231 Ga0496101_0511704 3300048904 Bacteria 949
232 Ga0496101_0568555 3300048904 Bacteria 896
233 Ga0496102_0276456 3300048905 Bacteria 1583
234 Ga0496102_0695706 3300048905 Bacteria 940
235 Ga0496103_0173548 3300048906 Bacteria 1385
236 Ga0496103_0914159 3300048906 Unclassified 549
237 Ga0496104_0009337 3300048907 Bacteria 8723
238 Ga0496105_0037927 3300048908 Bacteria 3969
239 Ga0496105_0108713 3300048908 Bacteria 2289
240 Ga0496105_0172267 3300048908 Bacteria 1774
241 Ga0496106_0323304 3300048909 Bacteria 1238
242 Ga0496107_0011219 3300048910 Bacteria 6237
243 Ga0496108_0211867 3300048911 Bacteria 1682
244 Ga0496108_0740953 3300048911 Bacteria 850
245 Ga0496109_0100973 3300048912 Bacteria 2677
246 Ga0496109_0210376 3300048912 Bacteria 1829
247 Ga0496109_0618961 3300048912 Bacteria 1019
248 Ga0496110_0640546 3300048913 Bacteria 962
249 Ga0496110_0860772 3300048913 Bacteria 812
250 Ga0496112_0016678 3300048915 Bacteria 6887
251 Ga0496112_0820008 3300048915 Bacteria 855
252 Ga0496113_0123591 3300048916 Bacteria 2025
253 Ga0496114_0021691 3300048917 Bacteria 5226
254 Ga0496114_0046085 3300048917 Bacteria 3623
255 Ga0496114_0287787 3300048917 Bacteria 1449
256 Ga0496114_0346697 3300048917 Bacteria 1313
257 Ga0496114_1644977 3300048917 Bacteria 530
258 Ga0496115_0361208 3300048918 Bacteria 1183
259 Ga0496115_0445568 3300048918 Bacteria 1046
260 Ga0496115_0464032 3300048918 Bacteria 1021
261 Ga0496116_0000873 3300048919 Bacteria 37590
262 Ga0496118_0002367 3300048921 Bacteria 25534
263 Ga0496118_0088423 3300048921 Bacteria 2143
264 Ga0496119_0005215 3300048922 Bacteria 12548
265 Ga0496119_0016253 3300048922 Bacteria 5678
266 Ga0496120_0081993 3300048923 Bacteria 1744
267 Ga0496120_0132320 3300048923 Bacteria 1276
268 Ga0496121_0005753 3300048924 Bacteria 15742
269 Ga0496121_0086164 3300048924 Bacteria 2469
270 Ga0501033_0086754 3300049570 Bacteria 2291
271 Ga0501036_0025450 3300049572 Bacteria 4992
272 Ga0501037_0599751 3300049573 Bacteria 740
273 Ga0501038_0015793 3300049574 Bacteria 6861
274 Ga0501038_0263627 3300049574 Bacteria 1361
275 Ga0501039_0056851 3300049575 Bacteria 3031
276 Ga0501040_0010479 3300049576 Bacteria 6062
277 Ga0501041_0013597 3300049577 Bacteria 4827
278 Ga0501041_0224694 3300049577 Bacteria 1178
279 Ga0501042_0060372 3300049578 Bacteria 2708
280 Ga0501042_0125547 3300049578 Bacteria 1847
281 Ga0501043_0051967 3300049579 Bacteria 3220
282 Ga0501046_0047904 3300049580 Bacteria 3387
283 Ga0501048_0037323 3300049582 Bacteria 3489
284 Ga0501048_0123929 3300049582 Bacteria 1827
285 Ga0501067_0069866 3300049583 Bacteria 1945
286 Ga0501071_0053221 3300049587 Bacteria 2919
287 Ga0501071_0059679 3300049587 Bacteria 2760
288 Ga0501071_0691936 3300049587 Bacteria 785
289 Ga0501074_0006391 3300049590 Bacteria 8507
290 Ga0501074_0139663 3300049590 Bacteria 1733
291 Ga0501075_0025237 3300049591 Bacteria 4367
292 Ga0501075_0058677 3300049591 Bacteria 2898
293 Ga0501076_0047891 3300049592 Bacteria 3380
294 Ga0501076_0078601 3300049592 Bacteria 2647
295 Ga0501076_0140147 3300049592 Bacteria 1964
296 Ga0501077_0058055 3300049593 Bacteria 2457
297 Ga0501079_0019809 3300049741 Bacteria 5141
298 Ga0501079_0037974 3300049741 Bacteria 3714
299 Ga0501080_1540262 3300049742 Bacteria 564
300 Ga0501081_0018129 3300049743 Bacteria 4672
301 Ga0501035_0404569 3300049822 Bacteria 1135
302 Ga0501045_0025575 3300049824 Bacteria 4245
303 Ga0501045_0373002 3300049824 Bacteria 1062
304 nmdc:mga00v17_48703_c1 3300050491 Bacteria 2569
305 nmdc:mga0yw44_488978_c1 3300050492 Unclassified 835
306 nmdc:mga0yw44_97764_c1 3300050492 Bacteria 1865
307 nmdc:mga09592_261641_c1 3300050508 Bacteria 1500
308 nmdc:mga06r32_210423_c1 3300050510 Bacteria 1932
309 nmdc:mga06r32_950894_c1 3300050510 Bacteria 814
310 Ga0495601_0544124 3300053077 Bacteria 747
311 Ga0495612_0460425 3300053078 Bacteria 581
312 Ga0495595_0019678 3300053084 Bacteria 2932
313 Ga0495619_0009071 3300053085 Bacteria 6276
314 Ga0495619_0205650 3300053085 Bacteria 1363
315 Ga0495619_0726222 3300053085 Bacteria 675
316 Ga0500644_0109730 3300053088 Bacteria 1061
317 Ga0500646_0197936 3300053090 Bacteria 688
318 Ga0500583_0251641 3300053092 Bacteria 872
319 Ga0500559_0009964 3300053136 Bacteria 4094
320 Ga0500568_0000141 3300053139 Bacteria 64491
321 Ga0500568_0042318 3300053139 Bacteria 1826
322 Ga0500616_0075419 3300053153 Bacteria 1707
323 Ga0501084_0005926 3300054114 Bacteria 10066
324 Ga0501084_0899361 3300054114 Bacteria 744
325 Ga0501082_0300605 3300060353 Bacteria 1397
326 Ga0530510_0132997 3300061734 Bacteria 1830
327 2508670396 2508501039 Bacteria 9978592
328 2528202443 2527291627 Bacteria 5309833
329 2528212385 2527291629 Bacteria 5267418
330 2546947238 2546825537 Bacteria 5389291
331 2579747262 2576861822 Bacteria 5004595
332 2579857299 2579778521 Bacteria 7624758
333 2619854405 2619618881 Bacteria 7521104
334 2620353018 2619619003 Bacteria 7619552
335 2626639816 2626541554 Bacteria 7741902
336 2671839247 2671180195 Bacteria 9757215
337 2676204756 2675902999 Bacteria 9438463
338 2686535143 2684623035 Bacteria 8032739
339 2686541267 2684623036 Bacteria 5199090
340 2689959937 2687453737 Bacteria 11203906
341 2710604964 2710264753 Bacteria 5455564
342 2774849331 2773857921 Bacteria 9435764
343 2774857403 2773857922 Bacteria 9757215
344 2774868131 2773857924 Bacteria 5256821
345 2895885208 2895880812 Bacteria 11255272
346 637878138 637000116 Bacteria 5433628
347 8054920817 8054913762 Bacteria 7713009
348 8054927000 8054920844 Bacteria 7068637
349 Ga0070714_100047922
350 JGI25407J50210_10019322
351 Ga0070683_100595775
352 Ga0070677_10137604
353 Ga0070677_10777447
354 Ga0070682_100978833
355 Ga0070668_100182665
356 Ga0070671_101816340
357 Ga0070709_10001569
358 Ga0070709_10900590
359 Ga0070714_100054650
360 Ga0070714_100164836
361 Ga0070714_100299364
362 Ga0070714_100366474
363 Ga0070714_100889323
364 Ga0070713_100002702
365 Ga0070713_100253993
366 Ga0070713_100653918
367 Ga0070710_10006656
368 Ga0070711_100210549
369 Ga0070705_100115818
370 Ga0070700_101041413
371 Ga0070708_101166251
372 Ga0068867_100956289
373 Ga0070706_100018854
374 Ga0070707_100135165
375 Ga0070698_100037672
376 Ga0070698_100126227
377 Ga0070686_101009764
378 Ga0070686_101290397
379 Ga0070696_101282955
380 Ga0070704_100451384
381 Ga0068856_100015885
382 Ga0068859_100000073
383 Ga0068859_100011409
384 Ga0068864_100088803
385 Ga0068864_101037509
386 Ga0068863_100000219
387 Ga0068858_100000237
388 Ga0068858_100010981
389 Ga0068858_102448272
390 Ga0068862_100000226
391 Ga0081455_10007241
392 Ga0081455_10008314
393 Ga0081455_10029432
394 Ga0081538_10003089
395 Ga0081538_10038606
396 Ga0070717_10026765
397 Ga0070717_10059710
398 Ga0070717_10596222
399 Ga0075365_10057319
400 Ga0075365_10615751
401 Ga0075364_10337050
402 Ga0075364_10563777
403 Ga0070715_10007264
404 Ga0070716_100005804
405 Ga0070716_100015466
406 Ga0070712_101231038
407 Ga0075367_10154434
408 Ga0075428_100071186
409 Ga0075430_100066631
410 Ga0075431_100665192
411 Ga0075431_100674712
412 Ga0075429_100059512
413 Ga0068865_100282384
414 Ga0097620_100000073
415 Ga0097620_100011408
416 Ga0075435_100861431
417 Ga0099794_10241986
418 Ga0105240_10837811
419 Ga0105245_10009984
420 Ga0105245_10498554
421 Ga0105245_11062141
422 Ga0105245_11100370
423 Ga0105247_10001833
424 Ga0105247_10153677
425 Ga0114129_10933961
426 Ga0114129_11845043
427 Ga0105241_11061091
428 Ga0105242_10151221
429 Ga0105242_10401756
430 Ga0105249_10015207
431 Ga0099796_10383466
432 Ga0105239_12642764
433 Ga0105246_10134205
434 Ga0157370_10559453
435 Ga0157369_10677396
436 Ga0157369_11309307
437 Ga0157375_10097468
438 Ga0163163_10002132
439 Ga0157379_10006719
440 Ga0163161_10045276
441 Ga0206353_10399142
442 Ga0213871_10246425
443 Ga0207692_10034055
444 Ga0207710_10000032
445 Ga0207710_10071870
446 Ga0207685_10026438
447 Ga0207699_10000094
448 Ga0207699_10065376
449 Ga0207684_10000574
450 Ga0207654_11085882
451 Ga0207707_10407435
452 Ga0207695_10689373
453 Ga0207693_10077406
454 Ga0207663_10273397
455 Ga0207652_10355658
456 Ga0207646_10080065
457 Ga0207687_10019311
458 Ga0207687_10418459
459 Ga0207687_10844196
460 Ga0207700_10001999
461 Ga0207700_10016925
462 Ga0207700_11173602
463 Ga0207664_10003251
464 Ga0207664_10107938
465 Ga0207664_10112720
466 Ga0207664_11666322
467 Ga0207686_10076087
468 Ga0207686_10224792
469 Ga0207665_10001880
470 Ga0207665_10029392
471 Ga0207661_11380341
472 Ga0207712_10015319
473 Ga0207668_11090203
474 Ga0207677_11430062
475 Ga0207703_10000003
476 Ga0207708_11132062
477 Ga0207702_10069284
478 Ga0207641_10009089
479 Ga0207676_10595591
480 Ga0207683_11127316
481 Ga0268266_10676579
482 Ga0268265_10000015
483 Ga0265338_10003034
484 Ga0307509_10503551
485 Ga0316578_10017369
486 Ga0316577_10483267
487 Ga0316580_10036006
488 Ga0373944_0094693
489 Ga0373923_0112786
490 Ga0373936_0361965
491 Ga0373945_0143528
492 Ga0373954_0080052
493 Ga0373946_0163322
494 Ga0373955_0609934
495 Ga0316574_0014516
496 Ga0373935_0369610
497 Ga0373935_0503293
498 Ga0373927_0087993
499 Ga0373947_1125367
500 Ga0373937_0010166
501 Ga0373937_1119316
502 Ga0316584_0173040
503 Ga0373925_0007822
504 Ga0373925_0301706
505 Ga0373925_0517263
506 Ga0395900_0031444
507 Ga0395900_0390356
508 Ga0395898_0263137
509 Ga0395905_0305091
510 Ga0395901_0209435
511 Ga0395901_0723068
512 Ga0436365_0431776
513 Ga0436360_1169676
514 Ga0451807_1313167
515 Ga0451841_1116952
516 Ga0451853_1303083
517 Ga0439443_022868
518 Ga0439448_0001608
519 Ga0439450_000461
520 Ga0439454_030121
521 Ga0439456_058211
522 Ga0439463_005356
523 Ga0439458_0139862
524 Ga0439444_0011123
525 Ga0439464_0001366
526 Ga0439460_0002958
527 Ga0466966_0044996
528 Ga0466963_0561698
529 Ga0466964_0216944
530 Ga0466960_0456760
531 Ga0466959_0111852
532 Ga0466967_0107509
533 Ga0466967_0327030
534 Ga0495592_0209812
535 Ga0495629_0132752
536 Ga0495651_0005471
537 Ga0495653_0350317
538 Ga0495653_0471823
539 Ga0495662_0282357
540 Ga0495664_0130417
541 Ga0495608_0281571
542 Ga0495618_0115471
543 Ga0495628_0649171
544 Ga0495628_1122003
545 Ga0495630_0487085
546 Ga0495652_0442523
547 Ga0495640_0032960
548 Ga0495640_0539811
549 Ga0495586_0016035
550 Ga0495587_0053981
551 Ga0495645_0255001
552 Ga0495645_0515601
553 Ga0495667_0073188
554 Ga0495634_0216007
555 Ga0495634_0663906
556 Ga0495635_0073597
557 Ga0495635_0442234
558 Ga0495635_0633613
559 Ga0495635_0688373
560 Ga0495657_0170005
561 Ga0495599_0295674
562 Ga0495599_0645511
563 Ga0495623_0322468
564 Ga0495646_0119573
565 Ga0495613_0004347
566 Ga0495624_0377926
567 Ga0495600_0373926
568 Ga0495604_0509771
569 Ga0495674_0004251
570 Ga0495674_0431766
571 Ga0495676_0313917
572 Ga0495680_0080105
573 Ga0495675_0476523
574 Ga0495684_0377150
575 Ga0495684_0557315
576 Ga0495602_0765694
577 Ga0496100_0200919
578 Ga0496101_0188687
579 Ga0496101_0511704
580 Ga0496101_0568555
581 Ga0496102_0276456
582 Ga0496102_0695706
583 Ga0496103_0173548
584 Ga0496103_0914159
585 Ga0496104_0009337
586 Ga0496105_0037927
587 Ga0496105_0108713
588 Ga0496105_0172267
589 Ga0496106_0323304
590 Ga0496107_0011219
591 Ga0496108_0211867
592 Ga0496108_0740953
593 Ga0496109_0100973
594 Ga0496109_0210376
595 Ga0496109_0618961
596 Ga0496110_0640546
597 Ga0496110_0860772
598 Ga0496112_0016678
599 Ga0496112_0820008
600 Ga0496113_0123591
601 Ga0496114_0021691
602 Ga0496114_0046085
603 Ga0496114_0287787
604 Ga0496114_0346697
605 Ga0496114_1644977
606 Ga0496115_0361208
607 Ga0496115_0445568
608 Ga0496115_0464032
609 Ga0496116_0000873
610 Ga0496118_0002367
611 Ga0496118_0088423
612 Ga0496119_0005215
613 Ga0496119_0016253
614 Ga0496120_0081993
615 Ga0496120_0132320
616 Ga0496121_0005753
617 Ga0496121_0086164
618 Ga0501033_0086754
619 Ga0501036_0025450
620 Ga0501037_0599751
621 Ga0501038_0015793
622 Ga0501038_0263627
623 Ga0501039_0056851
624 Ga0501040_0010479
625 Ga0501041_0013597
626 Ga0501041_0224694
627 Ga0501042_0060372
628 Ga0501042_0125547
629 Ga0501043_0051967
630 Ga0501046_0047904
631 Ga0501048_0037323
632 Ga0501048_0123929
633 Ga0501067_0069866
634 Ga0501071_0053221
635 Ga0501071_0059679
636 Ga0501071_0691936
637 Ga0501074_0006391
638 Ga0501074_0139663
639 Ga0501075_0025237
640 Ga0501075_0058677
641 Ga0501076_0047891
642 Ga0501076_0078601
643 Ga0501076_0140147
644 Ga0501077_0058055
645 Ga0501079_0019809
646 Ga0501079_0037974
647 Ga0501080_1540262
648 Ga0501081_0018129
649 Ga0501035_0404569
650 Ga0501045_0025575
651 Ga0501045_0373002
652 nmdc:mga00v17_48703_c1
653 nmdc:mga0yw44_488978_c1
654 nmdc:mga0yw44_97764_c1
655 nmdc:mga09592_261641_c1
656 nmdc:mga06r32_210423_c1
657 nmdc:mga06r32_950894_c1
658 Ga0495601_0544124
659 Ga0495612_0460425
660 Ga0495595_0019678
661 Ga0495619_0009071
662 Ga0495619_0205650
663 Ga0495619_0726222
664 Ga0500644_0109730
665 Ga0500646_0197936
666 Ga0500583_0251641
667 Ga0500559_0009964
668 Ga0500568_0000141
669 Ga0500568_0042318
670 Ga0500616_0075419
671 Ga0501084_0005926
672 Ga0501084_0899361
673 Ga0501082_0300605
674 Ga0530510_0132997
675 2508670396
676 2528202443
677 2528212385
678 2546947238
679 2579747262
680 2579857299
681 2619854405
682 2620353018
683 2626639816
684 2671839247
685 2676204756
686 2686535143
687 2686541267
688 2689959937
689 2710604964
690 2774849331
691 2774857403
692 2774868131
693 2895885208
694 637878138
695 8054920817
696 8054927000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

40

160

0.93

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

42

151

0.86

PF18029

Glyoxalase_6

Glyoxalase-like domain

43

161

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zsw-assembly1.cif.gz_A crystal structure of bacillus cereus metallo protein from glyoxalase family 0.8437 7 137
4nb1-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.80 angstrom resolution with l-cysteine-cys9 disulfide 0.8234 1 136
4jd1-assembly1.cif.gz_A crystal structure of metallothiol transferase fosb 2 from bacillus anthracis str. ames 0.8225 2 136
2rk0-assembly1.cif.gz_B crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.813 2 135
2rk0-assembly1.cif.gz_A crystal structure of glyoxylase/bleomycin resistance protein/dioxygenase domain from frankia sp. ean1pec 0.8116 2 138
ID Description Score Start End Superfamily
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8228 4 140 3.10.180.10
af_Q2FVA5_9_134_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8168 4 140 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8138 8 135 3.10.180.10
1xqaB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8122 5 131 3.10.180.10
2rk0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8077 8 135 3.10.180.10
ID Description Score Start End GO Terms
AF-Q2JEV3-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9683 1 156
AF-Q2JEV3-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9623 1 156
AF-A0A2W5ZD16-F1-model_v4 Glyoxalase 0.9574 1 156
AF-A0A2W5ZD16-F1-model_v4 Glyoxalase 0.9512 1 156
AF-A0A7Y3KZ25-F1-model_v4 VOC family protein 0.9345 1 156 GO:0008198
GO:0009056
GO:0051213

Map