F417294

General Info

Members Datasets Scaffolds Average Seq Length
347 227 694 173

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0291391|Ga0501031_0291391_300_812
Length 170
Sequence MEAPAAPHNPVETELTVTSPEQMRDLGRRLAKLLCAGDLVMLNGELGAGKTTLTRGLGEGLGVRGAVTSPTFVIARVHPSLGDGPPLVHVDAYRLSGGLDEMEDLDLDVSLPDSVIVVEWGEGKVEELTEDRLNVVIHRAVGDTTDEVRHVTVTGLGERWATVDLSVLTA

Samples

Sample ID Description Type Environment
1 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
19 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
20 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
23 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
30 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
41 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
42 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
46 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
47 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
48 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
49 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
50 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
51 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
52 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
55 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
58 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
59 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
60 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
61 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
62 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
63 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
64 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
65 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
66 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
69 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
86 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
101 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
109 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
110 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
119 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
120 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
131 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
136 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
137 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
138 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
177 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
178 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
179 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
180 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
181 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
182 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
183 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
188 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
189 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
190 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
191 2643221647 Streptomyces sp. Root369 Isolate Unclassified
192 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
193 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
194 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
195 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
196 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
197 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
198 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
199 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
200 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
201 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
202 2867428634 Streptomyces sp. RP5T Isolate Unclassified
203 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
204 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
205 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
206 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
207 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
208 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
209 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
210 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
211 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
212 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
213 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
214 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
215 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
216 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
217 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
218 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
219 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
220 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
221 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
222 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
223 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
224 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
225 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
226 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
227 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.61
Metatranscriptomes 0.58
Isolates 11.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.76
Nodule 0.29
Rhizoplane 2.31
Rhizosphere 79.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501031_0291391 3300049568 Bacteria 1058
2 JGI24739J22299_10035760 3300001989 Bacteria 1681
3 rootH2_10002475 3300003320 Bacteria 14776
4 rootL2_10016940 3300003322 Bacteria 9794
5 rootH1_10021004 3300003323 Bacteria 3439
6 JGI25160J50197_1009380 3300003354 Bacteria 3634
7 Ga0006562J51391_1042200 3300003578 Bacteria 5920
8 Ga0006562J51391_1042201 3300003578 Bacteria 884
9 Ga0070665_100170290 3300005548 Bacteria 2179
10 Ga0068852_100746537 3300005616 Bacteria 991
11 Ga0081455_10050740 3300005937 Bacteria 3564
12 Ga0075368_10000496 3300006042 Bacteria 11661
13 Ga0075367_10000729 3300006178 Bacteria 12780
14 Ga0105244_10124806 3300009036 Bacteria 1245
15 Ga0105245_10114355 3300009098 Bacteria 2513
16 Ga0105243_10047247 3300009148 Bacteria 3388
17 Ga0105238_10620989 3300009551 Bacteria 1089
18 Ga0105246_10073716 3300011119 Bacteria 2411
19 Ga0105246_10419440 3300011119 Bacteria 1116
20 Ga0157369_10043199 3300013105 Bacteria 4914
21 Ga0157375_10439612 3300013308 Bacteria 1470
22 Ga0182008_10000155 3300014497 Bacteria 54054
23 Ga0182007_10000136 3300015262 Bacteria 51316
24 Ga0182005_1009588 3300015265 Bacteria 2810
25 Ga0183367_1002 3300015688 Bacteria 1101531
26 Ga0207426_1002066 3300025302 Bacteria 13951
27 Ga0207426_1017847 3300025302 Bacteria 2513
28 Ga0207426_1028246 3300025302 Bacteria 1861
29 Ga0207647_10021481 3300025904 Bacteria 4308
30 Ga0207687_10081260 3300025927 Bacteria 2342
31 Ga0207691_10232771 3300025940 Bacteria 1595
32 Ga0207702_10263980 3300026078 Bacteria 1622
33 Ga0209813_10000474 3300027866 Bacteria 9626
34 Ga0268266_10137864 3300028379 Bacteria 2187
35 Ga0307515_10003019 3300028794 Bacteria 35727
36 Ga0268256_1034615 3300030500 Bacteria 1182
37 Ga0307512_10050247 3300030522 Bacteria 3351
38 Ga0307509_10027881 3300031507 Bacteria 6281
39 Ga0307508_10001583 3300031616 Bacteria 25403
40 Ga0307508_10059114 3300031616 Bacteria 3391
41 Ga0307514_10001786 3300031649 Bacteria 24306
42 Ga0307514_10048392 3300031649 Bacteria 3312
43 Ga0307516_10002850 3300031730 Bacteria 22777
44 Ga0307516_10150756 3300031730 Bacteria 2086
45 Ga0307516_10423028 3300031730 Bacteria 990
46 Ga0307416_100778771 3300032002 Bacteria 1051
47 Ga0307507_10016774 3300033179 Bacteria 8484
48 Ga0307507_10087120 3300033179 Bacteria 2702
49 Ga0307507_10105286 3300033179 Bacteria 2336
50 Ga0307510_10040055 3300033180 Bacteria 5150
51 Ga0307510_10049903 3300033180 Bacteria 4446
52 Ga0307510_10071835 3300033180 Bacteria 3442
53 Ga0395898_0002829 3300037466 Bacteria 19865
54 Ga0395898_0020144 3300037466 Bacteria 6776
55 Ga0395905_0866636 3300037471 Bacteria 806
56 Ga0436364_0550851 3300037853 Bacteria 13047
57 Ga0395901_0195109 3300038443 Bacteria 2123
58 Ga0439436_0023332 3300041404 Bacteria 1830
59 Ga0439439_0003136 3300041406 Bacteria 3612
60 Ga0451793_0599579 3300041452 Bacteria 593
61 Ga0451795_1122508 3300041456 Bacteria 649
62 Ga0451835_0677758 3300041492 Bacteria 884
63 Ga0451845_0136970 3300041501 Bacteria 1297
64 Ga0451843_0859934 3300041509 Bacteria 658
65 Ga0451855_0349275 3300041511 Bacteria 854
66 Ga0451853_1042094 3300041512 Bacteria 1657
67 Ga0451853_1073691 3300041512 Bacteria 1808
68 Ga0439433_0003340 3300041999 Bacteria 3438
69 Ga0439442_010786 3300042002 Bacteria 1856
70 Ga0439442_014082 3300042002 Bacteria 1645
71 Ga0439449_0008446 3300042007 Bacteria 3914
72 Ga0439449_0010381 3300042007 Bacteria 3516
73 Ga0439455_0017047 3300042012 Bacteria 1687
74 Ga0439457_000871 3300042014 Bacteria 9119
75 Ga0439457_003692 3300042014 Bacteria 4128
76 Ga0439462_0001654 3300042015 Bacteria 5014
77 Ga0450898_020969 3300042134 Bacteria 1148
78 Ga0450902_016159 3300042137 Bacteria 1215
79 Ga0450903_000180 3300042138 Bacteria 13908
80 Ga0439458_0003242 3300042157 Bacteria 3847
81 Ga0466969_0007945 3300044656 Bacteria 5631
82 Ga0466972_0020641 3300044658 Bacteria 3291
83 Ga0466965_0122293 3300044683 Bacteria 1345
84 Ga0466966_0053273 3300044684 Bacteria 2567
85 Ga0466961_0130776 3300044693 Bacteria 1573
86 Ga0466961_0135562 3300044693 Bacteria 1542
87 Ga0466961_0453155 3300044693 Bacteria 776
88 Ga0466961_0632445 3300044693 Bacteria 643
89 Ga0466963_0007112 3300044694 Bacteria 6667
90 Ga0466963_0031203 3300044694 Bacteria 3443
91 Ga0466971_0148776 3300044719 Bacteria 1092
92 Ga0466970_0079789 3300044765 Bacteria 1767
93 Ga0466957_0679113 3300044842 Bacteria 726
94 Ga0466960_0077663 3300044901 Bacteria 1666
95 Ga0466959_0008345 3300045049 Bacteria 7318
96 Ga0466967_0327751 3300045976 Bacteria 1478
97 Ga0495627_004508 3300046453 Bacteria 5809
98 Ga0495592_0001470 3300046454 Bacteria 16388
99 Ga0495592_0008357 3300046454 Bacteria 7763
100 Ga0495603_0004232 3300046455 Bacteria 8544
101 Ga0495629_0016968 3300046459 Bacteria 5224
102 Ga0495629_0063929 3300046459 Bacteria 2569
103 Ga0495638_0021848 3300046460 Bacteria 4206
104 Ga0495651_0027073 3300046462 Bacteria 4465
105 Ga0495651_0030853 3300046462 Bacteria 4179
106 Ga0495653_0276305 3300046463 Bacteria 1104
107 Ga0495653_0390688 3300046463 Bacteria 886
108 Ga0495580_0054477 3300046472 Bacteria 2821
109 Ga0495582_0027238 3300046473 Bacteria 3132
110 Ga0495639_0006014 3300046475 Bacteria 5219
111 Ga0495662_0000390 3300046476 Bacteria 19590
112 Ga0495662_0005541 3300046476 Bacteria 6312
113 Ga0495662_0031989 3300046476 Bacteria 2541
114 Ga0495662_0037333 3300046476 Bacteria 2346
115 Ga0495664_0000628 3300046477 Bacteria 17935
116 Ga0495664_0005335 3300046477 Bacteria 7054
117 Ga0495585_0115706 3300046492 Bacteria 1422
118 Ga0495594_0112372 3300046499 Bacteria 1536
119 Ga0495608_0000434 3300046511 Bacteria 29162
120 Ga0495618_0001915 3300046514 Bacteria 13672
121 Ga0495618_0429551 3300046514 Bacteria 804
122 Ga0495620_0148795 3300046515 Bacteria 913
123 Ga0495628_0002756 3300046516 Bacteria 15728
124 Ga0495628_0218837 3300046516 Bacteria 1430
125 Ga0495630_0142382 3300046517 Bacteria 1823
126 Ga0495632_0451121 3300046519 Bacteria 558
127 Ga0495644_0256672 3300046523 Bacteria 679
128 Ga0495666_0278582 3300046526 Bacteria 758
129 Ga0495652_0037013 3300046529 Bacteria 4237
130 Ga0495652_0048274 3300046529 Bacteria 3648
131 Ga0495665_0001097 3300046531 Bacteria 14293
132 Ga0495640_0004629 3300046533 Bacteria 10974
133 Ga0495640_0010427 3300046533 Bacteria 7184
134 Ga0495640_0139910 3300046533 Bacteria 1561
135 Ga0495586_0175773 3300046535 Bacteria 1210
136 Ga0495587_0004249 3300046536 Bacteria 9470
137 Ga0495645_0009455 3300046543 Bacteria 6807
138 Ga0495645_0011788 3300046543 Bacteria 6159
139 Ga0495645_0060718 3300046543 Bacteria 2740
140 Ga0495622_0040784 3300046557 Bacteria 2159
141 Ga0495622_0071169 3300046557 Bacteria 1605
142 Ga0495633_0046021 3300046558 Bacteria 2065
143 Ga0495667_0051172 3300046559 Bacteria 2725
144 Ga0495634_0001232 3300046642 Bacteria 23519
145 Ga0495634_0053136 3300046642 Bacteria 2714
146 Ga0495625_0049395 3300046660 Bacteria 3024
147 Ga0495625_0151471 3300046660 Bacteria 1559
148 Ga0495625_0400251 3300046660 Bacteria 858
149 Ga0495635_0001434 3300046663 Bacteria 15928
150 Ga0495635_0022186 3300046663 Bacteria 4421
151 Ga0495635_0105797 3300046663 Bacteria 1922
152 Ga0495635_0289375 3300046663 Bacteria 1100
153 Ga0495588_0002270 3300046674 Bacteria 8226
154 Ga0495588_0004173 3300046674 Bacteria 6370
155 Ga0495588_0077627 3300046674 Bacteria 1732
156 Ga0495657_0001624 3300046675 Bacteria 19284
157 Ga0495657_0006643 3300046675 Bacteria 9033
158 Ga0495657_0027661 3300046675 Bacteria 3998
159 Ga0495599_0176450 3300046678 Bacteria 1317
160 Ga0495623_0025117 3300046679 Bacteria 3838
161 Ga0495646_0001080 3300046680 Bacteria 15822
162 Ga0495646_0103769 3300046680 Bacteria 1626
163 Ga0495658_0007305 3300046683 Bacteria 5460
164 Ga0495658_0236627 3300046683 Bacteria 1146
165 Ga0495613_0000581 3300046689 Bacteria 29559
166 Ga0495613_0005862 3300046689 Bacteria 9190
167 Ga0495613_0010519 3300046689 Bacteria 6867
168 Ga0495613_0045017 3300046689 Bacteria 3264
169 Ga0495613_0045389 3300046689 Bacteria 3250
170 Ga0495613_0129679 3300046689 Bacteria 1806
171 Ga0495613_0356686 3300046689 Bacteria 1003
172 Ga0495624_0116020 3300046690 Bacteria 1646
173 Ga0495624_0199450 3300046690 Bacteria 1216
174 Ga0495671_0005913 3300046692 Bacteria 7114
175 Ga0495649_0026707 3300046694 Bacteria 3208
176 Ga0495649_0084428 3300046694 Bacteria 1695
177 Ga0495649_0174789 3300046694 Bacteria 1122
178 Ga0495589_0021274 3300046794 Bacteria 3314
179 Ga0495589_0064833 3300046794 Bacteria 1791
180 Ga0495600_0046224 3300046809 Bacteria 2840
181 Ga0495581_0002996 3300047315 Bacteria 9680
182 Ga0495581_0058955 3300047315 Bacteria 2217
183 Ga0495604_0000113 3300047317 Bacteria 68389
184 Ga0495604_0000681 3300047317 Bacteria 28787
185 Ga0495604_0004273 3300047317 Bacteria 11313
186 Ga0495604_0028027 3300047317 Bacteria 4480
187 Ga0495636_0002227 3300047318 Bacteria 7443
188 Ga0495636_0019065 3300047318 Bacteria 2755
189 Ga0495636_0057627 3300047318 Bacteria 1636
190 Ga0495636_0107121 3300047318 Bacteria 1227
191 Ga0495674_0090496 3300047319 Bacteria 2614
192 Ga0495674_0185032 3300047319 Bacteria 1733
193 Ga0495676_0002428 3300047321 Bacteria 16552
194 Ga0495687_025346 3300047443 Bacteria 2805
195 Ga0495687_044376 3300047443 Bacteria 1933
196 Ga0495675_0018319 3300047444 Bacteria 4445
197 Ga0495675_0056047 3300047444 Bacteria 2499
198 Ga0495675_0170792 3300047444 Bacteria 1335
199 Ga0495685_002482 3300047447 Bacteria 5781
200 Ga0495685_028209 3300047447 Bacteria 1931
201 Ga0495685_032035 3300047447 Bacteria 1806
202 Ga0495681_0008316 3300047470 Bacteria 6518
203 Ga0495681_0072337 3300047470 Bacteria 1559
204 Ga0495684_0016150 3300047471 Bacteria 5749
205 Ga0495684_0242034 3300047471 Bacteria 1315
206 Ga0495686_0025785 3300047472 Bacteria 3850
207 Ga0495593_0000754 3300047673 Bacteria 18796
208 Ga0495593_0201927 3300047673 Bacteria 999
209 Ga0495602_0002652 3300048088 Bacteria 18283
210 Ga0495614_0002795 3300048089 Bacteria 7762
211 Ga0495614_0011599 3300048089 Bacteria 3874
212 Ga0495626_0250846 3300048091 Bacteria 710
213 Ga0496100_0974449 3300048903 Bacteria 667
214 Ga0496102_0861994 3300048905 Bacteria 828
215 Ga0496106_1066941 3300048909 Bacteria 634
216 Ga0496108_0543070 3300048911 Bacteria 1014
217 Ga0496109_0059363 3300048912 Bacteria 3494
218 Ga0496113_1091687 3300048916 Bacteria 626
219 Ga0501031_0140291 3300049568 Bacteria 1579
220 Ga0501032_0012475 3300049569 Bacteria 6071
221 Ga0501032_0036773 3300049569 Bacteria 3341
222 Ga0501033_0004081 3300049570 Bacteria 11782
223 Ga0501033_0025651 3300049570 Bacteria 4440
224 Ga0501033_0044337 3300049570 Bacteria 3311
225 Ga0501033_0096141 3300049570 Bacteria 2164
226 Ga0501033_0123753 3300049570 Bacteria 1875
227 Ga0501033_0741286 3300049570 Bacteria 666
228 Ga0501034_0003504 3300049571 Bacteria 17819
229 Ga0501034_0012671 3300049571 Bacteria 8700
230 Ga0501034_0036467 3300049571 Bacteria 4981
231 Ga0501036_0000494 3300049572 Bacteria 28194
232 Ga0501036_0008385 3300049572 Bacteria 8468
233 Ga0501036_0042840 3300049572 Bacteria 3832
234 Ga0501036_0123637 3300049572 Bacteria 2185
235 Ga0501036_0392726 3300049572 Bacteria 1157
236 Ga0501037_0026622 3300049573 Bacteria 4273
237 Ga0501037_0043813 3300049573 Bacteria 3288
238 Ga0501037_0286753 3300049573 Bacteria 1146
239 Ga0501038_0005220 3300049574 Bacteria 12090
240 Ga0501038_0055450 3300049574 Bacteria 3404
241 Ga0501038_0175788 3300049574 Bacteria 1730
242 Ga0501038_0188374 3300049574 Bacteria 1661
243 Ga0501039_0003935 3300049575 Bacteria 11165
244 Ga0501039_0035280 3300049575 Bacteria 3859
245 Ga0501039_0636192 3300049575 Bacteria 835
246 Ga0501040_0011135 3300049576 Bacteria 5879
247 Ga0501041_0007503 3300049577 Bacteria 6400
248 Ga0501042_0138117 3300049578 Bacteria 1757
249 Ga0501043_0002870 3300049579 Bacteria 14387
250 Ga0501043_0005728 3300049579 Bacteria 10009
251 Ga0501043_0007828 3300049579 Bacteria 8446
252 Ga0501046_0062043 3300049580 Bacteria 2921
253 Ga0501046_0178624 3300049580 Bacteria 1588
254 Ga0501047_0008284 3300049581 Bacteria 9813
255 Ga0501047_0008530 3300049581 Bacteria 9666
256 Ga0501047_0097977 3300049581 Bacteria 2810
257 Ga0501047_0137724 3300049581 Bacteria 2321
258 Ga0501047_0499408 3300049581 Bacteria 1043
259 Ga0501048_0034513 3300049582 Bacteria 3648
260 Ga0501048_0315358 3300049582 Bacteria 1113
261 Ga0501048_0406062 3300049582 Bacteria 974
262 Ga0501068_0010733 3300049584 Bacteria 5150
263 Ga0501068_0076078 3300049584 Bacteria 2054
264 Ga0501069_0046541 3300049585 Bacteria 2406
265 Ga0501070_0000894 3300049586 Bacteria 27126
266 Ga0501070_0014748 3300049586 Bacteria 6575
267 Ga0501071_0016341 3300049587 Bacteria 5102
268 Ga0501072_0004233 3300049588 Bacteria 10884
269 Ga0501073_0031872 3300049589 Bacteria 3760
270 Ga0501073_0179357 3300049589 Bacteria 1466
271 Ga0501074_0001215 3300049590 Bacteria 16963
272 Ga0501074_0092576 3300049590 Bacteria 2164
273 Ga0501074_0410866 3300049590 Bacteria 960
274 Ga0501076_0056005 3300049592 Bacteria 3128
275 Ga0501077_0025667 3300049593 Bacteria 3740
276 Ga0501235_160228 3300049669 Bacteria 588
277 Ga0501079_0021813 3300049741 Bacteria 4902
278 Ga0501083_0002875 3300049744 Bacteria 11919
279 Ga0501035_0002481 3300049822 Bacteria 18028
280 Ga0501035_0005580 3300049822 Bacteria 11888
281 Ga0501035_0120564 3300049822 Bacteria 2293
282 Ga0501035_0206351 3300049822 Bacteria 1683
283 Ga0501035_0350892 3300049822 Bacteria 1234
284 Ga0501035_0447579 3300049822 Bacteria 1069
285 Ga0501044_0001248 3300049823 Bacteria 30179
286 Ga0501044_0038650 3300049823 Bacteria 4983
287 Ga0501044_0438011 3300049823 Bacteria 1215
288 Ga0501045_0018133 3300049824 Bacteria 5002
289 nmdc:mga03n38_232462_c1 3300050490 Bacteria 967
290 nmdc:mga06z11_7214_c1 3300050494 Bacteria 4563
291 nmdc:mga04h51_7301_c1 3300050495 Bacteria 2910
292 Ga0495619_0135445 3300053085 Bacteria 1694
293 Ga0500644_0039179 3300053088 Bacteria 1560
294 Ga0500640_004628 3300053095 Bacteria 5022
295 Ga0500553_011514 3300053101 Bacteria 4462
296 Ga0500553_105457 3300053101 Bacteria 1201
297 Ga0500558_171227 3300053106 Bacteria 785
298 Ga0500560_024859 3300053107 Bacteria 1753
299 Ga0500560_119741 3300053107 Bacteria 883
300 Ga0500573_0114653 3300053140 Bacteria 1505
301 Ga0500624_002374 3300053157 Bacteria 2554
302 Ga0500636_0081096 3300053177 Bacteria 1869
303 Ga0501084_0116449 3300054114 Bacteria 2246
304 Ga0501082_0076163 3300060353 Bacteria 2891
305 Ga0466962_0002817 3300061719 Bacteria 8280
306 Ga0466962_0003240 3300061719 Bacteria 7734
307 2585320241 2582581314 Bacteria 11452267
308 2616696731 2616644814 Bacteria 11555299
309 2644014408 2643221601 Bacteria 7493239
310 2644175845 2643221631 Bacteria 8168043
311 2644261536 2643221647 Bacteria 10741251
312 2768643561 2767802112 Bacteria 6465194
313 2785370827 2784746768 Bacteria 10036182
314 2786672008 2786546132 Bacteria 10419719
315 2808912966 2808606375 Bacteria 9466072
316 2812479372 2811994917 Bacteria 7761064
317 2852642801 2852635781 Bacteria 8251373
318 2862185280 2862178590 Bacteria 8583590
319 2862287053 2862281513 Bacteria 9621493
320 2862511944 2862507626 Bacteria 9425308
321 2863411514 2863404153 Bacteria 9672205
322 2867431223 2867428634 Bacteria 9590268
323 2877679747 2877676314 Bacteria 9512378
324 2912718389 2912715099 Bacteria 9460473
325 2912730737 2912723979 Bacteria 8557534
326 2912762172 2912757875 Bacteria 7940295
327 2946069212 2946064051 Bacteria 8957905
328 2946077159 2946072368 Bacteria 8999607
329 2947227714 2947224130 Bacteria 9938529
330 2954384661 2954380949 Bacteria 10050426
331 2954678280 2954673503 Bacteria 9685905
332 2954685877 2954682443 Bacteria 9862841
333 2954695517 2954691527 Bacteria 10720516
334 2954710711 2954701450 Bacteria 10834262
335 2954714947 2954711539 Bacteria 10867210
336 2954724890 2954721474 Bacteria 10456478
337 2954736928 2954731030 Bacteria 10243860
338 2954743816 2954740390 Bacteria 10229294
339 2954755777 2954749733 Bacteria 10366972
340 2954762769 2954759201 Bacteria 9358192
341 3006326158 3006321560 Bacteria 8247479
342 3006397788 3006393351 Bacteria 6615579
343 3006498873 3006493962 Bacteria 8825450
344 8008566599 8008558824 Bacteria 10610750
345 8008577761 8008574985 Bacteria 7815457
346 8048413792 8048406513 Bacteria 8936924
347 8056837569 8056829672 Bacteria 9045328
348 Ga0501031_0291391
349 JGI24739J22299_10035760
350 rootH2_10002475
351 rootL2_10016940
352 rootH1_10021004
353 JGI25160J50197_1009380
354 Ga0006562J51391_1042200
355 Ga0006562J51391_1042201
356 Ga0070665_100170290
357 Ga0068852_100746537
358 Ga0081455_10050740
359 Ga0075368_10000496
360 Ga0075367_10000729
361 Ga0105244_10124806
362 Ga0105245_10114355
363 Ga0105243_10047247
364 Ga0105238_10620989
365 Ga0105246_10073716
366 Ga0105246_10419440
367 Ga0157369_10043199
368 Ga0157375_10439612
369 Ga0182008_10000155
370 Ga0182007_10000136
371 Ga0182005_1009588
372 Ga0183367_1002
373 Ga0207426_1002066
374 Ga0207426_1017847
375 Ga0207426_1028246
376 Ga0207647_10021481
377 Ga0207687_10081260
378 Ga0207691_10232771
379 Ga0207702_10263980
380 Ga0209813_10000474
381 Ga0268266_10137864
382 Ga0307515_10003019
383 Ga0268256_1034615
384 Ga0307512_10050247
385 Ga0307509_10027881
386 Ga0307508_10001583
387 Ga0307508_10059114
388 Ga0307514_10001786
389 Ga0307514_10048392
390 Ga0307516_10002850
391 Ga0307516_10150756
392 Ga0307516_10423028
393 Ga0307416_100778771
394 Ga0307507_10016774
395 Ga0307507_10087120
396 Ga0307507_10105286
397 Ga0307510_10040055
398 Ga0307510_10049903
399 Ga0307510_10071835
400 Ga0395898_0002829
401 Ga0395898_0020144
402 Ga0395905_0866636
403 Ga0436364_0550851
404 Ga0395901_0195109
405 Ga0439436_0023332
406 Ga0439439_0003136
407 Ga0451793_0599579
408 Ga0451795_1122508
409 Ga0451835_0677758
410 Ga0451845_0136970
411 Ga0451843_0859934
412 Ga0451855_0349275
413 Ga0451853_1042094
414 Ga0451853_1073691
415 Ga0439433_0003340
416 Ga0439442_010786
417 Ga0439442_014082
418 Ga0439449_0008446
419 Ga0439449_0010381
420 Ga0439455_0017047
421 Ga0439457_000871
422 Ga0439457_003692
423 Ga0439462_0001654
424 Ga0450898_020969
425 Ga0450902_016159
426 Ga0450903_000180
427 Ga0439458_0003242
428 Ga0466969_0007945
429 Ga0466972_0020641
430 Ga0466965_0122293
431 Ga0466966_0053273
432 Ga0466961_0130776
433 Ga0466961_0135562
434 Ga0466961_0453155
435 Ga0466961_0632445
436 Ga0466963_0007112
437 Ga0466963_0031203
438 Ga0466971_0148776
439 Ga0466970_0079789
440 Ga0466957_0679113
441 Ga0466960_0077663
442 Ga0466959_0008345
443 Ga0466967_0327751
444 Ga0495627_004508
445 Ga0495592_0001470
446 Ga0495592_0008357
447 Ga0495603_0004232
448 Ga0495629_0016968
449 Ga0495629_0063929
450 Ga0495638_0021848
451 Ga0495651_0027073
452 Ga0495651_0030853
453 Ga0495653_0276305
454 Ga0495653_0390688
455 Ga0495580_0054477
456 Ga0495582_0027238
457 Ga0495639_0006014
458 Ga0495662_0000390
459 Ga0495662_0005541
460 Ga0495662_0031989
461 Ga0495662_0037333
462 Ga0495664_0000628
463 Ga0495664_0005335
464 Ga0495585_0115706
465 Ga0495594_0112372
466 Ga0495608_0000434
467 Ga0495618_0001915
468 Ga0495618_0429551
469 Ga0495620_0148795
470 Ga0495628_0002756
471 Ga0495628_0218837
472 Ga0495630_0142382
473 Ga0495632_0451121
474 Ga0495644_0256672
475 Ga0495666_0278582
476 Ga0495652_0037013
477 Ga0495652_0048274
478 Ga0495665_0001097
479 Ga0495640_0004629
480 Ga0495640_0010427
481 Ga0495640_0139910
482 Ga0495586_0175773
483 Ga0495587_0004249
484 Ga0495645_0009455
485 Ga0495645_0011788
486 Ga0495645_0060718
487 Ga0495622_0040784
488 Ga0495622_0071169
489 Ga0495633_0046021
490 Ga0495667_0051172
491 Ga0495634_0001232
492 Ga0495634_0053136
493 Ga0495625_0049395
494 Ga0495625_0151471
495 Ga0495625_0400251
496 Ga0495635_0001434
497 Ga0495635_0022186
498 Ga0495635_0105797
499 Ga0495635_0289375
500 Ga0495588_0002270
501 Ga0495588_0004173
502 Ga0495588_0077627
503 Ga0495657_0001624
504 Ga0495657_0006643
505 Ga0495657_0027661
506 Ga0495599_0176450
507 Ga0495623_0025117
508 Ga0495646_0001080
509 Ga0495646_0103769
510 Ga0495658_0007305
511 Ga0495658_0236627
512 Ga0495613_0000581
513 Ga0495613_0005862
514 Ga0495613_0010519
515 Ga0495613_0045017
516 Ga0495613_0045389
517 Ga0495613_0129679
518 Ga0495613_0356686
519 Ga0495624_0116020
520 Ga0495624_0199450
521 Ga0495671_0005913
522 Ga0495649_0026707
523 Ga0495649_0084428
524 Ga0495649_0174789
525 Ga0495589_0021274
526 Ga0495589_0064833
527 Ga0495600_0046224
528 Ga0495581_0002996
529 Ga0495581_0058955
530 Ga0495604_0000113
531 Ga0495604_0000681
532 Ga0495604_0004273
533 Ga0495604_0028027
534 Ga0495636_0002227
535 Ga0495636_0019065
536 Ga0495636_0057627
537 Ga0495636_0107121
538 Ga0495674_0090496
539 Ga0495674_0185032
540 Ga0495676_0002428
541 Ga0495687_025346
542 Ga0495687_044376
543 Ga0495675_0018319
544 Ga0495675_0056047
545 Ga0495675_0170792
546 Ga0495685_002482
547 Ga0495685_028209
548 Ga0495685_032035
549 Ga0495681_0008316
550 Ga0495681_0072337
551 Ga0495684_0016150
552 Ga0495684_0242034
553 Ga0495686_0025785
554 Ga0495593_0000754
555 Ga0495593_0201927
556 Ga0495602_0002652
557 Ga0495614_0002795
558 Ga0495614_0011599
559 Ga0495626_0250846
560 Ga0496100_0974449
561 Ga0496102_0861994
562 Ga0496106_1066941
563 Ga0496108_0543070
564 Ga0496109_0059363
565 Ga0496113_1091687
566 Ga0501031_0140291
567 Ga0501032_0012475
568 Ga0501032_0036773
569 Ga0501033_0004081
570 Ga0501033_0025651
571 Ga0501033_0044337
572 Ga0501033_0096141
573 Ga0501033_0123753
574 Ga0501033_0741286
575 Ga0501034_0003504
576 Ga0501034_0012671
577 Ga0501034_0036467
578 Ga0501036_0000494
579 Ga0501036_0008385
580 Ga0501036_0042840
581 Ga0501036_0123637
582 Ga0501036_0392726
583 Ga0501037_0026622
584 Ga0501037_0043813
585 Ga0501037_0286753
586 Ga0501038_0005220
587 Ga0501038_0055450
588 Ga0501038_0175788
589 Ga0501038_0188374
590 Ga0501039_0003935
591 Ga0501039_0035280
592 Ga0501039_0636192
593 Ga0501040_0011135
594 Ga0501041_0007503
595 Ga0501042_0138117
596 Ga0501043_0002870
597 Ga0501043_0005728
598 Ga0501043_0007828
599 Ga0501046_0062043
600 Ga0501046_0178624
601 Ga0501047_0008284
602 Ga0501047_0008530
603 Ga0501047_0097977
604 Ga0501047_0137724
605 Ga0501047_0499408
606 Ga0501048_0034513
607 Ga0501048_0315358
608 Ga0501048_0406062
609 Ga0501068_0010733
610 Ga0501068_0076078
611 Ga0501069_0046541
612 Ga0501070_0000894
613 Ga0501070_0014748
614 Ga0501071_0016341
615 Ga0501072_0004233
616 Ga0501073_0031872
617 Ga0501073_0179357
618 Ga0501074_0001215
619 Ga0501074_0092576
620 Ga0501074_0410866
621 Ga0501076_0056005
622 Ga0501077_0025667
623 Ga0501235_160228
624 Ga0501079_0021813
625 Ga0501083_0002875
626 Ga0501035_0002481
627 Ga0501035_0005580
628 Ga0501035_0120564
629 Ga0501035_0206351
630 Ga0501035_0350892
631 Ga0501035_0447579
632 Ga0501044_0001248
633 Ga0501044_0038650
634 Ga0501044_0438011
635 Ga0501045_0018133
636 nmdc:mga03n38_232462_c1
637 nmdc:mga06z11_7214_c1
638 nmdc:mga04h51_7301_c1
639 Ga0495619_0135445
640 Ga0500644_0039179
641 Ga0500640_004628
642 Ga0500553_011514
643 Ga0500553_105457
644 Ga0500558_171227
645 Ga0500560_024859
646 Ga0500560_119741
647 Ga0500573_0114653
648 Ga0500624_002374
649 Ga0500636_0081096
650 Ga0501084_0116449
651 Ga0501082_0076163
652 Ga0466962_0002817
653 Ga0466962_0003240
654 2585320241
655 2616696731
656 2644014408
657 2644175845
658 2644261536
659 2768643561
660 2785370827
661 2786672008
662 2808912966
663 2812479372
664 2852642801
665 2862185280
666 2862287053
667 2862511944
668 2863411514
669 2867431223
670 2877679747
671 2912718389
672 2912730737
673 2912762172
674 2946069212
675 2946077159
676 2947227714
677 2954384661
678 2954678280
679 2954685877
680 2954695517
681 2954710711
682 2954714947
683 2954724890
684 2954736928
685 2954743816
686 2954755777
687 2954762769
688 3006326158
689 3006397788
690 3006498873
691 8008566599
692 8008577761
693 8048413792
694 8056837569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02367

TsaE

Threonylcarbamoyl adenosine biosynthesis protein TsaE

17

148

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6nns-assembly1.cif.gz_A xanthomonas citri phospho-pgm in complex with glucose-6-phosphate 0.6766 5 53
6shu-assembly1.cif.gz_A borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine 0.6665 15 55
3pdk-assembly1.cif.gz_B crystal structure of phosphoglucosamine mutase from b. anthracis 0.6621 5 56
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.6426 5 173
5mvr-assembly1.cif.gz_A crystal structure of bacillus subtilus ydib 0.6092 5 173
ID Description Score Start End Superfamily
2f7lB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.741 10 56 3.40.120.10
3i3wB01 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.7109 7 55 3.40.120.10
4mptA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6772 16 57 3.40.50.2300
3tb6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6544 14 56 3.40.50.2300
af_Q8I2H3_93_235_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.6521 15 57 3.30.2320.30
ID Description Score Start End GO Terms
AF-A0A1G6P4L6-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.6719 1 176 GO:0002949
GO:0005524
GO:0005737
AF-A0A4R3IVB3-F1-model_v4 deleted 0.6717 2 176
AF-A0A7L7MBG0-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.6643 4 176 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A429ESV7-F1-model_v4 tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE) 0.6625 5 176 GO:0002949
GO:0005524
GO:0005737
GO:0016740
AF-A0A4R2E4V7-F1-model_v4 deleted 0.6618 1 176

Map