F417407

General Info

Members Datasets Scaffolds Average Seq Length
348 205 696 205

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100200819|Ga0068868_1002008192
Length 230
Sequence MGETAEWPSWVSFPSTGCAAGETLLRTGSRIMSNNLPIVYLARHGETAWTLTGQHTGRTDLPLTEAGERNARSLTERLRGVTFARVLTSPLQRAVRTCDLAGFGAAAEIDGDLVEWNYGDYEGRRTAEILRERPGWNLFRDGCPGGESPAQVAARADRVVSRVRGTEGNVLLFSSGHFIRVLAARWIGIEASLHARSFMLSTASLSVLGYENDLSRPVIRLWNDTHHVIP

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
142 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
165 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
174 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
205 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 2.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 98.28
Stem 0
Stem Tuber 0
Unclassified 15.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100200819 3300005338 Unclassified 1662
2 JGI25407J50210_10009024 3300003373 Bacteria 2519
3 JGI25407J50210_10016492 3300003373 Bacteria 1913
4 Ga0058863_11964151 3300004799 Bacteria 1292
5 Ga0058861_12061450 3300004800 Bacteria 1309
6 Ga0058862_12876490 3300004803 Bacteria 2409
7 Ga0065704_10088548 3300005289 Bacteria 2930
8 Ga0070683_100014158 3300005329 Bacteria 6967
9 Ga0070690_100124271 3300005330 Bacteria 1735
10 Ga0070690_100930204 3300005330 Unclassified 681
11 Ga0070670_100040637 3300005331 Bacteria 3998
12 Ga0070666_10001974 3300005335 Bacteria 12499
13 Ga0070682_100093932 3300005337 Bacteria 1967
14 Ga0070682_100105194 3300005337 Bacteria 1871
15 Ga0068868_100235214 3300005338 Bacteria 1538
16 Ga0068868_100458162 3300005338 Bacteria 1110
17 Ga0070660_100313939 3300005339 Bacteria 1286
18 Ga0070687_100179410 3300005343 Unclassified 1267
19 Ga0070661_100101848 3300005344 Bacteria 2137
20 Ga0070675_100004098 3300005354 Bacteria 11066
21 Ga0070675_100069890 3300005354 Bacteria 2909
22 Ga0070671_100212554 3300005355 Bacteria 1640
23 Ga0070673_100032902 3300005364 Bacteria 3909
24 Ga0070673_100519024 3300005364 Bacteria 1079
25 Ga0070688_100144891 3300005365 Bacteria 1617
26 Ga0070659_100171479 3300005366 Bacteria 1777
27 Ga0070667_100128817 3300005367 Bacteria 2207
28 Ga0070667_100593273 3300005367 Unclassified 1020
29 Ga0070714_100010548 3300005435 Bacteria 7309
30 Ga0070701_10094757 3300005438 Bacteria 1643
31 Ga0070711_100037596 3300005439 Bacteria 3249
32 Ga0070711_100116546 3300005439 Bacteria 1968
33 Ga0070711_101231360 3300005439 Bacteria 648
34 Ga0070705_100293532 3300005440 Unclassified 1161
35 Ga0070700_100016767 3300005441 Bacteria 4176
36 Ga0070694_100061702 3300005444 Bacteria 2559
37 Ga0070694_100154239 3300005444 Bacteria 1680
38 Ga0070708_100027017 3300005445 Bacteria 4920
39 Ga0070708_100090354 3300005445 Bacteria 2787
40 Ga0070708_100770186 3300005445 Unclassified 905
41 Ga0070708_100818497 3300005445 Unclassified 875
42 Ga0070663_100249360 3300005455 Bacteria 1405
43 Ga0070663_100429826 3300005455 Bacteria 1085
44 Ga0070662_100012186 3300005457 Bacteria 5696
45 Ga0070681_10080021 3300005458 Bacteria 3224
46 Ga0070685_10167578 3300005466 Bacteria 1405
47 Ga0070706_100004188 3300005467 Bacteria 14006
48 Ga0070706_100005527 3300005467 Bacteria 12031
49 Ga0070706_100475684 3300005467 Unclassified 1162
50 Ga0070706_100755772 3300005467 Bacteria 901
51 Ga0070706_100815056 3300005467 Bacteria 864
52 Ga0070707_100076331 3300005468 Bacteria 3232
53 Ga0070707_100087982 3300005468 Unclassified 3005
54 Ga0070707_100203265 3300005468 Bacteria 1931
55 Ga0070707_100217012 3300005468 Bacteria 1864
56 Ga0070707_100283029 3300005468 Unclassified 1611
57 Ga0070698_100051775 3300005471 Bacteria 4180
58 Ga0070698_100085052 3300005471 Bacteria 3150
59 Ga0070698_100264006 3300005471 Bacteria 1654
60 Ga0070699_100127327 3300005518 Unclassified 2243
61 Ga0070699_100164492 3300005518 Bacteria 1965
62 Ga0070699_100169265 3300005518 Unclassified 1935
63 Ga0070699_100255704 3300005518 Bacteria 1566
64 Ga0070699_100379705 3300005518 Unclassified 1276
65 Ga0070699_100411259 3300005518 Bacteria 1224
66 Ga0070679_100147985 3300005530 Bacteria 2326
67 Ga0070684_100017655 3300005535 Bacteria 5863
68 Ga0070697_100002668 3300005536 Bacteria 13724
69 Ga0070697_100007476 3300005536 Bacteria 8503
70 Ga0070697_100035713 3300005536 Bacteria 4011
71 Ga0070697_100145064 3300005536 Unclassified 1998
72 Ga0070697_100296052 3300005536 Bacteria 1391
73 Ga0070697_100312426 3300005536 Unclassified 1352
74 Ga0068853_100058313 3300005539 Bacteria 3333
75 Ga0068853_100568677 3300005539 Unclassified 1075
76 Ga0070672_100316433 3300005543 Bacteria 1326
77 Ga0070665_100032577 3300005548 Bacteria 5245
78 Ga0070704_100218375 3300005549 Bacteria 1548
79 Ga0068855_100019670 3300005563 Bacteria 8109
80 Ga0070664_100072376 3300005564 Bacteria 2956
81 Ga0070664_100197398 3300005564 Unclassified 1794
82 Ga0068857_100003716 3300005577 Bacteria 12806
83 Ga0068856_100173034 3300005614 Bacteria 2171
84 Ga0068859_100058997 3300005617 Bacteria 3866
85 Ga0068859_100059198 3300005617 Bacteria 3859
86 Ga0068859_100070377 3300005617 Bacteria 3534
87 Ga0068859_100294757 3300005617 Bacteria 1715
88 Ga0068859_100340809 3300005617 Bacteria 1593
89 Ga0068864_100105713 3300005618 Bacteria 2502
90 Ga0068861_101118494 3300005719 Bacteria 758
91 Ga0068851_10315289 3300005834 Bacteria 902
92 Ga0068863_100027148 3300005841 Bacteria 5461
93 Ga0068863_100156478 3300005841 Bacteria 2182
94 Ga0068858_100001663 3300005842 Bacteria 22717
95 Ga0068858_100006514 3300005842 Bacteria 11366
96 Ga0068858_100375861 3300005842 Bacteria 1363
97 Ga0068860_100003250 3300005843 Bacteria 16747
98 Ga0068860_100044885 3300005843 Bacteria 4212
99 Ga0081455_10004880 3300005937 Bacteria 14877
100 Ga0081538_10002251 3300005981 Bacteria 19106
101 Ga0081538_10013304 3300005981 Bacteria 6524
102 Ga0081538_10027771 3300005981 Bacteria 3912
103 Ga0081540_1002653 3300005983 Bacteria 14547
104 Ga0081539_10020661 3300005985 Bacteria 4436
105 Ga0070717_10007592 3300006028 Bacteria 8058
106 Ga0070717_10111838 3300006028 Bacteria 2331
107 Ga0070716_100008386 3300006173 Bacteria 5128
108 Ga0070712_100089650 3300006175 Unclassified 2250
109 Ga0075427_10002439 3300006194 Bacteria 2493
110 Ga0097621_100001454 3300006237 Bacteria 16207
111 Ga0097621_100002392 3300006237 Bacteria 12858
112 Ga0097621_100024124 3300006237 Bacteria 4746
113 Ga0097621_100517076 3300006237 Unclassified 1083
114 Ga0097621_100745898 3300006237 Bacteria 904
115 Ga0068871_100001801 3300006358 Bacteria 14449
116 Ga0068871_100001805 3300006358 Bacteria 14441
117 Ga0068871_100011750 3300006358 Bacteria 6432
118 Ga0075430_100076077 3300006846 Bacteria 2813
119 Ga0075431_100127889 3300006847 Bacteria 2622
120 Ga0075431_100237028 3300006847 Bacteria 1857
121 Ga0075433_10306278 3300006852 Bacteria 1406
122 Ga0075434_100020032 3300006871 Bacteria 6479
123 Ga0075434_100024204 3300006871 Bacteria 5934
124 Ga0075434_100071848 3300006871 Bacteria 3452
125 Ga0075434_100109095 3300006871 Unclassified 2778
126 Ga0075434_100111432 3300006871 Bacteria 2747
127 Ga0075434_100271062 3300006871 Bacteria 1717
128 Ga0068865_100019034 3300006881 Bacteria 4440
129 Ga0075436_100029053 3300006914 Bacteria 3803
130 Ga0075436_100503709 3300006914 Bacteria 886
131 Ga0097620_100058999 3300006931 Bacteria 3866
132 Ga0097620_100059198 3300006931 Bacteria 3859
133 Ga0097620_100070373 3300006931 Bacteria 3534
134 Ga0097620_100294757 3300006931 Bacteria 1715
135 Ga0097620_100340794 3300006931 Bacteria 1593
136 Ga0075435_100143073 3300007076 Bacteria 2007
137 Ga0075435_101181770 3300007076 Unclassified 669
138 Ga0105240_10049182 3300009093 Bacteria 5323
139 Ga0111539_10023376 3300009094 Bacteria 7593
140 Ga0111539_10536550 3300009094 Bacteria 1363
141 Ga0105245_10001615 3300009098 Bacteria 20511
142 Ga0105245_10026230 3300009098 Bacteria 5129
143 Ga0105245_10030350 3300009098 Bacteria 4779
144 Ga0105245_10661992 3300009098 Unclassified 1075
145 Ga0114129_10103763 3300009147 Bacteria 3930
146 Ga0114129_10489142 3300009147 Bacteria 1609
147 Ga0114129_10495940 3300009147 Bacteria 1596
148 Ga0114129_10821105 3300009147 Bacteria 1184
149 Ga0105241_10011185 3300009174 Bacteria 6582
150 Ga0105242_10000467 3300009176 Bacteria 32182
151 Ga0105242_10003027 3300009176 Bacteria 13134
152 Ga0105242_10015792 3300009176 Bacteria 5866
153 Ga0105242_10047901 3300009176 Bacteria 3472
154 Ga0105242_10062048 3300009176 Bacteria 3075
155 Ga0105242_10063312 3300009176 Bacteria 3046
156 Ga0105242_10074573 3300009176 Bacteria 2823
157 Ga0105242_10246962 3300009176 Unclassified 1607
158 Ga0105248_10041514 3300009177 Bacteria 5157
159 Ga0105248_12010793 3300009177 Bacteria 657
160 Ga0105237_10019304 3300009545 Bacteria 7041
161 Ga0105237_10300851 3300009545 Bacteria 1607
162 Ga0105238_10000263 3300009551 Bacteria 58779
163 Ga0105238_10003603 3300009551 Bacteria 15436
164 Ga0105249_10036143 3300009553 Bacteria 4481
165 Ga0105249_10642855 3300009553 Bacteria 1118
166 Ga0157370_10043102 3300013104 Bacteria 4344
167 Ga0157370_10046454 3300013104 Bacteria 4163
168 Ga0157369_10106390 3300013105 Bacteria 2986
169 Ga0157369_10466757 3300013105 Bacteria 1307
170 Ga0157374_10006539 3300013296 Bacteria 9898
171 Ga0157374_10017800 3300013296 Bacteria 6260
172 Ga0157378_10002742 3300013297 Bacteria 15689
173 Ga0157378_10016093 3300013297 Bacteria 6548
174 Ga0163162_10001382 3300013306 Bacteria 22587
175 Ga0163162_10003323 3300013306 Bacteria 15392
176 Ga0163162_10374279 3300013306 Bacteria 1557
177 Ga0157372_10133852 3300013307 Bacteria 2854
178 Ga0157372_10658065 3300013307 Unclassified 1220
179 Ga0157375_10003504 3300013308 Bacteria 13608
180 Ga0157375_10029430 3300013308 Bacteria 5165
181 Ga0157375_10253944 3300013308 Unclassified 1919
182 Ga0163163_10004544 3300014325 Bacteria 11850
183 Ga0157380_10025062 3300014326 Bacteria 4521
184 Ga0157377_10061777 3300014745 Bacteria 2142
185 Ga0157379_10108723 3300014968 Bacteria 2490
186 Ga0157379_10124861 3300014968 Unclassified 2316
187 Ga0157379_10612812 3300014968 Bacteria 1017
188 Ga0157376_10162024 3300014969 Bacteria 2029
189 Ga0157376_10716227 3300014969 Unclassified 1007
190 Ga0206354_10688331 3300020081 Bacteria 9634
191 Ga0206353_10163139 3300020082 Bacteria 1649
192 Ga0213872_10000334 3300021361 Bacteria 39952
193 Ga0213875_10003256 3300021388 Bacteria 9304
194 Ga0207666_1004155 3300025271 Bacteria 1806
195 Ga0207697_10000197 3300025315 Bacteria 32111
196 Ga0207697_10051826 3300025315 Bacteria 1696
197 Ga0207710_10110244 3300025900 Bacteria 1306
198 Ga0207688_10329097 3300025901 Unclassified 938
199 Ga0207680_10004772 3300025903 Bacteria 6454
200 Ga0207699_10518953 3300025906 Unclassified 861
201 Ga0207699_10538954 3300025906 Bacteria 845
202 Ga0207699_10801513 3300025906 Unclassified 692
203 Ga0207684_10000713 3300025910 Bacteria 39081
204 Ga0207684_10000956 3300025910 Bacteria 32546
205 Ga0207684_10654424 3300025910 Bacteria 895
206 Ga0207654_10011701 3300025911 Bacteria 4478
207 Ga0207693_10158882 3300025915 Unclassified 1778
208 Ga0207663_10370283 3300025916 Unclassified 1089
209 Ga0207657_10031746 3300025919 Bacteria 4779
210 Ga0207646_10010390 3300025922 Bacteria 9104
211 Ga0207646_10124680 3300025922 Unclassified 2315
212 Ga0207646_10201455 3300025922 Bacteria 1798
213 Ga0207646_10401149 3300025922 Bacteria 1238
214 Ga0207694_10007268 3300025924 Bacteria 8405
215 Ga0207694_10009442 3300025924 Bacteria 7354
216 Ga0207650_10448052 3300025925 Bacteria 1074
217 Ga0207659_10417428 3300025926 Bacteria 1125
218 Ga0207687_10008062 3300025927 Bacteria 6892
219 Ga0207687_10034490 3300025927 Bacteria 3436
220 Ga0207687_10037979 3300025927 Bacteria 3289
221 Ga0207687_10431487 3300025927 Unclassified 1089
222 Ga0207700_10571811 3300025928 Unclassified 1004
223 Ga0207664_10057870 3300025929 Bacteria 3083
224 Ga0207664_10095510 3300025929 Bacteria 2445
225 Ga0207690_10145662 3300025932 Unclassified 1751
226 Ga0207706_10068734 3300025933 Bacteria 3116
227 Ga0207686_10004372 3300025934 Bacteria 7575
228 Ga0207686_10011544 3300025934 Bacteria 4840
229 Ga0207686_10064929 3300025934 Bacteria 2325
230 Ga0207686_10108571 3300025934 Bacteria 1867
231 Ga0207686_10221609 3300025934 Unclassified 1366
232 Ga0207670_10053629 3300025936 Bacteria 2717
233 Ga0207704_10010533 3300025938 Bacteria 4516
234 Ga0207665_10139960 3300025939 Bacteria 1725
235 Ga0207691_10013647 3300025940 Bacteria 7765
236 Ga0207711_10004827 3300025941 Bacteria 11456
237 Ga0207711_10023841 3300025941 Bacteria 5123
238 Ga0207711_10045413 3300025941 Bacteria 3755
239 Ga0207661_10140481 3300025944 Bacteria 2078
240 Ga0207661_10273171 3300025944 Unclassified 1509
241 Ga0207679_10118371 3300025945 Bacteria 2104
242 Ga0207667_10098513 3300025949 Bacteria 3017
243 Ga0207651_10127958 3300025960 Bacteria 1939
244 Ga0207651_10416683 3300025960 Bacteria 1146
245 Ga0207658_10024799 3300025986 Bacteria 4197
246 Ga0207658_10255761 3300025986 Unclassified 1490
247 Ga0207677_10174910 3300026023 Bacteria 1683
248 Ga0207677_10189755 3300026023 Unclassified 1624
249 Ga0207703_10002488 3300026035 Bacteria 15978
250 Ga0207703_10201414 3300026035 Bacteria 1769
251 Ga0207703_10374953 3300026035 Bacteria 1315
252 Ga0207639_10044127 3300026041 Bacteria 3352
253 Ga0207678_10266118 3300026067 Bacteria 1470
254 Ga0207708_10039676 3300026075 Bacteria 3588
255 Ga0207702_10207057 3300026078 Bacteria 1822
256 Ga0207702_10849797 3300026078 Bacteria 903
257 Ga0207641_10059755 3300026088 Bacteria 3247
258 Ga0207641_10261826 3300026088 Bacteria 1620
259 Ga0207641_10482885 3300026088 Bacteria 1201
260 Ga0207674_10007365 3300026116 Bacteria 12817
261 Ga0207674_10495324 3300026116 Bacteria 1181
262 Ga0207674_10593840 3300026116 Bacteria 1070
263 Ga0265354_1002921 3300028016 Bacteria 2005
264 Ga0268266_10047017 3300028379 Bacteria 3695
265 Ga0268265_10454810 3300028380 Bacteria 1197
266 Ga0268264_10001309 3300028381 Bacteria 23465
267 Ga0265319_1003790 3300028563 Bacteria 7755
268 Ga0265765_1013831 3300030879 Unclassified 926
269 Ga0265760_10000757 3300031090 Bacteria 9276
270 Ga0265320_10013274 3300031240 Bacteria 4744
271 Ga0265316_10612832 3300031344 Bacteria 771
272 Ga0373936_0341639 3300035113 Bacteria 681
273 Ga0373945_0033246 3300035116 Bacteria 1832
274 Ga0373954_0053678 3300035118 Unclassified 1895
275 Ga0373954_0118921 3300035118 Bacteria 1282
276 Ga0373955_0013599 3300035172 Bacteria 3940
277 Ga0373927_0095383 3300035695 Bacteria 1933
278 Ga0373947_0032059 3300035725 Bacteria 3096
279 Ga0373937_0072908 3300036401 Bacteria 3167
280 Ga0373937_0578880 3300036401 Bacteria 1066
281 Ga0373937_0688893 3300036401 Bacteria 968
282 Ga0373925_0019947 3300037068 Bacteria 4877
283 Ga0395898_0376109 3300037466 Bacteria 1355
284 Ga0395905_0084411 3300037471 Bacteria 2975
285 Ga0436364_0411125 3300037853 Unclassified 1255
286 Ga0395901_0103333 3300038443 Bacteria 2990
287 Ga0395901_0511292 3300038443 Bacteria 1222
288 Ga0436365_0225421 3300039437 Bacteria 1318
289 Ga0436360_0214160 3300039438 Bacteria 885
290 Ga0436361_0749892 3300039447 Bacteria 56432
291 Ga0436363_0922548 3300039450 Bacteria 2605
292 Ga0439454_021961 3300042011 Bacteria 947
293 Ga0439458_0040462 3300042157 Bacteria 1130
294 Ga0439460_0014537 3300042461 Bacteria 2070
295 Ga0439440_0009993 3300042993 Unclassified 1974
296 Ga0495629_0551236 3300046459 Bacteria 774
297 Ga0495651_0051132 3300046462 Bacteria 3187
298 Ga0495582_0460982 3300046473 Unclassified 734
299 Ga0495639_0311119 3300046475 Bacteria 787
300 Ga0495594_0027922 3300046499 Bacteria 3043
301 Ga0495608_0006124 3300046511 Bacteria 8534
302 Ga0495618_0062499 3300046514 Bacteria 2363
303 Ga0495628_0043273 3300046516 Bacteria 3588
304 Ga0495630_0048170 3300046517 Bacteria 3189
305 Ga0495665_0112428 3300046531 Bacteria 1428
306 Ga0495640_0060204 3300046533 Bacteria 2583
307 Ga0495586_0026738 3300046535 Bacteria 3088
308 Ga0495587_0160052 3300046536 Bacteria 1281
309 Ga0495587_0477529 3300046536 Bacteria 690
310 Ga0495645_0029577 3300046543 Bacteria 3984
311 Ga0495645_0394966 3300046543 Bacteria 882
312 Ga0495667_0502800 3300046559 Bacteria 759
313 Ga0495635_0117907 3300046663 Bacteria 1811
314 Ga0495599_0101818 3300046678 Bacteria 1790
315 Ga0495623_0033631 3300046679 Bacteria 3290
316 Ga0495613_0091479 3300046689 Bacteria 2203
317 Ga0495649_0071685 3300046694 Bacteria 1857
318 Ga0495581_0020538 3300047315 Bacteria 3833
319 Ga0495674_0047878 3300047319 Bacteria 3787
320 Ga0495676_0172014 3300047321 Bacteria 1524
321 Ga0495680_0006722 3300047322 Bacteria 10635
322 Ga0495675_0024347 3300047444 Bacteria 3859
323 Ga0495684_0041201 3300047471 Bacteria 3539
324 Ga0496107_0448366 3300048910 Unclassified 959
325 Ga0496110_0804548 3300048913 Unclassified 844
326 Ga0501071_0818260 3300049587 Bacteria 718
327 nmdc:mga05p37_244036_c1 3300050507 Bacteria 2158
328 nmdc:mga05p37_725143_c1 3300050507 Unclassified 1100
329 nmdc:mga09592_28737_c1 3300050508 Bacteria 4622
330 nmdc:mga0qj67_215890_c1 3300050509 Bacteria 1557
331 nmdc:mga0qj67_68225_c1 3300050509 Bacteria 2128
332 nmdc:mga06r32_117409_c1 3300050510 Bacteria 2622
333 nmdc:mga06r32_575549_c1 3300050510 Bacteria 1099
334 nmdc:mga08y16_111286_c1 3300050511 Unclassified 2851
335 nmdc:mga08y16_974039_c1 3300050511 Bacteria 830
336 nmdc:mga0n895_224258_c1 3300050512 Bacteria 1908
337 nmdc:mga0n895_30492_c1 3300050512 Bacteria 5155
338 nmdc:mga0n895_617005_c1 3300050512 Unclassified 1086
339 nmdc:mga0n895_67680_c1 3300050512 Bacteria 3537
340 nmdc:mga0rr50_420586_c1 3300050513 Unclassified 1130
341 nmdc:mga0rr50_70219_c1 3300050513 Bacteria 2669
342 nmdc:mga0rr50_897365_c1 3300050513 Unclassified 756
343 nmdc:mga08x19_119047_c1 3300050514 Bacteria 1769
344 nmdc:mga08x19_777358_c1 3300050514 Unclassified 680
345 nmdc:mga0a205_234403_c1 3300050515 Bacteria 1718
346 nmdc:mga0a205_5644_c1 3300050515 Bacteria 11272
347 Ga0495612_0100299 3300053078 Bacteria 1232
348 Ga0587079_008461 3300059647 Bacteria 1575
349 Ga0068868_100200819
350 JGI25407J50210_10009024
351 JGI25407J50210_10016492
352 Ga0058863_11964151
353 Ga0058861_12061450
354 Ga0058862_12876490
355 Ga0065704_10088548
356 Ga0070683_100014158
357 Ga0070690_100124271
358 Ga0070690_100930204
359 Ga0070670_100040637
360 Ga0070666_10001974
361 Ga0070682_100093932
362 Ga0070682_100105194
363 Ga0068868_100235214
364 Ga0068868_100458162
365 Ga0070660_100313939
366 Ga0070687_100179410
367 Ga0070661_100101848
368 Ga0070675_100004098
369 Ga0070675_100069890
370 Ga0070671_100212554
371 Ga0070673_100032902
372 Ga0070673_100519024
373 Ga0070688_100144891
374 Ga0070659_100171479
375 Ga0070667_100128817
376 Ga0070667_100593273
377 Ga0070714_100010548
378 Ga0070701_10094757
379 Ga0070711_100037596
380 Ga0070711_100116546
381 Ga0070711_101231360
382 Ga0070705_100293532
383 Ga0070700_100016767
384 Ga0070694_100061702
385 Ga0070694_100154239
386 Ga0070708_100027017
387 Ga0070708_100090354
388 Ga0070708_100770186
389 Ga0070708_100818497
390 Ga0070663_100249360
391 Ga0070663_100429826
392 Ga0070662_100012186
393 Ga0070681_10080021
394 Ga0070685_10167578
395 Ga0070706_100004188
396 Ga0070706_100005527
397 Ga0070706_100475684
398 Ga0070706_100755772
399 Ga0070706_100815056
400 Ga0070707_100076331
401 Ga0070707_100087982
402 Ga0070707_100203265
403 Ga0070707_100217012
404 Ga0070707_100283029
405 Ga0070698_100051775
406 Ga0070698_100085052
407 Ga0070698_100264006
408 Ga0070699_100127327
409 Ga0070699_100164492
410 Ga0070699_100169265
411 Ga0070699_100255704
412 Ga0070699_100379705
413 Ga0070699_100411259
414 Ga0070679_100147985
415 Ga0070684_100017655
416 Ga0070697_100002668
417 Ga0070697_100007476
418 Ga0070697_100035713
419 Ga0070697_100145064
420 Ga0070697_100296052
421 Ga0070697_100312426
422 Ga0068853_100058313
423 Ga0068853_100568677
424 Ga0070672_100316433
425 Ga0070665_100032577
426 Ga0070704_100218375
427 Ga0068855_100019670
428 Ga0070664_100072376
429 Ga0070664_100197398
430 Ga0068857_100003716
431 Ga0068856_100173034
432 Ga0068859_100058997
433 Ga0068859_100059198
434 Ga0068859_100070377
435 Ga0068859_100294757
436 Ga0068859_100340809
437 Ga0068864_100105713
438 Ga0068861_101118494
439 Ga0068851_10315289
440 Ga0068863_100027148
441 Ga0068863_100156478
442 Ga0068858_100001663
443 Ga0068858_100006514
444 Ga0068858_100375861
445 Ga0068860_100003250
446 Ga0068860_100044885
447 Ga0081455_10004880
448 Ga0081538_10002251
449 Ga0081538_10013304
450 Ga0081538_10027771
451 Ga0081540_1002653
452 Ga0081539_10020661
453 Ga0070717_10007592
454 Ga0070717_10111838
455 Ga0070716_100008386
456 Ga0070712_100089650
457 Ga0075427_10002439
458 Ga0097621_100001454
459 Ga0097621_100002392
460 Ga0097621_100024124
461 Ga0097621_100517076
462 Ga0097621_100745898
463 Ga0068871_100001801
464 Ga0068871_100001805
465 Ga0068871_100011750
466 Ga0075430_100076077
467 Ga0075431_100127889
468 Ga0075431_100237028
469 Ga0075433_10306278
470 Ga0075434_100020032
471 Ga0075434_100024204
472 Ga0075434_100071848
473 Ga0075434_100109095
474 Ga0075434_100111432
475 Ga0075434_100271062
476 Ga0068865_100019034
477 Ga0075436_100029053
478 Ga0075436_100503709
479 Ga0097620_100058999
480 Ga0097620_100059198
481 Ga0097620_100070373
482 Ga0097620_100294757
483 Ga0097620_100340794
484 Ga0075435_100143073
485 Ga0075435_101181770
486 Ga0105240_10049182
487 Ga0111539_10023376
488 Ga0111539_10536550
489 Ga0105245_10001615
490 Ga0105245_10026230
491 Ga0105245_10030350
492 Ga0105245_10661992
493 Ga0114129_10103763
494 Ga0114129_10489142
495 Ga0114129_10495940
496 Ga0114129_10821105
497 Ga0105241_10011185
498 Ga0105242_10000467
499 Ga0105242_10003027
500 Ga0105242_10015792
501 Ga0105242_10047901
502 Ga0105242_10062048
503 Ga0105242_10063312
504 Ga0105242_10074573
505 Ga0105242_10246962
506 Ga0105248_10041514
507 Ga0105248_12010793
508 Ga0105237_10019304
509 Ga0105237_10300851
510 Ga0105238_10000263
511 Ga0105238_10003603
512 Ga0105249_10036143
513 Ga0105249_10642855
514 Ga0157370_10043102
515 Ga0157370_10046454
516 Ga0157369_10106390
517 Ga0157369_10466757
518 Ga0157374_10006539
519 Ga0157374_10017800
520 Ga0157378_10002742
521 Ga0157378_10016093
522 Ga0163162_10001382
523 Ga0163162_10003323
524 Ga0163162_10374279
525 Ga0157372_10133852
526 Ga0157372_10658065
527 Ga0157375_10003504
528 Ga0157375_10029430
529 Ga0157375_10253944
530 Ga0163163_10004544
531 Ga0157380_10025062
532 Ga0157377_10061777
533 Ga0157379_10108723
534 Ga0157379_10124861
535 Ga0157379_10612812
536 Ga0157376_10162024
537 Ga0157376_10716227
538 Ga0206354_10688331
539 Ga0206353_10163139
540 Ga0213872_10000334
541 Ga0213875_10003256
542 Ga0207666_1004155
543 Ga0207697_10000197
544 Ga0207697_10051826
545 Ga0207710_10110244
546 Ga0207688_10329097
547 Ga0207680_10004772
548 Ga0207699_10518953
549 Ga0207699_10538954
550 Ga0207699_10801513
551 Ga0207684_10000713
552 Ga0207684_10000956
553 Ga0207684_10654424
554 Ga0207654_10011701
555 Ga0207693_10158882
556 Ga0207663_10370283
557 Ga0207657_10031746
558 Ga0207646_10010390
559 Ga0207646_10124680
560 Ga0207646_10201455
561 Ga0207646_10401149
562 Ga0207694_10007268
563 Ga0207694_10009442
564 Ga0207650_10448052
565 Ga0207659_10417428
566 Ga0207687_10008062
567 Ga0207687_10034490
568 Ga0207687_10037979
569 Ga0207687_10431487
570 Ga0207700_10571811
571 Ga0207664_10057870
572 Ga0207664_10095510
573 Ga0207690_10145662
574 Ga0207706_10068734
575 Ga0207686_10004372
576 Ga0207686_10011544
577 Ga0207686_10064929
578 Ga0207686_10108571
579 Ga0207686_10221609
580 Ga0207670_10053629
581 Ga0207704_10010533
582 Ga0207665_10139960
583 Ga0207691_10013647
584 Ga0207711_10004827
585 Ga0207711_10023841
586 Ga0207711_10045413
587 Ga0207661_10140481
588 Ga0207661_10273171
589 Ga0207679_10118371
590 Ga0207667_10098513
591 Ga0207651_10127958
592 Ga0207651_10416683
593 Ga0207658_10024799
594 Ga0207658_10255761
595 Ga0207677_10174910
596 Ga0207677_10189755
597 Ga0207703_10002488
598 Ga0207703_10201414
599 Ga0207703_10374953
600 Ga0207639_10044127
601 Ga0207678_10266118
602 Ga0207708_10039676
603 Ga0207702_10207057
604 Ga0207702_10849797
605 Ga0207641_10059755
606 Ga0207641_10261826
607 Ga0207641_10482885
608 Ga0207674_10007365
609 Ga0207674_10495324
610 Ga0207674_10593840
611 Ga0265354_1002921
612 Ga0268266_10047017
613 Ga0268265_10454810
614 Ga0268264_10001309
615 Ga0265319_1003790
616 Ga0265765_1013831
617 Ga0265760_10000757
618 Ga0265320_10013274
619 Ga0265316_10612832
620 Ga0373936_0341639
621 Ga0373945_0033246
622 Ga0373954_0053678
623 Ga0373954_0118921
624 Ga0373955_0013599
625 Ga0373927_0095383
626 Ga0373947_0032059
627 Ga0373937_0072908
628 Ga0373937_0578880
629 Ga0373937_0688893
630 Ga0373925_0019947
631 Ga0395898_0376109
632 Ga0395905_0084411
633 Ga0436364_0411125
634 Ga0395901_0103333
635 Ga0395901_0511292
636 Ga0436365_0225421
637 Ga0436360_0214160
638 Ga0436361_0749892
639 Ga0436363_0922548
640 Ga0439454_021961
641 Ga0439458_0040462
642 Ga0439460_0014537
643 Ga0439440_0009993
644 Ga0495629_0551236
645 Ga0495651_0051132
646 Ga0495582_0460982
647 Ga0495639_0311119
648 Ga0495594_0027922
649 Ga0495608_0006124
650 Ga0495618_0062499
651 Ga0495628_0043273
652 Ga0495630_0048170
653 Ga0495665_0112428
654 Ga0495640_0060204
655 Ga0495586_0026738
656 Ga0495587_0160052
657 Ga0495587_0477529
658 Ga0495645_0029577
659 Ga0495645_0394966
660 Ga0495667_0502800
661 Ga0495635_0117907
662 Ga0495599_0101818
663 Ga0495623_0033631
664 Ga0495613_0091479
665 Ga0495649_0071685
666 Ga0495581_0020538
667 Ga0495674_0047878
668 Ga0495676_0172014
669 Ga0495680_0006722
670 Ga0495675_0024347
671 Ga0495684_0041201
672 Ga0496107_0448366
673 Ga0496110_0804548
674 Ga0501071_0818260
675 nmdc:mga05p37_244036_c1
676 nmdc:mga05p37_725143_c1
677 nmdc:mga09592_28737_c1
678 nmdc:mga0qj67_215890_c1
679 nmdc:mga0qj67_68225_c1
680 nmdc:mga06r32_117409_c1
681 nmdc:mga06r32_575549_c1
682 nmdc:mga08y16_111286_c1
683 nmdc:mga08y16_974039_c1
684 nmdc:mga0n895_224258_c1
685 nmdc:mga0n895_30492_c1
686 nmdc:mga0n895_617005_c1
687 nmdc:mga0n895_67680_c1
688 nmdc:mga0rr50_420586_c1
689 nmdc:mga0rr50_70219_c1
690 nmdc:mga0rr50_897365_c1
691 nmdc:mga08x19_119047_c1
692 nmdc:mga08x19_777358_c1
693 nmdc:mga0a205_234403_c1
694 nmdc:mga0a205_5644_c1
695 Ga0495612_0100299
696 Ga0587079_008461

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

39

225

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a6p-assembly1.cif.gz_B structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis 0.946 6 193
2a6p-assembly1.cif.gz_B structure solution to 2.2 angstrom and functional characterisation of the open reading frame rv3214 from mycobacterium tuberculosis 0.9175 6 193
3f3k-assembly1.cif.gz_A the structure of uncharacterized protein ykr043c from saccharomyces cerevisiae. 0.9157 5 189
3oi7-assembly1.cif.gz_A structure of the structure of the h13a mutant of ykr043c in complex with sedoheptulose-1,7-bisphosphate 0.9155 5 189
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.9146 7 196
ID Description Score Start End Superfamily
af_Q6MWZ7_1_203_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9429 6 193 3.40.50.1240
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9107 7 196 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8969 6 195 3.40.50.1240
3f3kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8963 5 189 3.40.50.1240
af_Q6MWZ7_1_203_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.892 6 193 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A532E9H6-F1-model_v4 Histidine phosphatase family protein 1.002 12 98 GO:0070297
GO:0101006
AF-A0A528D3T2-F1-model_v4 Histidine phosphatase family protein 0.9999 12 113 GO:0070297
GO:0101006
AF-A0A7K1D2H1-F1-model_v4 Histidine phosphatase family protein 0.9973 12 95 GO:0070297
GO:0101006
AF-A0A2V7SD98-F1-model_v4 Histidine phosphatase family protein 0.9945 1 155 GO:0070297
GO:0101006
AF-A0A6G4ZTZ6-F1-model_v4 Adenosylcobalamin/alpha-ribazole phosphatase (EC 3.1.3.73) 0.9924 6 168 GO:0043755
GO:0070297
GO:0101006

Map