F417306

General Info

Members Datasets Scaffolds Average Seq Length
347 190 694 263

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0157000|Ga0501040_0157000_183_1028
Length 281
Sequence VALPVDASGVAFDASRPPRRIVSLIPSTTETLCRLGLADALVGVTAYCVEPRDVVRTKRRIGGEKNPDLEAVRALAPDLVVANVEENVREHIETLRAWKVPVWVTYPRTVDGSLAMIRELGEVTGARAAAAAVLAEIEPLLAAVRAAVAGRPAVSVFYPIWRDPYMTINRDTYIHDLLAVCGAANVFAGRAERYPTITLAEMAGHRPEVIVLPDEPFRFRRSHVRDFEEFGDVPAVRTGRIHLVDGKPFSWHGPRVADALRALPALFHGPDFLPAAGARVR

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
140 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
141 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
186 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
187 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
188 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
189 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
190 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.27
Metatranscriptomes 0
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.58
Rhizoplane 1.73
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0157000 3300049576 Bacteria 1607
2 Ga0070683_100025370 3300005329 Bacteria 5323
3 Ga0070690_100297558 3300005330 Bacteria 1156
4 Ga0070690_100326935 3300005330 Unclassified 1107
5 Ga0070670_100003608 3300005331 Bacteria 12876
6 Ga0068869_100001934 3300005334 Bacteria 12438
7 Ga0068869_100002695 3300005334 Bacteria 10744
8 Ga0068869_100059888 3300005334 Bacteria 2789
9 Ga0070680_100003291 3300005336 Bacteria 12057
10 Ga0070682_100000155 3300005337 Bacteria 52961
11 Ga0070660_100000413 3300005339 Bacteria 28424
12 Ga0070689_100066561 3300005340 Bacteria 2807
13 Ga0070691_10025409 3300005341 Bacteria 2758
14 Ga0070661_100000295 3300005344 Bacteria 40240
15 Ga0070692_10000129 3300005345 Bacteria 17925
16 Ga0070669_100188534 3300005353 Bacteria 1617
17 Ga0070675_100114323 3300005354 Bacteria 2287
18 Ga0070659_100001038 3300005366 Bacteria 20309
19 Ga0070703_10006712 3300005406 Bacteria 3225
20 Ga0070703_10030931 3300005406 Bacteria 1616
21 Ga0070705_100001014 3300005440 Bacteria 15656
22 Ga0070705_100048634 3300005440 Bacteria 2458
23 Ga0070700_100112207 3300005441 Unclassified 1814
24 Ga0070694_100000027 3300005444 Bacteria 67286
25 Ga0070694_100218309 3300005444 Bacteria 1429
26 Ga0070708_100018846 3300005445 Bacteria 5781
27 Ga0070708_100034693 3300005445 Bacteria 4391
28 Ga0070708_100178361 3300005445 Bacteria 1985
29 Ga0070663_100040992 3300005455 Bacteria 3245
30 Ga0070662_100000730 3300005457 Bacteria 20101
31 Ga0070681_10021012 3300005458 Bacteria 6540
32 Ga0068867_100006054 3300005459 Bacteria 8572
33 Ga0070706_100146729 3300005467 Unclassified 2203
34 Ga0070706_100183286 3300005467 Bacteria 1955
35 Ga0070706_100319660 3300005467 Bacteria 1448
36 Ga0070706_100378011 3300005467 Unclassified 1319
37 Ga0070707_100033458 3300005468 Bacteria 4902
38 Ga0070707_100033876 3300005468 Bacteria 4870
39 Ga0070707_100085657 3300005468 Bacteria 3046
40 Ga0070707_100091405 3300005468 Unclassified 2946
41 Ga0070707_100112961 3300005468 Bacteria 2636
42 Ga0070707_100118384 3300005468 Bacteria 2571
43 Ga0070698_100041363 3300005471 Bacteria 4731
44 Ga0070698_100188535 3300005471 Bacteria 2000
45 Ga0070699_100004242 3300005518 Bacteria 12673
46 Ga0070699_100053460 3300005518 Bacteria 3495
47 Ga0070699_100322790 3300005518 Bacteria 1388
48 Ga0070679_100017240 3300005530 Bacteria 6986
49 Ga0070697_100159801 3300005536 Unclassified 1903
50 Ga0070697_100244098 3300005536 Bacteria 1534
51 Ga0070697_100465503 3300005536 Bacteria 1102
52 Ga0068853_100003096 3300005539 Bacteria 12713
53 Ga0070672_100040719 3300005543 Bacteria 3567
54 Ga0070672_100193709 3300005543 Bacteria 1698
55 Ga0070695_100002075 3300005545 Bacteria 11473
56 Ga0070695_100022330 3300005545 Bacteria 3881
57 Ga0070696_100001392 3300005546 Bacteria 15803
58 Ga0070696_100020510 3300005546 Bacteria 4478
59 Ga0070696_100039816 3300005546 Bacteria 3245
60 Ga0070696_100305281 3300005546 Bacteria 1220
61 Ga0070693_100000299 3300005547 Bacteria 22979
62 Ga0070704_100003220 3300005549 Bacteria 9337
63 Ga0068855_100002347 3300005563 Bacteria 23364
64 Ga0070664_100036983 3300005564 Bacteria 4103
65 Ga0068857_100034171 3300005577 Bacteria 4498
66 Ga0068854_100014166 3300005578 Bacteria 5249
67 Ga0068856_100041756 3300005614 Bacteria 4509
68 Ga0070702_100095878 3300005615 Bacteria 1809
69 Ga0068852_100028782 3300005616 Bacteria 4552
70 Ga0068859_100010533 3300005617 Bacteria 9306
71 Ga0068859_100154234 3300005617 Bacteria 2373
72 Ga0068859_100171761 3300005617 Bacteria 2249
73 Ga0068864_100087113 3300005618 Bacteria 2749
74 Ga0068866_10030072 3300005718 Bacteria 2603
75 Ga0068861_100010518 3300005719 Bacteria 6422
76 Ga0068861_100176304 3300005719 Bacteria 1775
77 Ga0068870_10009102 3300005840 Bacteria 4499
78 Ga0068863_100101582 3300005841 Bacteria 2734
79 Ga0068863_100129337 3300005841 Unclassified 2410
80 Ga0068863_100146703 3300005841 Bacteria 2257
81 Ga0068858_100024729 3300005842 Bacteria 5593
82 Ga0068860_100011411 3300005843 Bacteria 8753
83 Ga0068860_100081412 3300005843 Bacteria 3079
84 Ga0068862_100018213 3300005844 Bacteria 5847
85 Ga0068862_100023225 3300005844 Bacteria 5194
86 Ga0068862_100052398 3300005844 Bacteria 3491
87 Ga0068862_100081955 3300005844 Bacteria 2799
88 Ga0068862_100564812 3300005844 Unclassified 1088
89 Ga0070717_10323612 3300006028 Bacteria 1374
90 Ga0075432_10038894 3300006058 Bacteria 1658
91 Ga0075428_100001426 3300006844 Bacteria 25474
92 Ga0075428_100001646 3300006844 Bacteria 23777
93 Ga0075428_100042735 3300006844 Bacteria 4983
94 Ga0075428_100070391 3300006844 Bacteria 3824
95 Ga0075430_100000068 3300006846 Bacteria 55821
96 Ga0075430_100001067 3300006846 Bacteria 21734
97 Ga0075431_100000238 3300006847 Bacteria 41406
98 Ga0075431_100001186 3300006847 Bacteria 23511
99 Ga0075431_100036911 3300006847 Bacteria 5034
100 Ga0075431_100226907 3300006847 Bacteria 1904
101 Ga0075431_100311888 3300006847 Unclassified 1588
102 Ga0075433_10000659 3300006852 Bacteria 23294
103 Ga0075433_10020922 3300006852 Bacteria 5478
104 Ga0075433_10115834 3300006852 Bacteria 2378
105 Ga0075433_10406457 3300006852 Unclassified 1201
106 Ga0075433_10425432 3300006852 Bacteria 1171
107 Ga0075434_100001544 3300006871 Bacteria 19489
108 Ga0075434_100004630 3300006871 Bacteria 12426
109 Ga0075434_100068788 3300006871 Bacteria 3528
110 Ga0075434_100194805 3300006871 Bacteria 2046
111 Ga0075429_100005572 3300006880 Bacteria 10849
112 Ga0075429_100015625 3300006880 Bacteria 6578
113 Ga0075429_100241639 3300006880 Unclassified 1582
114 Ga0075429_100463580 3300006880 Bacteria 1110
115 Ga0068865_100057225 3300006881 Bacteria 2719
116 Ga0075436_100080748 3300006914 Bacteria 2253
117 Ga0097620_100010533 3300006931 Bacteria 9306
118 Ga0097620_100154240 3300006931 Bacteria 2373
119 Ga0097620_100171755 3300006931 Bacteria 2249
120 Ga0075435_100038551 3300007076 Bacteria 3810
121 Ga0075435_100042019 3300007076 Bacteria 3656
122 Ga0075435_100135009 3300007076 Bacteria 2066
123 Ga0075435_100293111 3300007076 Bacteria 1391
124 Ga0075435_100424837 3300007076 Bacteria 1145
125 Ga0099794_10000256 3300007265 Bacteria 18535
126 Ga0099794_10000489 3300007265 Bacteria 13266
127 Ga0105240_10065459 3300009093 Bacteria 4512
128 Ga0111539_10001624 3300009094 Bacteria 30047
129 Ga0111539_10002856 3300009094 Bacteria 22943
130 Ga0111539_10439755 3300009094 Bacteria 1519
131 Ga0111539_10465969 3300009094 Bacteria 1471
132 Ga0114129_10001708 3300009147 Bacteria 29965
133 Ga0114129_10025346 3300009147 Bacteria 8403
134 Ga0114129_10030019 3300009147 Bacteria 7697
135 Ga0114129_10064194 3300009147 Bacteria 5124
136 Ga0114129_10095730 3300009147 Unclassified 4112
137 Ga0114129_10138232 3300009147 Bacteria 3342
138 Ga0105243_10513655 3300009148 Unclassified 1138
139 Ga0105241_10002590 3300009174 Bacteria 13561
140 Ga0105241_10021356 3300009174 Bacteria 4786
141 Ga0105242_10099325 3300009176 Bacteria 2464
142 Ga0105242_10131140 3300009176 Bacteria 2164
143 Ga0105248_10128733 3300009177 Bacteria 2856
144 Ga0105237_10138134 3300009545 Bacteria 2432
145 Ga0105249_10009950 3300009553 Bacteria 8343
146 Ga0105249_10126867 3300009553 Bacteria 2431
147 Ga0105246_10034023 3300011119 Bacteria 3391
148 Ga0157373_10003098 3300013100 Bacteria 12563
149 Ga0157371_10078330 3300013102 Bacteria 2341
150 Ga0157369_10036193 3300013105 Bacteria 5410
151 Ga0163162_10159491 3300013306 Bacteria 2377
152 Ga0163162_10615459 3300013306 Bacteria 1211
153 Ga0157372_10000270 3300013307 Bacteria 57505
154 Ga0157375_10158936 3300013308 Bacteria 2401
155 Ga0157380_10746807 3300014326 Unclassified 989
156 Ga0182007_10014407 3300015262 Unclassified 2982
157 Ga0163161_10155138 3300017792 Unclassified 1743
158 Ga0207653_10003998 3300025885 Bacteria 4638
159 Ga0207642_10034559 3300025899 Bacteria 2151
160 Ga0207688_10003951 3300025901 Bacteria 8086
161 Ga0207680_10040124 3300025903 Bacteria 2722
162 Ga0207647_10045495 3300025904 Bacteria 2738
163 Ga0207643_10000017 3300025908 Bacteria 114659
164 Ga0207684_10001418 3300025910 Bacteria 25959
165 Ga0207684_10016060 3300025910 Bacteria 6429
166 Ga0207684_10170154 3300025910 Unclassified 1878
167 Ga0207684_10308413 3300025910 Bacteria 1364
168 Ga0207654_10002534 3300025911 Bacteria 9274
169 Ga0207654_10030592 3300025911 Bacteria 2957
170 Ga0207707_10000808 3300025912 Bacteria 30642
171 Ga0207695_10074646 3300025913 Bacteria 3452
172 Ga0207660_10001516 3300025917 Bacteria 15617
173 Ga0207657_10000929 3300025919 Bacteria 30994
174 Ga0207649_10001632 3300025920 Bacteria 13026
175 Ga0207652_10001962 3300025921 Bacteria 17791
176 Ga0207646_10007716 3300025922 Bacteria 10892
177 Ga0207646_10033558 3300025922 Bacteria 4643
178 Ga0207646_10072994 3300025922 Bacteria 3065
179 Ga0207646_10083506 3300025922 Bacteria 2857
180 Ga0207646_10133345 3300025922 Bacteria 2236
181 Ga0207646_10570865 3300025922 Bacteria 1016
182 Ga0207646_10587106 3300025922 Unclassified 1000
183 Ga0207646_10677665 3300025922 Bacteria 923
184 Ga0207650_10077655 3300025925 Bacteria 2511
185 Ga0207690_10006225 3300025932 Bacteria 7066
186 Ga0207706_10003342 3300025933 Bacteria 15342
187 Ga0207686_10086106 3300025934 Bacteria 2063
188 Ga0207686_10214008 3300025934 Bacteria 1387
189 Ga0207670_10011937 3300025936 Bacteria 5060
190 Ga0207670_10096973 3300025936 Unclassified 2098
191 Ga0207691_10064137 3300025940 Bacteria 3329
192 Ga0207691_10074712 3300025940 Bacteria 3057
193 Ga0207711_10157965 3300025941 Bacteria 2050
194 Ga0207689_10000021 3300025942 Bacteria 110537
195 Ga0207689_10013255 3300025942 Bacteria 7032
196 Ga0207689_10138754 3300025942 Bacteria 2003
197 Ga0207679_10000336 3300025945 Bacteria 34925
198 Ga0207667_10005451 3300025949 Bacteria 15508
199 Ga0207712_10006717 3300025961 Bacteria 7256
200 Ga0207640_10001810 3300025981 Bacteria 11473
201 Ga0207703_10037822 3300026035 Bacteria 3847
202 Ga0207639_10063258 3300026041 Bacteria 2864
203 Ga0207678_10005840 3300026067 Bacteria 10973
204 Ga0207708_10122033 3300026075 Bacteria 2031
205 Ga0207708_10334656 3300026075 Unclassified 1238
206 Ga0207702_10017191 3300026078 Bacteria 5984
207 Ga0207641_10077494 3300026088 Bacteria 2877
208 Ga0207641_10089275 3300026088 Bacteria 2693
209 Ga0207648_10010654 3300026089 Bacteria 8691
210 Ga0207648_10111392 3300026089 Bacteria 2403
211 Ga0207676_10104148 3300026095 Bacteria 2359
212 Ga0207674_10001479 3300026116 Bacteria 30347
213 Ga0207675_100012193 3300026118 Bacteria 8029
214 Ga0207675_100053315 3300026118 Bacteria 3774
215 Ga0207675_100085687 3300026118 Bacteria 2957
216 Ga0207698_10035513 3300026142 Bacteria 3648
217 Ga0209982_1015400 3300027552 Bacteria 1160
218 Ga0207428_10000340 3300027907 Bacteria 60713
219 Ga0207428_10136920 3300027907 Bacteria 1872
220 Ga0268265_10005736 3300028380 Bacteria 8478
221 Ga0268265_10034781 3300028380 Bacteria 3676
222 Ga0268264_10005560 3300028381 Bacteria 10674
223 Ga0268264_10200717 3300028381 Bacteria 1824
224 Ga0307408_100120690 3300031548 Bacteria 2030
225 Ga0307408_100154530 3300031548 Bacteria 1815
226 Ga0307413_10112572 3300031824 Bacteria 1825
227 Ga0307409_100127976 3300031995 Bacteria 2164
228 Ga0307416_100019317 3300032002 Bacteria 4828
229 Ga0373959_0010015 3300034820 Bacteria 1649
230 Ga0373932_0103100 3300035112 Bacteria 931
231 Ga0373931_0003124 3300035691 Bacteria 7398
232 Ga0373931_0012710 3300035691 Bacteria 4085
233 Ga0373931_0082899 3300035691 Bacteria 1773
234 Ga0395899_0081260 3300037312 Bacteria 2358
235 Ga0395900_0008974 3300037418 Bacteria 10253
236 Ga0395898_0011153 3300037466 Bacteria 9357
237 Ga0395901_0001179 3300038443 Bacteria 27782
238 Ga0450903_000394 3300042138 Bacteria 9390
239 Ga0450903_010990 3300042138 Bacteria 1461
240 Ga0439458_0007514 3300042157 Bacteria 2427
241 Ga0439459_0003804 3300042438 Bacteria 2413
242 Ga0451577_0011834 3300042876 Bacteria 8230
243 Ga0451577_0085255 3300042876 Bacteria 2818
244 Ga0451577_0112474 3300042876 Bacteria 2437
245 Ga0453684_0042710 3300044712 Bacteria 6108
246 Ga0453684_0711153 3300044712 Bacteria 1091
247 Ga0466970_0009232 3300044765 Bacteria 4977
248 Ga0451576_0022626 3300045051 Bacteria 6812
249 Ga0451576_0049265 3300045051 Bacteria 4421
250 Ga0451576_0344386 3300045051 Bacteria 1560
251 Ga0451576_0360927 3300045051 Bacteria 1521
252 Ga0495603_0193765 3300046455 Bacteria 1175
253 Ga0495580_0002425 3300046472 Bacteria 16291
254 Ga0495594_0123069 3300046499 Bacteria 1467
255 Ga0495659_0096475 3300046664 Bacteria 1141
256 Ga0495669_0116878 3300046684 Bacteria 1248
257 Ga0496102_0015393 3300048905 Bacteria 6662
258 Ga0496102_0541787 3300048905 Bacteria 1086
259 Ga0496103_0230454 3300048906 Bacteria 1191
260 Ga0496106_0038039 3300048909 Bacteria 3600
261 Ga0496106_0064201 3300048909 Bacteria 2793
262 Ga0496108_0202485 3300048911 Bacteria 1723
263 Ga0501032_0034198 3300049569 Bacteria 3481
264 Ga0501034_0347676 3300049571 Bacteria 1411
265 Ga0501036_0577175 3300049572 Bacteria 934
266 Ga0501039_0055713 3300049575 Bacteria 3063
267 Ga0501040_0180796 3300049576 Unclassified 1495
268 Ga0501040_0241955 3300049576 Bacteria 1286
269 Ga0501041_0014759 3300049577 Bacteria 4638
270 Ga0501041_0105552 3300049577 Bacteria 1746
271 Ga0501041_0346697 3300049577 Bacteria 938
272 Ga0501042_0096491 3300049578 Bacteria 2124
273 Ga0501042_0341850 3300049578 Bacteria 1082
274 Ga0501043_0398102 3300049579 Bacteria 1041
275 Ga0501048_0439944 3300049582 Unclassified 933
276 Ga0501048_0478767 3300049582 Bacteria 892
277 Ga0501068_0326914 3300049584 Unclassified 983
278 Ga0501072_0061151 3300049588 Bacteria 2970
279 Ga0501072_0112126 3300049588 Bacteria 2171
280 Ga0501072_0115105 3300049588 Unclassified 2141
281 Ga0501072_0200260 3300049588 Unclassified 1592
282 Ga0501074_0456269 3300049590 Bacteria 906
283 Ga0501075_0067065 3300049591 Bacteria 2709
284 Ga0501075_0078175 3300049591 Unclassified 2504
285 Ga0501075_0172258 3300049591 Bacteria 1652
286 Ga0501076_0081768 3300049592 Bacteria 2593
287 Ga0501076_0107048 3300049592 Bacteria 2257
288 Ga0501076_0158529 3300049592 Unclassified 1843
289 Ga0501076_0343224 3300049592 Bacteria 1226
290 Ga0501077_0021205 3300049593 Bacteria 4112
291 Ga0501077_0061978 3300049593 Bacteria 2373
292 Ga0501079_0081289 3300049741 Bacteria 2505
293 Ga0501080_0108045 3300049742 Bacteria 2579
294 Ga0501081_0005389 3300049743 Bacteria 8254
295 Ga0501081_0100625 3300049743 Bacteria 2043
296 Ga0501081_0380340 3300049743 Bacteria 1043
297 Ga0501035_0348824 3300049822 Bacteria 1239
298 Ga0501044_0096931 3300049823 Bacteria 2970
299 nmdc:mga05p37_10416_c1 3300050507 Bacteria 11034
300 nmdc:mga05p37_212845_c1 3300050507 Bacteria 2336
301 nmdc:mga05p37_55113_c3 3300050507 Unclassified 3957
302 nmdc:mga05p37_806018_c1 3300050507 Unclassified 1027
303 nmdc:mga09592_289455_c1 3300050508 Bacteria 1420
304 nmdc:mga09592_29410_c1 3300050508 Bacteria 4570
305 nmdc:mga09592_4227_c1 3300050508 Bacteria 11595
306 nmdc:mga0qj67_11056_c1 3300050509 Bacteria 6758
307 nmdc:mga0qj67_384_c1 3300050509 Bacteria 30480
308 nmdc:mga0qj67_81673_c1 3300050509 Bacteria 2592
309 nmdc:mga06r32_1016_c1 3300050510 Bacteria 25205
310 nmdc:mga06r32_16821_c1 3300050510 Bacteria 6669
311 nmdc:mga06r32_225048_c1 3300050510 Bacteria 1864
312 nmdc:mga06r32_421704_c1 3300050510 Unclassified 1315
313 nmdc:mga06r32_4336_c1 3300050510 Bacteria 12703
314 nmdc:mga06r32_511621_c1 3300050510 Unclassified 1177
315 nmdc:mga08y16_22166_c1 3300050511 Bacteria 6705
316 nmdc:mga08y16_662922_c1 3300050511 Unclassified 1046
317 nmdc:mga08y16_7328_c1 3300050511 Bacteria 11575
318 nmdc:mga0n895_119216_c1 3300050512 Bacteria 2660
319 nmdc:mga0n895_14175_c1 3300050512 Bacteria 7229
320 nmdc:mga0n895_48183_c1 3300050512 Bacteria 4170
321 nmdc:mga0n895_59080_c1 3300050512 Bacteria 3784
322 nmdc:mga0rr50_12795_c1 3300050513 Bacteria 5437
323 nmdc:mga0rr50_160796_c1 3300050513 Bacteria 1823
324 nmdc:mga0rr50_310915_c1 3300050513 Bacteria 1320
325 nmdc:mga0rr50_37354_c1 3300050513 Bacteria 3505
326 nmdc:mga0rr50_57564_c1 3300050513 Bacteria 2908
327 nmdc:mga0rr50_59390_c1 3300050513 Bacteria 2871
328 nmdc:mga08x19_11352_c1 3300050514 Bacteria 5362
329 nmdc:mga0a205_17626_c1 3300050515 Bacteria 6701
330 nmdc:mga0a205_1983_c1 3300050515 Bacteria 17834
331 nmdc:mga0a205_30748_c1 3300050515 Bacteria 5143
332 nmdc:mga0a205_36865_c1 3300050515 Bacteria 4701
333 nmdc:mga0a205_431559_c1 3300050515 Bacteria 1179
334 nmdc:mga0a205_80134_c1 3300050515 Unclassified 3155
335 Ga0501084_0316834 3300054114 Unclassified 1317
336 Ga0501084_0463464 3300054114 Bacteria 1071
337 Ga0501082_0140568 3300060353 Bacteria 2095
338 Ga0530510_0043551 3300061734 Bacteria 3242
339 Ga0530510_0068343 3300061734 Bacteria 2577
340 Ga0530510_0100255 3300061734 Bacteria 2117
341 Ga0530510_0426139 3300061734 Bacteria 1002
342 2784586863 2784132148 Bacteria 8627943
343 2808918523 2808606375 Bacteria 9466072
344 2862385041 2862382967 Bacteria 10317375
345 2912722278 2912715099 Bacteria 9460473
346 2912725979 2912723979 Bacteria 8557534
347 8008561444 8008558824 Bacteria 10610750
348 Ga0501040_0157000
349 Ga0070683_100025370
350 Ga0070690_100297558
351 Ga0070690_100326935
352 Ga0070670_100003608
353 Ga0068869_100001934
354 Ga0068869_100002695
355 Ga0068869_100059888
356 Ga0070680_100003291
357 Ga0070682_100000155
358 Ga0070660_100000413
359 Ga0070689_100066561
360 Ga0070691_10025409
361 Ga0070661_100000295
362 Ga0070692_10000129
363 Ga0070669_100188534
364 Ga0070675_100114323
365 Ga0070659_100001038
366 Ga0070703_10006712
367 Ga0070703_10030931
368 Ga0070705_100001014
369 Ga0070705_100048634
370 Ga0070700_100112207
371 Ga0070694_100000027
372 Ga0070694_100218309
373 Ga0070708_100018846
374 Ga0070708_100034693
375 Ga0070708_100178361
376 Ga0070663_100040992
377 Ga0070662_100000730
378 Ga0070681_10021012
379 Ga0068867_100006054
380 Ga0070706_100146729
381 Ga0070706_100183286
382 Ga0070706_100319660
383 Ga0070706_100378011
384 Ga0070707_100033458
385 Ga0070707_100033876
386 Ga0070707_100085657
387 Ga0070707_100091405
388 Ga0070707_100112961
389 Ga0070707_100118384
390 Ga0070698_100041363
391 Ga0070698_100188535
392 Ga0070699_100004242
393 Ga0070699_100053460
394 Ga0070699_100322790
395 Ga0070679_100017240
396 Ga0070697_100159801
397 Ga0070697_100244098
398 Ga0070697_100465503
399 Ga0068853_100003096
400 Ga0070672_100040719
401 Ga0070672_100193709
402 Ga0070695_100002075
403 Ga0070695_100022330
404 Ga0070696_100001392
405 Ga0070696_100020510
406 Ga0070696_100039816
407 Ga0070696_100305281
408 Ga0070693_100000299
409 Ga0070704_100003220
410 Ga0068855_100002347
411 Ga0070664_100036983
412 Ga0068857_100034171
413 Ga0068854_100014166
414 Ga0068856_100041756
415 Ga0070702_100095878
416 Ga0068852_100028782
417 Ga0068859_100010533
418 Ga0068859_100154234
419 Ga0068859_100171761
420 Ga0068864_100087113
421 Ga0068866_10030072
422 Ga0068861_100010518
423 Ga0068861_100176304
424 Ga0068870_10009102
425 Ga0068863_100101582
426 Ga0068863_100129337
427 Ga0068863_100146703
428 Ga0068858_100024729
429 Ga0068860_100011411
430 Ga0068860_100081412
431 Ga0068862_100018213
432 Ga0068862_100023225
433 Ga0068862_100052398
434 Ga0068862_100081955
435 Ga0068862_100564812
436 Ga0070717_10323612
437 Ga0075432_10038894
438 Ga0075428_100001426
439 Ga0075428_100001646
440 Ga0075428_100042735
441 Ga0075428_100070391
442 Ga0075430_100000068
443 Ga0075430_100001067
444 Ga0075431_100000238
445 Ga0075431_100001186
446 Ga0075431_100036911
447 Ga0075431_100226907
448 Ga0075431_100311888
449 Ga0075433_10000659
450 Ga0075433_10020922
451 Ga0075433_10115834
452 Ga0075433_10406457
453 Ga0075433_10425432
454 Ga0075434_100001544
455 Ga0075434_100004630
456 Ga0075434_100068788
457 Ga0075434_100194805
458 Ga0075429_100005572
459 Ga0075429_100015625
460 Ga0075429_100241639
461 Ga0075429_100463580
462 Ga0068865_100057225
463 Ga0075436_100080748
464 Ga0097620_100010533
465 Ga0097620_100154240
466 Ga0097620_100171755
467 Ga0075435_100038551
468 Ga0075435_100042019
469 Ga0075435_100135009
470 Ga0075435_100293111
471 Ga0075435_100424837
472 Ga0099794_10000256
473 Ga0099794_10000489
474 Ga0105240_10065459
475 Ga0111539_10001624
476 Ga0111539_10002856
477 Ga0111539_10439755
478 Ga0111539_10465969
479 Ga0114129_10001708
480 Ga0114129_10025346
481 Ga0114129_10030019
482 Ga0114129_10064194
483 Ga0114129_10095730
484 Ga0114129_10138232
485 Ga0105243_10513655
486 Ga0105241_10002590
487 Ga0105241_10021356
488 Ga0105242_10099325
489 Ga0105242_10131140
490 Ga0105248_10128733
491 Ga0105237_10138134
492 Ga0105249_10009950
493 Ga0105249_10126867
494 Ga0105246_10034023
495 Ga0157373_10003098
496 Ga0157371_10078330
497 Ga0157369_10036193
498 Ga0163162_10159491
499 Ga0163162_10615459
500 Ga0157372_10000270
501 Ga0157375_10158936
502 Ga0157380_10746807
503 Ga0182007_10014407
504 Ga0163161_10155138
505 Ga0207653_10003998
506 Ga0207642_10034559
507 Ga0207688_10003951
508 Ga0207680_10040124
509 Ga0207647_10045495
510 Ga0207643_10000017
511 Ga0207684_10001418
512 Ga0207684_10016060
513 Ga0207684_10170154
514 Ga0207684_10308413
515 Ga0207654_10002534
516 Ga0207654_10030592
517 Ga0207707_10000808
518 Ga0207695_10074646
519 Ga0207660_10001516
520 Ga0207657_10000929
521 Ga0207649_10001632
522 Ga0207652_10001962
523 Ga0207646_10007716
524 Ga0207646_10033558
525 Ga0207646_10072994
526 Ga0207646_10083506
527 Ga0207646_10133345
528 Ga0207646_10570865
529 Ga0207646_10587106
530 Ga0207646_10677665
531 Ga0207650_10077655
532 Ga0207690_10006225
533 Ga0207706_10003342
534 Ga0207686_10086106
535 Ga0207686_10214008
536 Ga0207670_10011937
537 Ga0207670_10096973
538 Ga0207691_10064137
539 Ga0207691_10074712
540 Ga0207711_10157965
541 Ga0207689_10000021
542 Ga0207689_10013255
543 Ga0207689_10138754
544 Ga0207679_10000336
545 Ga0207667_10005451
546 Ga0207712_10006717
547 Ga0207640_10001810
548 Ga0207703_10037822
549 Ga0207639_10063258
550 Ga0207678_10005840
551 Ga0207708_10122033
552 Ga0207708_10334656
553 Ga0207702_10017191
554 Ga0207641_10077494
555 Ga0207641_10089275
556 Ga0207648_10010654
557 Ga0207648_10111392
558 Ga0207676_10104148
559 Ga0207674_10001479
560 Ga0207675_100012193
561 Ga0207675_100053315
562 Ga0207675_100085687
563 Ga0207698_10035513
564 Ga0209982_1015400
565 Ga0207428_10000340
566 Ga0207428_10136920
567 Ga0268265_10005736
568 Ga0268265_10034781
569 Ga0268264_10005560
570 Ga0268264_10200717
571 Ga0307408_100120690
572 Ga0307408_100154530
573 Ga0307413_10112572
574 Ga0307409_100127976
575 Ga0307416_100019317
576 Ga0373959_0010015
577 Ga0373932_0103100
578 Ga0373931_0003124
579 Ga0373931_0012710
580 Ga0373931_0082899
581 Ga0395899_0081260
582 Ga0395900_0008974
583 Ga0395898_0011153
584 Ga0395901_0001179
585 Ga0450903_000394
586 Ga0450903_010990
587 Ga0439458_0007514
588 Ga0439459_0003804
589 Ga0451577_0011834
590 Ga0451577_0085255
591 Ga0451577_0112474
592 Ga0453684_0042710
593 Ga0453684_0711153
594 Ga0466970_0009232
595 Ga0451576_0022626
596 Ga0451576_0049265
597 Ga0451576_0344386
598 Ga0451576_0360927
599 Ga0495603_0193765
600 Ga0495580_0002425
601 Ga0495594_0123069
602 Ga0495659_0096475
603 Ga0495669_0116878
604 Ga0496102_0015393
605 Ga0496102_0541787
606 Ga0496103_0230454
607 Ga0496106_0038039
608 Ga0496106_0064201
609 Ga0496108_0202485
610 Ga0501032_0034198
611 Ga0501034_0347676
612 Ga0501036_0577175
613 Ga0501039_0055713
614 Ga0501040_0180796
615 Ga0501040_0241955
616 Ga0501041_0014759
617 Ga0501041_0105552
618 Ga0501041_0346697
619 Ga0501042_0096491
620 Ga0501042_0341850
621 Ga0501043_0398102
622 Ga0501048_0439944
623 Ga0501048_0478767
624 Ga0501068_0326914
625 Ga0501072_0061151
626 Ga0501072_0112126
627 Ga0501072_0115105
628 Ga0501072_0200260
629 Ga0501074_0456269
630 Ga0501075_0067065
631 Ga0501075_0078175
632 Ga0501075_0172258
633 Ga0501076_0081768
634 Ga0501076_0107048
635 Ga0501076_0158529
636 Ga0501076_0343224
637 Ga0501077_0021205
638 Ga0501077_0061978
639 Ga0501079_0081289
640 Ga0501080_0108045
641 Ga0501081_0005389
642 Ga0501081_0100625
643 Ga0501081_0380340
644 Ga0501035_0348824
645 Ga0501044_0096931
646 nmdc:mga05p37_10416_c1
647 nmdc:mga05p37_212845_c1
648 nmdc:mga05p37_55113_c3
649 nmdc:mga05p37_806018_c1
650 nmdc:mga09592_289455_c1
651 nmdc:mga09592_29410_c1
652 nmdc:mga09592_4227_c1
653 nmdc:mga0qj67_11056_c1
654 nmdc:mga0qj67_384_c1
655 nmdc:mga0qj67_81673_c1
656 nmdc:mga06r32_1016_c1
657 nmdc:mga06r32_16821_c1
658 nmdc:mga06r32_225048_c1
659 nmdc:mga06r32_421704_c1
660 nmdc:mga06r32_4336_c1
661 nmdc:mga06r32_511621_c1
662 nmdc:mga08y16_22166_c1
663 nmdc:mga08y16_662922_c1
664 nmdc:mga08y16_7328_c1
665 nmdc:mga0n895_119216_c1
666 nmdc:mga0n895_14175_c1
667 nmdc:mga0n895_48183_c1
668 nmdc:mga0n895_59080_c1
669 nmdc:mga0rr50_12795_c1
670 nmdc:mga0rr50_160796_c1
671 nmdc:mga0rr50_310915_c1
672 nmdc:mga0rr50_37354_c1
673 nmdc:mga0rr50_57564_c1
674 nmdc:mga0rr50_59390_c1
675 nmdc:mga08x19_11352_c1
676 nmdc:mga0a205_17626_c1
677 nmdc:mga0a205_1983_c1
678 nmdc:mga0a205_30748_c1
679 nmdc:mga0a205_36865_c1
680 nmdc:mga0a205_431559_c1
681 nmdc:mga0a205_80134_c1
682 Ga0501084_0316834
683 Ga0501084_0463464
684 Ga0501082_0140568
685 Ga0530510_0043551
686 Ga0530510_0068343
687 Ga0530510_0100255
688 Ga0530510_0426139
689 2784586863
690 2808918523
691 2862385041
692 2912722278
693 2912725979
694 8008561444

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01497

Peripla_BP_2

Periplasmic binding protein

21

248

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m3b-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli 0.9226 3 250
5m34-assembly2.cif.gz_B structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.9185 1 250
5m34-assembly1.cif.gz_A structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli 0.918 3 250
1n4d-assembly2.cif.gz_B the ligand-free structure of e coli btuf, the periplasmic binding protein for vitamin b12 0.9144 3 253
5m29-assembly2.cif.gz_B structure of cobinamide-bound btuf, the periplasmic vitamin b12 binding protein in e.coli 0.9141 3 250
ID Description Score Start End Superfamily
2r79A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9267 3 119 3.40.50.1980
af_Q2G0F6_19_140_3.40.50.1980 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9184 4 121 3.40.50.1980
5gj1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9151 3 121 3.40.50.1980
5y8bA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9132 3 121 3.40.50.1980
2rg7D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9079 3 121 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A1Q7PIG4-F1-model_v4 Fe/B12 periplasmic-binding domain-containing protein 0.9919 2 252
AF-A0A1F4QTD2-F1-model_v4 Fe/B12 periplasmic-binding domain-containing protein 0.9914 1 252
AF-A0A2V6QCN7-F1-model_v4 ABC transporter substrate-binding protein 0.9909 1 251
AF-A0A7C2EUY7-F1-model_v4 Cobalamin-binding protein 0.9904 1 254
AF-A0A2V6PTJ5-F1-model_v4 Fe/B12 periplasmic-binding domain-containing protein 0.9894 2 180

Map