F417316

General Info

Members Datasets Scaffolds Average Seq Length
347 219 340 245

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_148588_c1|nmdc:mga0k408_148588_c1_22_822
Length 266
Sequence MNEFFICVYLRQKFNTSMEISALTRSVVKSNHAIIAPDGYINSNVPGWTNCVTNVIINEAMGAKFSQILTTMNSKGEIKGETNISEIFFYVVKGKCHANTGGGEKSFTKGHYVYVPVGTPYQFNSEEEGTQILSFHKVYEPLPGDYASHPPVIFDKSAGDGETYLGDPALRLQVLLPDKSNFDMAVNIFTYDPGGHLPFVETHVMEHGLLFLQGQGIYMLGDKWYPVKKGDSIWMAPYCQQWFTAMGKEPAVYIYYKNVNRFPTIQ

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
5 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
6 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
147 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
152 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
191 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
192 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
202 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
203 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
210 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
211 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
212 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
216 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
217 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.98
Metatranscriptomes 0
Isolates 2.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.44
Nodule 0
Rhizoplane 1.15
Rhizosphere 69.45
Stem 0
Stem Tuber 0
Unclassified 10.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003972 3300001979 Bacteria 6420
2 JGI24739J22299_10001551 3300001989 Bacteria 8698
3 JGI24033J26618_1009060 3300002155 Bacteria 1154
4 JGI25154J39366_1000001 3300002738 Bacteria 483450
5 JGI25157J39369_1009320 3300002741 Bacteria 1326
6 JGI25153J46596_10000204 3300003215 Bacteria 54445
7 JGI25153J46596_10015373 3300003215 Bacteria 3121
8 JGI25153J46596_10035439 3300003215 Unclassified 1616
9 rootH1_10075172 3300003316 Bacteria 2091
10 rootH2_10135351 3300003320 Bacteria 14175
11 rootH2_10281983 3300003320 Bacteria 1691
12 rootL2_10003015 3300003322 Bacteria 6575
13 rootL2_10003898 3300003322 Bacteria 11762
14 rootL2_10020271 3300003322 Bacteria 29229
15 rootL2_10120688 3300003322 Bacteria 1595
16 rootL2_10120690 3300003322 Bacteria 1534
17 rootH1_10052358 3300003323 Bacteria 5695
18 rootH1_10055289 3300003323 Bacteria 2692
19 rootH1_10228023 3300003323 Bacteria 1078
20 JGI25160J50197_1003439 3300003354 Bacteria 7083
21 JGI25160J50197_1004298 3300003354 Bacteria 6176
22 Ga0055535_1001768 3300003761 Bacteria 9579
23 Ga0055526_1054730 3300003771 Bacteria 884
24 Ga0055528_1000995 3300003790 Bacteria 18812
25 Ga0055530_10004890 3300003791 Bacteria 6662
26 Ga0055531_10000102 3300003794 Bacteria 92703
27 Ga0065165_1000053 3300005262 Bacteria 189081
28 Ga0065165_1008771 3300005262 Unclassified 4660
29 Ga0065165_1010948 3300005262 Bacteria 3851
30 Ga0065715_10006205 3300005293 Bacteria 2932
31 Ga0065707_10203422 3300005295 Bacteria 1292
32 Ga0070658_10004413 3300005327 Bacteria 11463
33 Ga0070658_10311614 3300005327 Unclassified 1343
34 Ga0070676_10096446 3300005328 Bacteria 1820
35 Ga0070670_100237583 3300005331 Bacteria 1586
36 Ga0068869_100011818 3300005334 Bacteria 5742
37 Ga0068869_100268936 3300005334 Unclassified 1367
38 Ga0070666_10000143 3300005335 Bacteria 48999
39 Ga0070666_10171751 3300005335 Unclassified 1518
40 Ga0070682_100070172 3300005337 Unclassified 2239
41 Ga0068868_100046799 3300005338 Unclassified 3386
42 Ga0070660_100066448 3300005339 Bacteria 2807
43 Ga0070668_100040159 3300005347 Bacteria 3580
44 Ga0070668_100071062 3300005347 Bacteria 2711
45 Ga0070675_100034017 3300005354 Bacteria 4134
46 Ga0070673_100021225 3300005364 Bacteria 4702
47 Ga0070673_100214582 3300005364 Bacteria 1663
48 Ga0070688_100011851 3300005365 Bacteria 4863
49 Ga0070659_100000092 3300005366 Bacteria 67270
50 Ga0070667_100053319 3300005367 Bacteria 3413
51 Ga0070701_10280077 3300005438 Bacteria 1018
52 Ga0070700_100280785 3300005441 Bacteria 1207
53 Ga0070681_10041336 3300005458 Unclassified 4621
54 Ga0068867_100077746 3300005459 Bacteria 2494
55 Ga0070698_100599706 3300005471 Bacteria 1042
56 Ga0070699_100506068 3300005518 Unclassified 1097
57 Ga0070679_100384214 3300005530 Bacteria 1351
58 Ga0068853_100157336 3300005539 Bacteria 2048
59 Ga0068853_100298220 3300005539 Unclassified 1489
60 Ga0068853_100354586 3300005539 Bacteria 1365
61 Ga0070665_100248583 3300005548 Bacteria 1779
62 Ga0068855_100012782 3300005563 Bacteria 10127
63 Ga0068855_100216439 3300005563 Bacteria 2150
64 Ga0068852_100004042 3300005616 Bacteria 10314
65 Ga0068852_100356219 3300005616 Unclassified 1430
66 Ga0068859_100000099 3300005617 Bacteria 80240
67 Ga0068859_100006324 3300005617 Bacteria 12012
68 Ga0068864_100007566 3300005618 Bacteria 8950
69 Ga0068861_100124050 3300005719 Bacteria 2087
70 Ga0068861_100463196 3300005719 Bacteria 1138
71 Ga0068870_10044285 3300005840 Bacteria 2324
72 Ga0068870_10224661 3300005840 Bacteria 1151
73 Ga0068863_100001311 3300005841 Bacteria 24817
74 Ga0068863_100008066 3300005841 Bacteria 10282
75 Ga0068858_100042281 3300005842 Bacteria 4225
76 Ga0068860_100000004 3300005843 Bacteria 506126
77 Ga0068860_100001298 3300005843 Bacteria 27144
78 Ga0068860_100024559 3300005843 Bacteria 5822
79 Ga0068862_100034537 3300005844 Bacteria 4279
80 Ga0068862_100609591 3300005844 Unclassified 1049
81 Ga0068862_100667209 3300005844 Bacteria 1004
82 Ga0075366_10147153 3300006195 Bacteria 1425
83 Ga0097621_100003043 3300006237 Bacteria 11509
84 Ga0075370_10319312 3300006353 Unclassified 925
85 Ga0068871_100006159 3300006358 Bacteria 8455
86 Ga0068871_100039656 3300006358 Bacteria 3770
87 Ga0068871_100272302 3300006358 Bacteria 1479
88 Ga0068865_100153564 3300006881 Bacteria 1749
89 Ga0097620_100000099 3300006931 Bacteria 80240
90 Ga0097620_100006324 3300006931 Bacteria 12012
91 Ga0105240_10000160 3300009093 Bacteria 137390
92 Ga0105240_10000649 3300009093 Bacteria 64145
93 Ga0105240_10010930 3300009093 Bacteria 12721
94 Ga0105240_10015917 3300009093 Bacteria 10203
95 Ga0105240_10025803 3300009093 Bacteria 7717
96 Ga0105240_10034833 3300009093 Bacteria 6491
97 Ga0105240_10268437 3300009093 Bacteria 1966
98 Ga0105240_10489641 3300009093 Unclassified 1369
99 Ga0105240_10860787 3300009093 Bacteria 978
100 Ga0111539_10005613 3300009094 Bacteria 16226
101 Ga0105247_10030533 3300009101 Bacteria 3266
102 Ga0105241_10003932 3300009174 Bacteria 10994
103 Ga0105241_10005420 3300009174 Bacteria 9431
104 Ga0105241_10111620 3300009174 Bacteria 2189
105 Ga0105241_10368295 3300009174 Bacteria 1252
106 Ga0105237_10000028 3300009545 Bacteria 201366
107 Ga0105237_10000677 3300009545 Bacteria 47148
108 Ga0105237_10001023 3300009545 Bacteria 37620
109 Ga0105237_10007520 3300009545 Bacteria 11913
110 Ga0105237_10021097 3300009545 Bacteria 6701
111 Ga0105237_10060745 3300009545 Bacteria 3779
112 Ga0105238_10052366 3300009551 Bacteria 4103
113 Ga0105238_10454859 3300009551 Bacteria 1278
114 Ga0105249_10007133 3300009553 Bacteria 9755
115 Ga0105249_10064641 3300009553 Bacteria 3364
116 Ga0105239_10000140 3300010375 Bacteria 101896
117 Ga0105239_10000512 3300010375 Bacteria 56021
118 Ga0105239_10013857 3300010375 Bacteria 8949
119 Ga0105239_10045774 3300010375 Unclassified 4795
120 Ga0105239_10203051 3300010375 Unclassified 2221
121 Ga0105239_10293521 3300010375 Bacteria 1831
122 Ga0105239_10366590 3300010375 Bacteria 1627
123 Ga0105239_10785104 3300010375 Bacteria 1091
124 Ga0157373_10000087 3300013100 Bacteria 80308
125 Ga0157373_10205444 3300013100 Bacteria 1389
126 Ga0157371_10020932 3300013102 Bacteria 4809
127 Ga0157374_10000004 3300013296 Bacteria 759774
128 Ga0157378_10112947 3300013297 Bacteria 2493
129 Ga0157378_10308052 3300013297 Unclassified 1535
130 Ga0163162_10000498 3300013306 Bacteria 36558
131 Ga0163162_10001451 3300013306 Bacteria 22074
132 Ga0163162_10113839 3300013306 Bacteria 2804
133 Ga0163162_10149755 3300013306 Bacteria 2450
134 Ga0157372_10034396 3300013307 Bacteria 5570
135 Ga0157372_10121153 3300013307 Unclassified 3005
136 Ga0157372_11300780 3300013307 Unclassified 839
137 Ga0157375_10173860 3300013308 Bacteria 2302
138 Ga0157380_10002002 3300014326 Bacteria 13580
139 Ga0157377_10007840 3300014745 Bacteria 5177
140 Ga0157379_10039083 3300014968 Bacteria 4233
141 Ga0157376_10001244 3300014969 Bacteria 16788
142 Ga0157376_10032668 3300014969 Bacteria 4181
143 Ga0157376_10062829 3300014969 Bacteria 3126
144 Ga0182005_1000353 3300015265 Bacteria 25823
145 Ga0209258_100252 3300025242 Bacteria 97179
146 Ga0209646_1000002 3300025246 Bacteria 1425781
147 Ga0209646_1001455 3300025246 Bacteria 6323
148 Ga0209026_1000263 3300025250 Bacteria 64234
149 Ga0209026_1000505 3300025250 Bacteria 27798
150 Ga0209148_1000217 3300025254 Bacteria 98076
151 Ga0209673_1000034 3300025273 Bacteria 328788
152 Ga0209564_1002598 3300025295 Bacteria 13858
153 Ga0209564_1002679 3300025295 Bacteria 13506
154 Ga0209564_1018349 3300025295 Unclassified 2672
155 Ga0209758_1000409 3300025297 Bacteria 73316
156 Ga0209758_1003706 3300025297 Bacteria 13553
157 Ga0209758_1004741 3300025297 Bacteria 11061
158 Ga0209050_1000673 3300025298 Bacteria 51628
159 Ga0207426_1000820 3300025302 Bacteria 33377
160 Ga0207426_1011585 3300025302 Unclassified 3350
161 Ga0207426_1013551 3300025302 Bacteria 3016
162 Ga0207426_1079779 3300025302 Bacteria 890
163 Ga0209051_1026188 3300025303 Bacteria 2357
164 Ga0209257_1000004 3300025304 Bacteria 1678347
165 Ga0209257_1003313 3300025304 Bacteria 13977
166 Ga0207697_10064009 3300025315 Bacteria 1533
167 Ga0207680_10000096 3300025903 Bacteria 40670
168 Ga0207680_10141157 3300025903 Unclassified 1597
169 Ga0207643_10244912 3300025908 Bacteria 1103
170 Ga0207705_10004523 3300025909 Bacteria 10510
171 Ga0207654_10000240 3300025911 Bacteria 33102
172 Ga0207695_10000027 3300025913 Bacteria 612456
173 Ga0207695_10024164 3300025913 Bacteria 6845
174 Ga0207695_10053078 3300025913 Bacteria 4242
175 Ga0207695_10085664 3300025913 Bacteria 3179
176 Ga0207695_10087162 3300025913 Bacteria 3145
177 Ga0207695_10172899 3300025913 Unclassified 2085
178 Ga0207671_10001586 3300025914 Bacteria 25838
179 Ga0207671_10008118 3300025914 Bacteria 8958
180 Ga0207671_10012063 3300025914 Bacteria 6981
181 Ga0207671_10013542 3300025914 Bacteria 6494
182 Ga0207671_10024787 3300025914 Unclassified 4507
183 Ga0207671_10085794 3300025914 Bacteria 2366
184 Ga0207652_10510960 3300025921 Bacteria 1081
185 Ga0207652_10546258 3300025921 Bacteria 1041
186 Ga0207681_10015721 3300025923 Bacteria 4724
187 Ga0207694_10657954 3300025924 Unclassified 883
188 Ga0207650_10207980 3300025925 Bacteria 1570
189 Ga0207650_10247332 3300025925 Bacteria 1443
190 Ga0207659_10021644 3300025926 Bacteria 4272
191 Ga0207690_10000309 3300025932 Bacteria 33416
192 Ga0207704_10011243 3300025938 Bacteria 4401
193 Ga0207691_10373112 3300025940 Unclassified 1218
194 Ga0207689_10001706 3300025942 Bacteria 20803
195 Ga0207689_10176003 3300025942 Bacteria 1764
196 Ga0207689_10280692 3300025942 Unclassified 1379
197 Ga0207667_10006409 3300025949 Bacteria 14256
198 Ga0207667_10046085 3300025949 Bacteria 4616
199 Ga0207667_10248712 3300025949 Unclassified 1819
200 Ga0207667_10836561 3300025949 Unclassified 915
201 Ga0207651_10049817 3300025960 Bacteria 2840
202 Ga0207651_10396156 3300025960 Bacteria 1173
203 Ga0207712_10053215 3300025961 Bacteria 2839
204 Ga0207668_10156684 3300025972 Bacteria 1770
205 Ga0207640_10045674 3300025981 Bacteria 2814
206 Ga0207658_10595878 3300025986 Bacteria 992
207 Ga0207677_10033694 3300026023 Unclassified 3308
208 Ga0207677_10154421 3300026023 Bacteria 1775
209 Ga0207639_10034685 3300026041 Bacteria 3731
210 Ga0207639_10115098 3300026041 Unclassified 2199
211 Ga0207639_10419274 3300026041 Bacteria 1210
212 Ga0207708_10098237 3300026075 Bacteria 2263
213 Ga0207702_10297658 3300026078 Bacteria 1530
214 Ga0207641_10000998 3300026088 Bacteria 28957
215 Ga0207641_10013301 3300026088 Bacteria 6751
216 Ga0207648_10184610 3300026089 Bacteria 1847
217 Ga0207676_10060043 3300026095 Bacteria 3005
218 Ga0207674_10004099 3300026116 Bacteria 17649
219 Ga0207675_100000507 3300026118 Bacteria 37845
220 Ga0207698_10166472 3300026142 Bacteria 1935
221 Ga0268266_10000232 3300028379 Bacteria 95941
222 Ga0268265_10312555 3300028380 Bacteria 1419
223 Ga0268265_10926390 3300028380 Bacteria 857
224 Ga0268264_10000011 3300028381 Bacteria 580884
225 Ga0268264_10001066 3300028381 Bacteria 27233
226 Ga0268264_10017738 3300028381 Bacteria 5828
227 Ga0265318_10044453 3300028577 Bacteria 1681
228 Ga0307515_10000024 3300028794 Bacteria 393119
229 Ga0265338_10083021 3300028800 Bacteria 2681
230 Ga0307511_10000651 3300030521 Bacteria 37072
231 Ga0316177_1169535 3300030731 Bacteria 1950
232 Ga0307513_10193184 3300031456 Unclassified 1885
233 Ga0307513_10224791 3300031456 Bacteria 1695
234 Ga0307513_10435137 3300031456 Bacteria 1039
235 Ga0307509_10041406 3300031507 Bacteria 4998
236 Ga0307509_10066002 3300031507 Bacteria 3798
237 Ga0307509_10075500 3300031507 Bacteria 3501
238 Ga0307509_10486330 3300031507 Unclassified 921
239 Ga0307408_100001197 3300031548 Bacteria 19594
240 Ga0307408_100007798 3300031548 Bacteria 7076
241 Ga0307408_100016951 3300031548 Bacteria 4870
242 Ga0307508_10001613 3300031616 Bacteria 25177
243 Ga0307508_10414856 3300031616 Bacteria 938
244 Ga0307412_10004806 3300031911 Bacteria 7537
245 Ga0307416_100688467 3300032002 Bacteria 1110
246 Ga0307414_10135113 3300032004 Unclassified 1922
247 Ga0307510_10007641 3300033180 Bacteria 12890
248 Ga0373927_0017039 3300035695 Unclassified 4787
249 Ga0373937_0946777 3300036401 Bacteria 810
250 Ga0439439_0039678 3300041406 Unclassified 1217
251 Ga0451804_0637577 3300041463 Bacteria 1053
252 Ga0451804_1093970 3300041463 Bacteria 1530
253 Ga0451807_2651224 3300041486 Bacteria 701
254 Ga0439442_051176 3300042002 Unclassified 871
255 Ga0439449_0072585 3300042007 Bacteria 1268
256 Ga0439457_001395 3300042014 Bacteria 7274
257 Ga0439457_010021 3300042014 Unclassified 2191
258 Ga0450898_014777 3300042134 Unclassified 1316
259 Ga0439434_0050947 3300042435 Unclassified 1283
260 Ga0451577_0005624 3300042876 Bacteria 12739
261 Ga0466969_0001622 3300044656 Bacteria 12048
262 Ga0466972_0000039 3300044658 Bacteria 135618
263 Ga0466972_0008589 3300044658 Bacteria 5125
264 Ga0466972_0010582 3300044658 Bacteria 4630
265 Ga0466972_0142080 3300044658 Bacteria 1130
266 Ga0466965_0111010 3300044683 Bacteria 1409
267 Ga0466966_0000091 3300044684 Bacteria 56015
268 Ga0466964_0045986 3300044706 Bacteria 1778
269 Ga0466968_0082592 3300044735 Bacteria 1414
270 Ga0466957_0000530 3300044842 Bacteria 19237
271 Ga0466957_0021586 3300044842 Bacteria 3795
272 Ga0466957_0218328 3300044842 Bacteria 1258
273 Ga0466960_0176605 3300044901 Bacteria 1156
274 Ga0466959_0000002 3300045049 Bacteria 362671
275 Ga0451576_0167104 3300045051 Unclassified 2296
276 Ga0495627_039750 3300046453 Unclassified 1450
277 Ga0495638_0085980 3300046460 Bacteria 1901
278 Ga0495606_0012319 3300046507 Bacteria 6875
279 Ga0495608_0127044 3300046511 Bacteria 1633
280 Ga0495628_0270575 3300046516 Bacteria 1264
281 Ga0495630_0002212 3300046517 Bacteria 13545
282 Ga0495632_0209336 3300046519 Bacteria 885
283 Ga0495648_0001281 3300046524 Bacteria 25084
284 Ga0495586_0032461 3300046535 Bacteria 2799
285 Ga0495633_0000017 3300046558 Bacteria 249973
286 Ga0495667_0024032 3300046559 Bacteria 4104
287 Ga0495668_0010143 3300046616 Bacteria 5729
288 Ga0495634_0133471 3300046642 Bacteria 1581
289 Ga0495611_0000058 3300046648 Bacteria 79572
290 Ga0495625_0093480 3300046660 Bacteria 2076
291 Ga0495672_0037192 3300047320 Unclassified 2981
292 Ga0495680_0070846 3300047322 Unclassified 2656
293 Ga0495687_000001 3300047443 Bacteria 1215582
294 Ga0495686_0011419 3300047472 Bacteria 6258
295 Ga0495686_0056964 3300047472 Unclassified 2440
296 Ga0495686_0130532 3300047472 Bacteria 1490
297 Ga0496115_0022002 3300048918 Unclassified 4932
298 Ga0496121_0000010 3300048924 Bacteria 793488
299 Ga0496126_0026329 3300048929 Bacteria 5579
300 Ga0495682_0106332 3300049460 Bacteria 1006
301 Ga0501033_0057337 3300049570 Unclassified 2879
302 Ga0501047_0015973 3300049581 Bacteria 7159
303 Ga0501047_0091133 3300049581 Bacteria 2926
304 Ga0501257_006923 3300049686 Bacteria 2525
305 Ga0501225_0000064 3300049705 Bacteria 34604
306 Ga0501241_000791 3300049758 Bacteria 6704
307 Ga0501044_0000801 3300049823 Bacteria 37915
308 nmdc:mga00v17_180896_c1 3300050491 Bacteria 1360
309 nmdc:mga0k408_148588_c1 3300050493 Bacteria 1395
310 nmdc:mga0k408_175657_c1 3300050493 Bacteria 1277
311 nmdc:mga06z11_387638_c1 3300050494 Unclassified 840
312 nmdc:mga06z11_56889_c1 3300050494 Unclassified 2024
313 nmdc:mga08y16_11997_c1 3300050511 Bacteria 9100
314 Ga0500578_0000034 3300053086 Bacteria 136582
315 Ga0500644_0000101 3300053088 Bacteria 54447
316 Ga0500583_0000063 3300053092 Bacteria 66256
317 Ga0500583_0000494 3300053092 Bacteria 12122
318 Ga0500583_0094532 3300053092 Unclassified 1458
319 Ga0500555_000116 3300053103 Bacteria 37945
320 Ga0500569_008732 3300053109 Bacteria 2329
321 Ga0500618_023749 3300053125 Bacteria 1481
322 Ga0500642_0118822 3300053130 Bacteria 1236
323 Ga0500652_003283 3300053131 Bacteria 4897
324 Ga0500652_051448 3300053131 Bacteria 1683
325 Ga0500658_0003136 3300053134 Bacteria 6311
326 Ga0500658_0180577 3300053134 Bacteria 961
327 Ga0500559_0042413 3300053136 Bacteria 1985
328 Ga0500568_0001005 3300053139 Bacteria 19319
329 Ga0500573_0090179 3300053140 Bacteria 1733
330 Ga0500577_0025923 3300053142 Bacteria 1989
331 Ga0500588_0039033 3300053146 Unclassified 1419
332 Ga0500590_022148 3300053148 Bacteria 3299
333 Ga0500616_0000468 3300053153 Bacteria 52556
334 Ga0500616_0157651 3300053153 Bacteria 1044
335 Ga0500622_0001731 3300053156 Bacteria 16871
336 Ga0500622_0009947 3300053156 Bacteria 5246
337 Ga0500636_0180928 3300053177 Bacteria 1132
338 Ga0500637_0198958 3300053178 Bacteria 1142
339 Ga0500611_000003 3300053727 Bacteria 333431
340 Ga0500645_000103 3300053730 Bacteria 67414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10112947 Ga0157378_101129472 203
2 3300041406 Ga0439439_0039678 Ga0439439_0039678_31_645 204
3 3300042002 Ga0439442_051176 Ga0439442_051176_236_850 204
4 3300041486 Ga0451807_2651224 Ga0451807_2651224_40_657 205
5 3300049460 Ga0495682_0106332 Ga0495682_0106332_370_987 205
6 3300009093 Ga0105240_10000160 Ga0105240_1000016069 213
7 3300025903 Ga0207680_10141157 Ga0207680_101411573 213
8 3300033180 Ga0307510_10007641 Ga0307510_1000764110 213
9 3300048929 Ga0496126_0026329 Ga0496126_0026329_12_653 213
10 3300053134 Ga0500658_0180577 Ga0500658_0180577_294_935 213
11 3300005843 Ga0068860_100000004 Ga0068860_10000000460 220
12 3300005844 Ga0068862_100667209 Ga0068862_1006672091 220
13 3300010375 Ga0105239_10293521 Ga0105239_102935212 220
14 3300013306 Ga0163162_10000498 Ga0163162_1000049819 220
15 3300028379 Ga0268266_10000232 Ga0268266_1000023221 220
16 3300028381 Ga0268264_10000011 Ga0268264_10000011306 220
17 3300046460 Ga0495638_0085980 Ga0495638_0085980_340_1086 220
18 3300046524 Ga0495648_0001281 Ga0495648_0001281_17205_17951 220
19 3300047443 Ga0495687_000001 Ga0495687_000001_1036788_1037534 220
20 3300053130 Ga0500642_0118822 Ga0500642_0118822_43_789 220
21 3300053156 Ga0500622_0009947 Ga0500622_0009947_758_1504 220
22 3300050494 nmdc:mga06z11_56889_c1 nmdc:mga06z11_56889_c1_122_895 223
23 3300003322 rootL2_10003898 rootL2_1000389811 225
24 3300046519 Ga0495632_0209336 Ga0495632_0209336_17_694 225
25 3300050491 nmdc:mga00v17_180896_c1 nmdc:mga00v17_180896_c1_229_1002 227
26 3300031548 Ga0307408_100007798 Ga0307408_1000077982 233
27 3300014969 Ga0157376_10062829 Ga0157376_100628292 237
28 iso_pu_bacteria 2818991442 2819572348 240
29 iso_pu_bacteria 2821136567 2821140281 240
30 iso_pu_bacteria 2904467357 2904472406 240
31 iso_pu_bacteria 2929239360 2929242673 240
32 3300003320 rootH2_10135351 rootH2_1013535110 242
33 3300005327 Ga0070658_10004413 Ga0070658_100044136 242
34 3300005327 Ga0070658_10311614 Ga0070658_103116142 242
35 3300005458 Ga0070681_10041336 Ga0070681_100413362 242
36 3300005530 Ga0070679_100384214 Ga0070679_1003842141 242
37 3300005539 Ga0068853_100298220 Ga0068853_1002982202 242
38 3300005563 Ga0068855_100012782 Ga0068855_1000127828 242
39 3300006353 Ga0075370_10319312 Ga0075370_103193122 242
40 3300009093 Ga0105240_10015917 Ga0105240_1001591710 242
41 3300009093 Ga0105240_10489641 Ga0105240_104896412 242
42 3300009093 Ga0105240_10860787 Ga0105240_108607871 242
43 3300013297 Ga0157378_10308052 Ga0157378_103080522 242
44 3300013307 Ga0157372_11300780 Ga0157372_113007801 242
45 3300025909 Ga0207705_10004523 Ga0207705_100045233 242
46 3300025913 Ga0207695_10053078 Ga0207695_100530782 242
47 3300025921 Ga0207652_10510960 Ga0207652_105109602 242
48 3300025921 Ga0207652_10546258 Ga0207652_105462582 242
49 3300025949 Ga0207667_10006409 Ga0207667_100064099 242
50 3300025949 Ga0207667_10836561 Ga0207667_108365611 242
51 3300026041 Ga0207639_10115098 Ga0207639_101150982 242
52 3300026078 Ga0207702_10297658 Ga0207702_102976582 242
53 3300028800 Ga0265338_10083021 Ga0265338_100830212 242
54 3300036401 Ga0373937_0946777 Ga0373937_0946777_42_773 242
55 3300042876 Ga0451577_0005624 Ga0451577_0005624_11804_12535 242
56 3300045051 Ga0451576_0167104 Ga0451576_0167104_660_1391 242
57 3300046511 Ga0495608_0127044 Ga0495608_0127044_632_1363 242
58 3300046516 Ga0495628_0270575 Ga0495628_0270575_15_746 242
59 3300046517 Ga0495630_0002212 Ga0495630_0002212_5392_6123 242
60 3300046535 Ga0495586_0032461 Ga0495586_0032461_1681_2412 242
61 3300046559 Ga0495667_0024032 Ga0495667_0024032_1151_1882 242
62 3300046642 Ga0495634_0133471 Ga0495634_0133471_99_830 242
63 3300047322 Ga0495680_0070846 Ga0495680_0070846_1792_2523 242
64 3300048918 Ga0496115_0022002 Ga0496115_0022002_2051_2782 242
65 3300049570 Ga0501033_0057337 Ga0501033_0057337_1117_1848 242
66 3300050494 nmdc:mga06z11_387638_c1 nmdc:mga06z11_387638_c1_24_770 242
67 3300053103 Ga0500555_000116 Ga0500555_000116_17604_18374 242
68 3300053139 Ga0500568_0001005 Ga0500568_0001005_11809_12570 242
69 3300053153 Ga0500616_0000468 Ga0500616_0000468_9112_9879 242
70 3300053730 Ga0500645_000103 Ga0500645_000103_20331_21101 242
71 3300025295 Ga0209564_1018349 Ga0209564_10183493 243
72 3300025302 Ga0207426_1079779 Ga0207426_10797791 243
73 3300003761 Ga0055535_1001768 Ga0055535_10017683 244
74 3300005262 Ga0065165_1008771 Ga0065165_10087715 244
75 3300015265 Ga0182005_1000353 Ga0182005_100035316 244
76 3300025242 Ga0209258_100252 Ga0209258_10025263 244
77 3300025254 Ga0209148_1000217 Ga0209148_100021763 244
78 3300025302 Ga0207426_1011585 Ga0207426_10115853 244
79 3300044842 Ga0466957_0218328 Ga0466957_0218328_382_1116 244
80 3300048924 Ga0496121_0000010 Ga0496121_0000010_650338_651072 244
81 3300053088 Ga0500644_0000101 Ga0500644_0000101_46106_46840 244
82 3300053109 Ga0500569_008732 Ga0500569_008732_1232_1966 244
83 3300053134 Ga0500658_0003136 Ga0500658_0003136_2631_3365 244
84 3300053136 Ga0500559_0042413 Ga0500559_0042413_952_1686 244
85 3300053142 Ga0500577_0025923 Ga0500577_0025923_927_1661 244
86 3300053148 Ga0500590_022148 Ga0500590_022148_780_1514 244
87 iso_pu_bacteria 2738541278 2738727159 244
88 iso_pu_bacteria 2929921140 2929922799 244
89 iso_pu_bacteria 8003151029 8003154598 244
90 3300009551 Ga0105238_10454859 Ga0105238_104548592 246
91 3300025924 Ga0207694_10657954 Ga0207694_106579542 246
92 3300028577 Ga0265318_10044453 Ga0265318_100444531 246
93 3300035695 Ga0373927_0017039 Ga0373927_0017039_2120_2866 246
94 3300002155 JGI24033J26618_1009060 JGI24033J26618_10090602 247
95 3300005293 Ga0065715_10006205 Ga0065715_100062052 247
96 3300005295 Ga0065707_10203422 Ga0065707_102034222 247
97 3300005328 Ga0070676_10096446 Ga0070676_100964462 247
98 3300005331 Ga0070670_100237583 Ga0070670_1002375831 247
99 3300005347 Ga0070668_100071062 Ga0070668_1000710622 247
100 3300005354 Ga0070675_100034017 Ga0070675_1000340173 247
101 3300005364 Ga0070673_100021225 Ga0070673_1000212253 247
102 3300005365 Ga0070688_100011851 Ga0070688_1000118512 247
103 3300005438 Ga0070701_10280077 Ga0070701_102800771 247
104 3300005441 Ga0070700_100280785 Ga0070700_1002807852 247
105 3300005459 Ga0068867_100077746 Ga0068867_1000777462 247
106 3300005617 Ga0068859_100006324 Ga0068859_10000632412 247
107 3300005719 Ga0068861_100124050 Ga0068861_1001240502 247
108 3300005719 Ga0068861_100463196 Ga0068861_1004631962 247
109 3300005840 Ga0068870_10044285 Ga0068870_100442852 247
110 3300005844 Ga0068862_100034537 Ga0068862_1000345374 247
111 3300005844 Ga0068862_100609591 Ga0068862_1006095911 247
112 3300006358 Ga0068871_100272302 Ga0068871_1002723022 247
113 3300006931 Ga0097620_100006324 Ga0097620_10000632412 247
114 3300009093 Ga0105240_10034833 Ga0105240_100348337 247
115 3300009094 Ga0111539_10005613 Ga0111539_1000561313 247
116 3300009545 Ga0105237_10021097 Ga0105237_100210972 247
117 3300009553 Ga0105249_10007133 Ga0105249_100071335 247
118 3300010375 Ga0105239_10000140 Ga0105239_1000014056 247
119 3300013296 Ga0157374_10000004 Ga0157374_10000004482 247
120 3300013306 Ga0163162_10113839 Ga0163162_101138392 247
121 3300013308 Ga0157375_10173860 Ga0157375_101738602 247
122 3300014326 Ga0157380_10002002 Ga0157380_100020024 247
123 3300014745 Ga0157377_10007840 Ga0157377_100078402 247
124 3300014969 Ga0157376_10001244 Ga0157376_100012447 247
125 3300025315 Ga0207697_10064009 Ga0207697_100640092 247
126 3300025908 Ga0207643_10244912 Ga0207643_102449122 247
127 3300025913 Ga0207695_10087162 Ga0207695_100871624 247
128 3300025914 Ga0207671_10012063 Ga0207671_100120639 247
129 3300025923 Ga0207681_10015721 Ga0207681_100157212 247
130 3300025925 Ga0207650_10207980 Ga0207650_102079802 247
131 3300025926 Ga0207659_10021644 Ga0207659_100216444 247
132 3300025942 Ga0207689_10176003 Ga0207689_101760032 247
133 3300025949 Ga0207667_10248712 Ga0207667_102487122 247
134 3300025960 Ga0207651_10396156 Ga0207651_103961561 247
135 3300025961 Ga0207712_10053215 Ga0207712_100532153 247
136 3300025972 Ga0207668_10156684 Ga0207668_101566843 247
137 3300025981 Ga0207640_10045674 Ga0207640_100456743 247
138 3300026075 Ga0207708_10098237 Ga0207708_100982372 247
139 3300026089 Ga0207648_10184610 Ga0207648_101846103 247
140 3300026116 Ga0207674_10004099 Ga0207674_1000409912 247
141 3300026118 Ga0207675_100000507 Ga0207675_10000050733 247
142 3300028380 Ga0268265_10312555 Ga0268265_103125552 247
143 3300028380 Ga0268265_10926390 Ga0268265_109263901 247
144 3300030521 Ga0307511_10000651 Ga0307511_1000065128 247
145 3300030731 Ga0316177_1169535 Ga0316177_11695352 247
146 3300032004 Ga0307414_10135113 Ga0307414_101351132 247
147 3300042014 Ga0439457_010021 Ga0439457_010021_741_1484 247
148 3300042134 Ga0450898_014777 Ga0450898_014777_471_1214 247
149 3300042435 Ga0439434_0050947 Ga0439434_0050947_415_1158 247
150 3300047472 Ga0495686_0011419 Ga0495686_0011419_3758_4507 247
151 3300047472 Ga0495686_0056964 Ga0495686_0056964_785_1534 247
152 3300050493 nmdc:mga0k408_148588_c1 nmdc:mga0k408_148588_c1_22_822 247
153 3300050511 nmdc:mga08y16_11997_c1 nmdc:mga08y16_11997_c1_7899_8645 247
154 3300001979 JGI24740J21852_10003972 JGI24740J21852_100039728 248
155 3300001989 JGI24739J22299_10001551 JGI24739J22299_100015513 248
156 3300002738 JGI25154J39366_1000001 JGI25154J39366_100000176 248
157 3300002741 JGI25157J39369_1009320 JGI25157J39369_10093202 248
158 3300003215 JGI25153J46596_10000204 JGI25153J46596_1000020427 248
159 3300003215 JGI25153J46596_10015373 JGI25153J46596_100153732 248
160 3300003215 JGI25153J46596_10035439 JGI25153J46596_100354391 248
161 3300003316 rootH1_10075172 rootH1_100751721 248
162 3300003320 rootH2_10281983 rootH2_102819832 248
163 3300003322 rootL2_10003015 rootL2_100030153 248
164 3300003322 rootL2_10020271 rootL2_100202718 248
165 3300003322 rootL2_10120688 rootL2_101206882 248
166 3300003322 rootL2_10120690 rootL2_101206902 248
167 3300003323 rootH1_10052358 rootH1_100523584 248
168 3300003323 rootH1_10055289 rootH1_100552894 248
169 3300003323 rootH1_10228023 rootH1_102280231 248
170 3300003354 JGI25160J50197_1003439 JGI25160J50197_10034398 248
171 3300003354 JGI25160J50197_1004298 JGI25160J50197_10042985 248
172 3300003771 Ga0055526_1054730 Ga0055526_10547301 248
173 3300003790 Ga0055528_1000995 Ga0055528_100099512 248
174 3300003791 Ga0055530_10004890 Ga0055530_100048905 248
175 3300003794 Ga0055531_10000102 Ga0055531_1000010214 248
176 3300005262 Ga0065165_1000053 Ga0065165_1000053151 248
177 3300005262 Ga0065165_1010948 Ga0065165_10109484 248
178 3300005334 Ga0068869_100011818 Ga0068869_1000118183 248
179 3300005334 Ga0068869_100268936 Ga0068869_1002689362 248
180 3300005335 Ga0070666_10000143 Ga0070666_1000014329 248
181 3300005335 Ga0070666_10171751 Ga0070666_101717512 248
182 3300005337 Ga0070682_100070172 Ga0070682_1000701724 248
183 3300005338 Ga0068868_100046799 Ga0068868_1000467994 248
184 3300005339 Ga0070660_100066448 Ga0070660_1000664484 248
185 3300005347 Ga0070668_100040159 Ga0070668_1000401593 248
186 3300005364 Ga0070673_100214582 Ga0070673_1002145821 248
187 3300005366 Ga0070659_100000092 Ga0070659_10000009222 248
188 3300005367 Ga0070667_100053319 Ga0070667_1000533193 248
189 3300005471 Ga0070698_100599706 Ga0070698_1005997061 248
190 3300005518 Ga0070699_100506068 Ga0070699_1005060681 248
191 3300005539 Ga0068853_100157336 Ga0068853_1001573362 248
192 3300005539 Ga0068853_100354586 Ga0068853_1003545862 248
193 3300005548 Ga0070665_100248583 Ga0070665_1002485832 248
194 3300005563 Ga0068855_100216439 Ga0068855_1002164392 248
195 3300005616 Ga0068852_100004042 Ga0068852_10000404210 248
196 3300005616 Ga0068852_100356219 Ga0068852_1003562192 248
197 3300005617 Ga0068859_100000099 Ga0068859_10000009954 248
198 3300005618 Ga0068864_100007566 Ga0068864_1000075663 248
199 3300005840 Ga0068870_10224661 Ga0068870_102246612 248
200 3300005841 Ga0068863_100001311 Ga0068863_10000131117 248
201 3300005841 Ga0068863_100008066 Ga0068863_1000080668 248
202 3300005842 Ga0068858_100042281 Ga0068858_1000422816 248
203 3300005843 Ga0068860_100001298 Ga0068860_1000012986 248
204 3300005843 Ga0068860_100024559 Ga0068860_1000245593 248
205 3300006195 Ga0075366_10147153 Ga0075366_101471532 248
206 3300006237 Ga0097621_100003043 Ga0097621_1000030437 248
207 3300006358 Ga0068871_100006159 Ga0068871_1000061591 248
208 3300006358 Ga0068871_100039656 Ga0068871_1000396562 248
209 3300006881 Ga0068865_100153564 Ga0068865_1001535642 248
210 3300006931 Ga0097620_100000099 Ga0097620_10000009954 248
211 3300009093 Ga0105240_10000649 Ga0105240_1000064927 248
212 3300009093 Ga0105240_10010930 Ga0105240_1001093011 248
213 3300009093 Ga0105240_10025803 Ga0105240_100258034 248
214 3300009093 Ga0105240_10268437 Ga0105240_102684372 248
215 3300009101 Ga0105247_10030533 Ga0105247_100305332 248
216 3300009174 Ga0105241_10003932 Ga0105241_100039323 248
217 3300009174 Ga0105241_10005420 Ga0105241_100054202 248
218 3300009174 Ga0105241_10111620 Ga0105241_101116204 248
219 3300009174 Ga0105241_10368295 Ga0105241_103682952 248
220 3300009545 Ga0105237_10000028 Ga0105237_1000002879 248
221 3300009545 Ga0105237_10000677 Ga0105237_1000067737 248
222 3300009545 Ga0105237_10001023 Ga0105237_100010239 248
223 3300009545 Ga0105237_10007520 Ga0105237_100075204 248
224 3300009545 Ga0105237_10060745 Ga0105237_100607452 248
225 3300009551 Ga0105238_10052366 Ga0105238_100523667 248
226 3300009553 Ga0105249_10064641 Ga0105249_100646414 248
227 3300010375 Ga0105239_10000512 Ga0105239_1000051242 248
228 3300010375 Ga0105239_10013857 Ga0105239_100138573 248
229 3300010375 Ga0105239_10045774 Ga0105239_100457744 248
230 3300010375 Ga0105239_10203051 Ga0105239_102030512 248
231 3300010375 Ga0105239_10366590 Ga0105239_103665902 248
232 3300010375 Ga0105239_10785104 Ga0105239_107851042 248
233 3300013100 Ga0157373_10000087 Ga0157373_1000008722 248
234 3300013100 Ga0157373_10205444 Ga0157373_102054442 248
235 3300013102 Ga0157371_10020932 Ga0157371_100209324 248
236 3300013306 Ga0163162_10001451 Ga0163162_1000145115 248
237 3300013306 Ga0163162_10149755 Ga0163162_101497553 248
238 3300013307 Ga0157372_10034396 Ga0157372_100343966 248
239 3300013307 Ga0157372_10121153 Ga0157372_101211532 248
240 3300014968 Ga0157379_10039083 Ga0157379_100390834 248
241 3300014969 Ga0157376_10032668 Ga0157376_100326682 248
242 3300025246 Ga0209646_1000002 Ga0209646_100000277 248
243 3300025246 Ga0209646_1001455 Ga0209646_10014553 248
244 3300025250 Ga0209026_1000263 Ga0209026_100026343 248
245 3300025250 Ga0209026_1000505 Ga0209026_100050514 248
246 3300025273 Ga0209673_1000034 Ga0209673_100003446 248
247 3300025295 Ga0209564_1002598 Ga0209564_10025985 248
248 3300025295 Ga0209564_1002679 Ga0209564_10026795 248
249 3300025297 Ga0209758_1000409 Ga0209758_100040924 248
250 3300025297 Ga0209758_1003706 Ga0209758_10037068 248
251 3300025297 Ga0209758_1004741 Ga0209758_10047411 248
252 3300025298 Ga0209050_1000673 Ga0209050_10006734 248
253 3300025302 Ga0207426_1000820 Ga0207426_100082014 248
254 3300025302 Ga0207426_1013551 Ga0207426_10135514 248
255 3300025303 Ga0209051_1026188 Ga0209051_10261882 248
256 3300025304 Ga0209257_1000004 Ga0209257_10000041335 248
257 3300025304 Ga0209257_1003313 Ga0209257_10033139 248
258 3300025903 Ga0207680_10000096 Ga0207680_1000009619 248
259 3300025911 Ga0207654_10000240 Ga0207654_100002405 248
260 3300025913 Ga0207695_10000027 Ga0207695_10000027162 248
261 3300025913 Ga0207695_10024164 Ga0207695_100241649 248
262 3300025913 Ga0207695_10085664 Ga0207695_100856643 248
263 3300025913 Ga0207695_10172899 Ga0207695_101728993 248
264 3300025914 Ga0207671_10001586 Ga0207671_1000158613 248
265 3300025914 Ga0207671_10008118 Ga0207671_100081183 248
266 3300025914 Ga0207671_10013542 Ga0207671_100135429 248
267 3300025914 Ga0207671_10024787 Ga0207671_100247874 248
268 3300025914 Ga0207671_10085794 Ga0207671_100857942 248
269 3300025925 Ga0207650_10247332 Ga0207650_102473323 248
270 3300025932 Ga0207690_10000309 Ga0207690_1000030921 248
271 3300025938 Ga0207704_10011243 Ga0207704_100112435 248
272 3300025940 Ga0207691_10373112 Ga0207691_103731121 248
273 3300025942 Ga0207689_10001706 Ga0207689_1000170621 248
274 3300025942 Ga0207689_10280692 Ga0207689_102806922 248
275 3300025949 Ga0207667_10046085 Ga0207667_100460854 248
276 3300025960 Ga0207651_10049817 Ga0207651_100498173 248
277 3300025986 Ga0207658_10595878 Ga0207658_105958781 248
278 3300026023 Ga0207677_10033694 Ga0207677_100336942 248
279 3300026023 Ga0207677_10154421 Ga0207677_101544213 248
280 3300026041 Ga0207639_10034685 Ga0207639_100346854 248
281 3300026041 Ga0207639_10419274 Ga0207639_104192742 248
282 3300026088 Ga0207641_10000998 Ga0207641_1000099825 248
283 3300026088 Ga0207641_10013301 Ga0207641_100133016 248
284 3300026095 Ga0207676_10060043 Ga0207676_100600433 248
285 3300026142 Ga0207698_10166472 Ga0207698_101664722 248
286 3300028381 Ga0268264_10001066 Ga0268264_100010666 248
287 3300028381 Ga0268264_10017738 Ga0268264_100177383 248
288 3300028794 Ga0307515_10000024 Ga0307515_10000024236 248
289 3300031456 Ga0307513_10193184 Ga0307513_101931841 248
290 3300031456 Ga0307513_10224791 Ga0307513_102247913 248
291 3300031456 Ga0307513_10435137 Ga0307513_104351372 248
292 3300031507 Ga0307509_10041406 Ga0307509_100414062 248
293 3300031507 Ga0307509_10066002 Ga0307509_100660023 248
294 3300031507 Ga0307509_10075500 Ga0307509_100755003 248
295 3300031507 Ga0307509_10486330 Ga0307509_104863302 248
296 3300031548 Ga0307408_100001197 Ga0307408_10000119712 248
297 3300031548 Ga0307408_100016951 Ga0307408_1000169515 248
298 3300031616 Ga0307508_10001613 Ga0307508_1000161323 248
299 3300031616 Ga0307508_10414856 Ga0307508_104148561 248
300 3300031911 Ga0307412_10004806 Ga0307412_100048067 248
301 3300032002 Ga0307416_100688467 Ga0307416_1006884672 248
302 3300041463 Ga0451804_0637577 Ga0451804_0637577_189_935 248
303 3300041463 Ga0451804_1093970 Ga0451804_1093970_216_974 248
304 3300042007 Ga0439449_0072585 Ga0439449_0072585_49_795 248
305 3300042014 Ga0439457_001395 Ga0439457_001395_3115_3861 248
306 3300044656 Ga0466969_0001622 Ga0466969_0001622_3166_3912 248
307 3300044658 Ga0466972_0000039 Ga0466972_0000039_86233_86979 248
308 3300044658 Ga0466972_0008589 Ga0466972_0008589_3891_4637 248
309 3300044658 Ga0466972_0010582 Ga0466972_0010582_2050_2796 248
310 3300044658 Ga0466972_0142080 Ga0466972_0142080_270_1016 248
311 3300044683 Ga0466965_0111010 Ga0466965_0111010_95_841 248
312 3300044684 Ga0466966_0000091 Ga0466966_0000091_2411_3157 248
313 3300044706 Ga0466964_0045986 Ga0466964_0045986_676_1422 248
314 3300044735 Ga0466968_0082592 Ga0466968_0082592_447_1193 248
315 3300044842 Ga0466957_0000530 Ga0466957_0000530_15161_15907 248
316 3300044842 Ga0466957_0021586 Ga0466957_0021586_1587_2333 248
317 3300044901 Ga0466960_0176605 Ga0466960_0176605_365_1111 248
318 3300045049 Ga0466959_0000002 Ga0466959_0000002_185423_186169 248
319 3300046453 Ga0495627_039750 Ga0495627_039750_151_897 248
320 3300046507 Ga0495606_0012319 Ga0495606_0012319_1773_2519 248
321 3300046558 Ga0495633_0000017 Ga0495633_0000017_9499_10245 248
322 3300046616 Ga0495668_0010143 Ga0495668_0010143_3451_4197 248
323 3300046648 Ga0495611_0000058 Ga0495611_0000058_21402_22148 248
324 3300046660 Ga0495625_0093480 Ga0495625_0093480_710_1456 248
325 3300047320 Ga0495672_0037192 Ga0495672_0037192_579_1325 248
326 3300047472 Ga0495686_0130532 Ga0495686_0130532_26_772 248
327 3300049581 Ga0501047_0015973 Ga0501047_0015973_736_1482 248
328 3300049581 Ga0501047_0091133 Ga0501047_0091133_1912_2658 248
329 3300049686 Ga0501257_006923 Ga0501257_006923_1083_1829 248
330 3300049705 Ga0501225_0000064 Ga0501225_0000064_14493_15239 248
331 3300049758 Ga0501241_000791 Ga0501241_000791_2860_3606 248
332 3300049823 Ga0501044_0000801 Ga0501044_0000801_11215_11961 248
333 3300050493 nmdc:mga0k408_175657_c1 nmdc:mga0k408_175657_c1_53_811 248
334 3300053086 Ga0500578_0000034 Ga0500578_0000034_93186_93932 248
335 3300053092 Ga0500583_0000063 Ga0500583_0000063_7888_8634 248
336 3300053092 Ga0500583_0000494 Ga0500583_0000494_2896_3642 248
337 3300053092 Ga0500583_0094532 Ga0500583_0094532_458_1204 248
338 3300053125 Ga0500618_023749 Ga0500618_023749_82_828 248
339 3300053131 Ga0500652_003283 Ga0500652_003283_4129_4875 248
340 3300053131 Ga0500652_051448 Ga0500652_051448_682_1428 248
341 3300053140 Ga0500573_0090179 Ga0500573_0090179_109_855 248
342 3300053146 Ga0500588_0039033 Ga0500588_0039033_182_928 248
343 3300053153 Ga0500616_0157651 Ga0500616_0157651_30_776 248
344 3300053156 Ga0500622_0001731 Ga0500622_0001731_11341_12087 248
345 3300053177 Ga0500636_0180928 Ga0500636_0180928_212_958 248
346 3300053178 Ga0500637_0198958 Ga0500637_0198958_116_862 248
347 3300053727 Ga0500611_000003 Ga0500611_000003_30030_30776 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

187

256

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sef-assembly1.cif.gz_A crystal structure of cupin domain protein ef2996 from enterococcus faecalis 0.9545 5 247
1sfn-assembly1.cif.gz_A crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861 0.9518 1 246
1sfn-assembly1.cif.gz_A crystal structure of protein dr1152 from deinococcus radiodurans r1, pfam duf861 0.9481 1 246
4e2q-assembly1.cif.gz_G crystal structure of (s)-ureidoglycine aminohydrolase from arabidopsis thaliana 0.9464 1 246
1sef-assembly1.cif.gz_A crystal structure of cupin domain protein ef2996 from enterococcus faecalis 0.9322 5 247
ID Description Score Start End Superfamily
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9518 1 246 2.60.120.10
1sefA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9514 146 247 2.60.120.10
4e2qH00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9485 1 246 2.60.120.10
1sfnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9481 1 246 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.923 151 240 2.60.120.10
ID Description Score Start End GO Terms
AF-I4B3X3-F1-model_v4 Cupin 2 conserved barrel domain protein 0.9801 4 248 GO:0071522
AF-A0A7Y5VID9-F1-model_v4 (S)-ureidoglycine aminohydrolase (EC 3.5.3.26) 0.9742 33 247 GO:0071522
AF-A0A2A6RPU2-F1-model_v4 (S)-ureidoglycine aminohydrolase 0.9735 5 245 GO:0071522
AF-A0A4Q5R105-F1-model_v4 (S)-ureidoglycine aminohydrolase (EC 3.5.3.26) 0.9732 7 248 GO:0071522
AF-A0A2V9F545-F1-model_v4 (S)-ureidoglycine aminohydrolase 0.9711 140 245 GO:0071522

Feature Viewer

pLDDT pTM Quality
93.11 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map