F417282

General Info

Members Datasets Scaffolds Average Seq Length
347 179 694 160

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0284487|Ga0496102_0284487_860_1411
Length 183
Sequence MPLRAAPKLVGIVESMTETAAPQNPQQQSPEQRTVFLDKAHPAAWRALNGLGLKAKEAATAAGLDETLIELLNVRISQINGCAYCLDMHVGDAVKNGESAQRLAVLPAWRDTTLFTEKERAALTLAEAITTISDAQARDHEGAQARRHLTADEFSAVSWLAITMNAFNRVSIVSQHPVRAARG

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
70 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
74 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
75 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
76 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
79 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
80 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
81 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
84 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
99 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
100 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
106 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
107 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
115 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
116 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
144 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
145 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
146 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
147 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
148 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
149 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
150 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
151 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
152 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
153 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
154 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
155 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
156 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
157 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
159 2643221617 Nocardioides sp. Root79 Isolate Unclassified
160 2643221620 Nocardioides sp. Root240 Isolate Unclassified
161 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
162 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
163 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
164 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
165 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
166 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
167 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
168 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
169 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
170 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
171 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
172 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
173 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
174 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
175 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
176 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
177 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
178 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
179 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.8
Metatranscriptomes 0.86
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 12.1
Rhizosphere 81.84
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0284487 3300048905 Bacteria 1558
2 rootH1_10029217 3300003316 Bacteria 2783
3 rootH2_10129477 3300003320 Bacteria 2661
4 Ga0006562J51391_1065743 3300003578 Bacteria 880
5 Ga0055542_1005251 3300003762 Bacteria 2961
6 Ga0065714_10023299 3300005288 Bacteria 1391
7 Ga0065714_10107031 3300005288 Bacteria 1539
8 Ga0065714_10108227 3300005288 Bacteria 1518
9 Ga0065714_10185916 3300005288 Bacteria 945
10 Ga0070658_11083576 3300005327 Bacteria 697
11 Ga0070676_10151094 3300005328 Bacteria 1487
12 Ga0070676_10756829 3300005328 Bacteria 713
13 Ga0070670_100479498 3300005331 Bacteria 1104
14 Ga0070677_10131612 3300005333 Bacteria 1143
15 Ga0070666_10046383 3300005335 Bacteria 2914
16 Ga0070668_100215683 3300005347 Bacteria 1580
17 Ga0070675_100073625 3300005354 Bacteria 2836
18 Ga0070671_100117983 3300005355 Bacteria 2232
19 Ga0070673_100084868 3300005364 Bacteria 2576
20 Ga0070667_101006955 3300005367 Bacteria 777
21 Ga0070678_100578938 3300005456 Bacteria 1000
22 Ga0070672_100113813 3300005543 Bacteria 2208
23 Ga0068851_10664284 3300005834 Bacteria 639
24 Ga0075364_10009947 3300006051 Bacteria 5723
25 Ga0075432_10045400 3300006058 Bacteria 1541
26 Ga0075367_10314723 3300006178 Bacteria 986
27 Ga0105244_10113905 3300009036 Bacteria 1313
28 Ga0105244_10230084 3300009036 Bacteria 868
29 Ga0105245_10317429 3300009098 Bacteria 1534
30 Ga0105247_10533801 3300009101 Bacteria 860
31 Ga0114129_12451233 3300009147 Bacteria 624
32 Ga0105243_10065356 3300009148 Bacteria 2922
33 Ga0105248_10227071 3300009177 Bacteria 2102
34 Ga0105246_10005656 3300011119 Bacteria 7626
35 Ga0105246_10181511 3300011119 Bacteria 1621
36 Ga0157373_10021715 3300013100 Bacteria 4658
37 Ga0157369_10248948 3300013105 Bacteria 1855
38 Ga0157369_10510189 3300013105 Bacteria 1244
39 Ga0157369_10545866 3300013105 Bacteria 1198
40 Ga0163162_10047493 3300013306 Bacteria 4303
41 Ga0163162_10267603 3300013306 Bacteria 1841
42 Ga0157375_10422301 3300013308 Bacteria 1499
43 Ga0163161_10327988 3300017792 Bacteria 1212
44 Ga0209148_1004441 3300025254 Bacteria 3461
45 Ga0207697_10003124 3300025315 Bacteria 8277
46 Ga0207655_1020832 3300025728 Bacteria 3353
47 Ga0207713_1029844 3300025735 Bacteria 2435
48 Ga0207682_10004118 3300025893 Bacteria 6166
49 Ga0207688_10361042 3300025901 Bacteria 896
50 Ga0207645_10002199 3300025907 Bacteria 15574
51 Ga0207643_10174470 3300025908 Bacteria 1298
52 Ga0207650_10092248 3300025925 Bacteria 2316
53 Ga0207650_10217264 3300025925 Bacteria 1537
54 Ga0207687_10636480 3300025927 Bacteria 901
55 Ga0207686_10507360 3300025934 Bacteria 937
56 Ga0207691_10023574 3300025940 Bacteria 5794
57 Ga0207711_10967614 3300025941 Bacteria 790
58 Ga0207651_10166608 3300025960 Bacteria 1733
59 Ga0207658_11276394 3300025986 Bacteria 671
60 Ga0207683_10009519 3300026121 Bacteria 8282
61 Ga0207683_10197251 3300026121 Bacteria 1829
62 Ga0207428_10002801 3300027907 Bacteria 17322
63 Ga0207428_10290093 3300027907 Bacteria 1213
64 Ga0307408_100006145 3300031548 Bacteria 7972
65 Ga0307408_100008546 3300031548 Bacteria 6761
66 Ga0307408_100021191 3300031548 Bacteria 4395
67 Ga0307408_100025722 3300031548 Bacteria 4033
68 Ga0307408_100032579 3300031548 Bacteria 3634
69 Ga0307408_100100412 3300031548 Bacteria 2204
70 Ga0307408_100101630 3300031548 Bacteria 2191
71 Ga0307408_100121884 3300031548 Bacteria 2021
72 Ga0307408_100147608 3300031548 Bacteria 1853
73 Ga0307408_100163705 3300031548 Bacteria 1769
74 Ga0307408_100224206 3300031548 Bacteria 1535
75 Ga0307408_100257499 3300031548 Bacteria 1442
76 Ga0307408_100855368 3300031548 Bacteria 829
77 Ga0307405_10001135 3300031731 Bacteria 10925
78 Ga0307405_10024257 3300031731 Bacteria 3461
79 Ga0307405_10079854 3300031731 Bacteria 2134
80 Ga0307405_10124927 3300031731 Bacteria 1767
81 Ga0307405_10140187 3300031731 Bacteria 1684
82 Ga0307405_10159098 3300031731 Bacteria 1597
83 Ga0307405_10188286 3300031731 Bacteria 1488
84 Ga0307405_10211096 3300031731 Bacteria 1417
85 Ga0307405_10283466 3300031731 Bacteria 1248
86 Ga0307405_10330591 3300031731 Bacteria 1168
87 Ga0307405_10849577 3300031731 Bacteria 768
88 Ga0307405_11378695 3300031731 Bacteria 616
89 Ga0307413_10027846 3300031824 Bacteria 3138
90 Ga0307413_10041870 3300031824 Bacteria 2686
91 Ga0307413_10061905 3300031824 Bacteria 2312
92 Ga0307413_10068679 3300031824 Bacteria 2221
93 Ga0307413_10080482 3300031824 Bacteria 2086
94 Ga0307413_10141348 3300031824 Bacteria 1664
95 Ga0307413_10238405 3300031824 Bacteria 1341
96 Ga0307413_10321850 3300031824 Bacteria 1181
97 Ga0307413_10613094 3300031824 Bacteria 892
98 Ga0307413_11209734 3300031824 Bacteria 657
99 Ga0307410_10004116 3300031852 Bacteria 7450
100 Ga0307410_10082042 3300031852 Bacteria 2267
101 Ga0307410_10124283 3300031852 Bacteria 1886
102 Ga0307410_10304248 3300031852 Bacteria 1259
103 Ga0307410_10355543 3300031852 Bacteria 1172
104 Ga0307410_10415933 3300031852 Bacteria 1089
105 Ga0307410_10626756 3300031852 Bacteria 900
106 Ga0307406_10141450 3300031901 Bacteria 1704
107 Ga0307406_10184069 3300031901 Bacteria 1523
108 Ga0307406_10646095 3300031901 Bacteria 878
109 Ga0307406_10769846 3300031901 Bacteria 810
110 Ga0307406_10946972 3300031901 Bacteria 736
111 Ga0307407_10008342 3300031903 Bacteria 4748
112 Ga0307407_10013899 3300031903 Bacteria 3923
113 Ga0307407_10037516 3300031903 Bacteria 2678
114 Ga0307407_10075119 3300031903 Bacteria 2025
115 Ga0307407_10198470 3300031903 Bacteria 1343
116 Ga0307407_10586409 3300031903 Bacteria 828
117 Ga0307407_10743820 3300031903 Bacteria 742
118 Ga0307407_11306321 3300031903 Bacteria 569
119 Ga0307412_10000535 3300031911 Bacteria 22642
120 Ga0307412_10010487 3300031911 Bacteria 5339
121 Ga0307412_10053137 3300031911 Bacteria 2684
122 Ga0307412_10100559 3300031911 Bacteria 2044
123 Ga0307412_10212412 3300031911 Bacteria 1477
124 Ga0307412_10248363 3300031911 Bacteria 1380
125 Ga0307412_10255727 3300031911 Bacteria 1362
126 Ga0307412_10569697 3300031911 Bacteria 954
127 Ga0307412_10742541 3300031911 Bacteria 846
128 Ga0307412_10999523 3300031911 Bacteria 739
129 Ga0307409_100031918 3300031995 Bacteria 3810
130 Ga0307409_100036369 3300031995 Bacteria 3618
131 Ga0307409_100043801 3300031995 Bacteria 3365
132 Ga0307409_100082556 3300031995 Bacteria 2602
133 Ga0307409_100113457 3300031995 Bacteria 2278
134 Ga0307409_100175549 3300031995 Bacteria 1890
135 Ga0307409_100301964 3300031995 Bacteria 1490
136 Ga0307409_100445907 3300031995 Bacteria 1248
137 Ga0307409_100455754 3300031995 Bacteria 1235
138 Ga0307409_101505415 3300031995 Bacteria 700
139 Ga0307416_100020995 3300032002 Bacteria 4675
140 Ga0307416_100035319 3300032002 Bacteria 3816
141 Ga0307416_100044722 3300032002 Bacteria 3479
142 Ga0307416_100063634 3300032002 Bacteria 3022
143 Ga0307416_100072240 3300032002 Bacteria 2871
144 Ga0307416_100090100 3300032002 Bacteria 2628
145 Ga0307416_100124860 3300032002 Bacteria 2303
146 Ga0307416_100137501 3300032002 Bacteria 2213
147 Ga0307416_100174870 3300032002 Bacteria 2004
148 Ga0307416_100191205 3300032002 Bacteria 1930
149 Ga0307416_100213305 3300032002 Bacteria 1844
150 Ga0307416_100658630 3300032002 Unclassified 1132
151 Ga0307416_100760396 3300032002 Bacteria 1062
152 Ga0307416_101158554 3300032002 Bacteria 878
153 Ga0307416_101221634 3300032002 Bacteria 857
154 Ga0307414_10011224 3300032004 Bacteria 5244
155 Ga0307414_10071191 3300032004 Bacteria 2507
156 Ga0307414_10202936 3300032004 Bacteria 1614
157 Ga0307414_10458333 3300032004 Bacteria 1120
158 Ga0307414_10579596 3300032004 Bacteria 1004
159 Ga0307411_10001115 3300032005 Bacteria 10468
160 Ga0307411_10073979 3300032005 Bacteria 2320
161 Ga0307411_10188685 3300032005 Bacteria 1572
162 Ga0307415_100042176 3300032126 Bacteria 3035
163 Ga0307415_100105642 3300032126 Bacteria 2077
164 Ga0307415_100241369 3300032126 Bacteria 1462
165 Ga0307415_100347175 3300032126 Bacteria 1248
166 Ga0307415_100472850 3300032126 Bacteria 1089
167 Ga0307415_100486662 3300032126 Bacteria 1075
168 Ga0307415_101149116 3300032126 Bacteria 729
169 Ga0307415_101509414 3300032126 Bacteria 643
170 Ga0395899_0067725 3300037312 Bacteria 2619
171 Ga0395899_0124837 3300037312 Bacteria 1841
172 Ga0395899_0392163 3300037312 Bacteria 920
173 Ga0395900_0134982 3300037418 Bacteria 2528
174 Ga0395900_0178484 3300037418 Bacteria 2159
175 Ga0395900_0190664 3300037418 Bacteria 2079
176 Ga0395898_0432235 3300037466 Bacteria 1254
177 Ga0395905_0075686 3300037471 Bacteria 3155
178 Ga0395905_1777341 3300037471 Bacteria 522
179 Ga0395901_0100665 3300038443 Bacteria 3031
180 Ga0395901_0120977 3300038443 Bacteria 2751
181 Ga0395901_0155316 3300038443 Bacteria 2403
182 Ga0395901_0776669 3300038443 Bacteria 949
183 Ga0439439_0006237 3300041406 Bacteria 2754
184 Ga0439461_0009163 3300041410 Bacteria 1791
185 Ga0439466_0004392 3300041411 Bacteria 5430
186 Ga0439465_0005069 3300041413 Bacteria 4227
187 Ga0451800_0353823 3300041459 Bacteria 551
188 Ga0439433_0000437 3300041999 Bacteria 7631
189 Ga0439433_0044064 3300041999 Bacteria 1043
190 Ga0439442_000015 3300042002 Bacteria 47229
191 Ga0439442_000502 3300042002 Bacteria 8813
192 Ga0439442_003271 3300042002 Bacteria 3203
193 Ga0439432_013990 3300042006 Bacteria 2719
194 Ga0439432_040194 3300042006 Bacteria 1484
195 Ga0439449_0011183 3300042007 Bacteria 3379
196 Ga0439449_0021138 3300042007 Bacteria 2437
197 Ga0439449_0079890 3300042007 Bacteria 1206
198 Ga0439457_063996 3300042014 Bacteria 834
199 Ga0439462_0106120 3300042015 Unclassified 776
200 Ga0450920_000208 3300042122 Bacteria 8651
201 Ga0450920_001077 3300042122 Bacteria 4468
202 Ga0450907_000019 3300042146 Bacteria 75961
203 Ga0450907_015608 3300042146 Bacteria 1268
204 Ga0439434_0000734 3300042435 Bacteria 9392
205 Ga0439434_0074093 3300042435 Bacteria 1074
206 Ga0439434_0135653 3300042435 Bacteria 809
207 Ga0450918_000306 3300042531 Bacteria 10970
208 Ga0495590_0216000 3300046457 Bacteria 708
209 Ga0495629_0058619 3300046459 Bacteria 2692
210 Ga0495653_0011758 3300046463 Bacteria 7148
211 Ga0495580_0270164 3300046472 Bacteria 1161
212 Ga0495582_0154203 3300046473 Bacteria 1305
213 Ga0495639_0001277 3300046475 Bacteria 11312
214 Ga0495639_0257920 3300046475 Bacteria 863
215 Ga0495662_0030900 3300046476 Bacteria 2586
216 Ga0495664_0018746 3300046477 Bacteria 3970
217 Ga0495594_0063901 3300046499 Bacteria 2040
218 Ga0495594_0175520 3300046499 Bacteria 1219
219 Ga0495606_0001231 3300046507 Bacteria 35820
220 Ga0495610_0047818 3300046512 Bacteria 2103
221 Ga0495631_0154085 3300046518 Bacteria 986
222 Ga0495642_0120113 3300046528 Bacteria 1127
223 Ga0495665_0000223 3300046531 Bacteria 28631
224 Ga0495665_0194503 3300046531 Bacteria 1052
225 Ga0495586_0032074 3300046535 Bacteria 2816
226 Ga0495587_0019049 3300046536 Bacteria 4252
227 Ga0495645_0026586 3300046543 Bacteria 4201
228 Ga0495667_0012135 3300046559 Bacteria 5838
229 Ga0495656_0001038 3300046615 Bacteria 8987
230 Ga0495656_0210699 3300046615 Bacteria 968
231 Ga0495668_0000326 3300046616 Bacteria 65274
232 Ga0495625_0000770 3300046660 Bacteria 44596
233 Ga0495659_0202499 3300046664 Bacteria 815
234 Ga0495661_0091661 3300046665 Bacteria 1728
235 Ga0495588_0044773 3300046674 Bacteria 2267
236 Ga0495588_0088438 3300046674 Bacteria 1621
237 Ga0495588_0116902 3300046674 Bacteria 1405
238 Ga0495588_0453651 3300046674 Bacteria 672
239 Ga0495657_0060310 3300046675 Bacteria 2514
240 Ga0495623_0441455 3300046679 Bacteria 694
241 Ga0495670_0004902 3300046691 Bacteria 6574
242 Ga0495670_0405580 3300046691 Bacteria 737
243 Ga0495600_0029186 3300046809 Bacteria 3570
244 Ga0495600_0087144 3300046809 Bacteria 2037
245 Ga0495581_0031487 3300047315 Bacteria 3073
246 Ga0495581_0065253 3300047315 Bacteria 2104
247 Ga0495581_0101615 3300047315 Bacteria 1670
248 Ga0495581_0158880 3300047315 Bacteria 1321
249 Ga0495581_0169779 3300047315 Bacteria 1275
250 Ga0495581_0752116 3300047315 Bacteria 561
251 Ga0495604_0543062 3300047317 Bacteria 750
252 Ga0495636_0012789 3300047318 Bacteria 3325
253 Ga0495680_0013925 3300047322 Bacteria 6996
254 Ga0495683_0128677 3300047323 Bacteria 1196
255 Ga0495675_0093564 3300047444 Bacteria 1885
256 Ga0495677_0151059 3300047445 Bacteria 894
257 Ga0495593_0197492 3300047673 Bacteria 1011
258 Ga0495615_0118159 3300048090 Bacteria 765
259 Ga0495626_0000046 3300048091 Bacteria 162660
260 Ga0496100_0106401 3300048903 Bacteria 1941
261 Ga0496100_0126453 3300048903 Bacteria 1794
262 Ga0496101_0161454 3300048904 Bacteria 1718
263 Ga0496101_0415794 3300048904 Bacteria 1060
264 Ga0496101_0443943 3300048904 Bacteria 1023
265 Ga0496101_0755035 3300048904 Bacteria 767
266 Ga0496102_0117919 3300048905 Bacteria 2477
267 Ga0496102_0147088 3300048905 Bacteria 2212
268 Ga0496102_0156316 3300048905 Bacteria 2143
269 Ga0496102_0192171 3300048905 Bacteria 1924
270 Ga0496102_0243790 3300048905 Bacteria 1694
271 Ga0496102_0680809 3300048905 Bacteria 951
272 Ga0496103_0006684 3300048906 Bacteria 6881
273 Ga0496103_0035678 3300048906 Bacteria 3044
274 Ga0496103_0050157 3300048906 Bacteria 2581
275 Ga0496103_0164282 3300048906 Bacteria 1424
276 Ga0496104_0770689 3300048907 Bacteria 869
277 Ga0496106_0189317 3300048909 Bacteria 1635
278 Ga0496106_0474912 3300048909 Bacteria 1004
279 Ga0496106_0797442 3300048909 Bacteria 749
280 Ga0496107_0156315 3300048910 Bacteria 1688
281 Ga0496107_0310256 3300048910 Bacteria 1174
282 Ga0496107_0457645 3300048910 Bacteria 947
283 Ga0496108_0112989 3300048911 Bacteria 2324
284 Ga0496108_0354766 3300048911 Bacteria 1280
285 Ga0496108_0510570 3300048911 Bacteria 1049
286 Ga0496109_0298738 3300048912 Bacteria 1518
287 Ga0496109_1063909 3300048912 Bacteria 746
288 Ga0496110_0016045 3300048913 Bacteria 6245
289 Ga0496110_0074869 3300048913 Bacteria 3007
290 Ga0496110_0736476 3300048913 Bacteria 888
291 Ga0496111_0030999 3300048914 Bacteria 3805
292 Ga0496111_0607169 3300048914 Bacteria 800
293 Ga0496113_0108814 3300048916 Bacteria 2155
294 Ga0496113_0114484 3300048916 Bacteria 2103
295 Ga0496113_0505331 3300048916 Bacteria 970
296 Ga0496114_0042778 3300048917 Bacteria 3755
297 Ga0496114_0058146 3300048917 Bacteria 3228
298 Ga0496114_0196770 3300048917 Bacteria 1764
299 Ga0496115_0029536 3300048918 Bacteria 4306
300 Ga0496119_0400772 3300048922 Bacteria 655
301 Ga0496125_0122727 3300048928 Bacteria 1849
302 Ga0496125_0307019 3300048928 Bacteria 969
303 Ga0501315_024312 3300049531 Bacteria 837
304 Ga0501316_015531 3300049532 Bacteria 918
305 Ga0501032_0972228 3300049569 Bacteria 534
306 Ga0501037_0019532 3300049573 Bacteria 4999
307 Ga0501038_0018436 3300049574 Bacteria 6301
308 Ga0501038_0096147 3300049574 Bacteria 2473
309 Ga0501039_0894859 3300049575 Bacteria 691
310 Ga0501202_041714 3300049652 Bacteria 993
311 Ga0501202_089813 3300049652 Bacteria 733
312 Ga0501216_032261 3300049660 Bacteria 972
313 Ga0501217_023273 3300049661 Bacteria 1475
314 Ga0501235_210063 3300049669 Unclassified 530
315 Ga0501243_010983 3300049675 Bacteria 1417
316 Ga0501252_007526 3300049682 Bacteria 1235
317 Ga0501253_031769 3300049683 Bacteria 1012
318 Ga0501261_064735 3300049690 Bacteria 629
319 Ga0501229_038532 3300049706 Bacteria 675
320 Ga0501234_037956 3300049707 Bacteria 785
321 Ga0501266_014820 3300049763 Bacteria 1025
322 Ga0501279_021025 3300049775 Bacteria 930
323 nmdc:mga00v17_29099_c1 3300050491 Bacteria 3240
324 Ga0495655_0002092 3300053083 Bacteria 3132
325 Ga0590075_094393 3300059424 Bacteria 777
326 2623499061 2622736605 Bacteria 4992138
327 2644102407 2643221617 Bacteria 5139111
328 2644118069 2643221620 Bacteria 5134593
329 2691512030 2690315906 Bacteria 4517044
330 2775657065 2775506735 Bacteria 4556596
331 2808829192 2808606357 Bacteria 4466944
332 2808850416 2808606360 Bacteria 4404006
333 2808893437 2808606370 Bacteria 4942454
334 2808898496 2808606371 Bacteria 4251511
335 2812319064 2811994871 Bacteria 4497550
336 2887480069 2887478801 Bacteria 8972725
337 2919051892 2919051321 Bacteria 4210889
338 2919392610 2919391150 Bacteria 4884741
339 2939601693 2939598168 Bacteria 4687164
340 2945916814 2945916053 Bacteria 4555517
341 2945922914 2945920336 Bacteria 4501603
342 2945945220 2945941187 Bacteria 4682474
343 2945956409 2945956166 Bacteria 5110334
344 2946041393 2946037020 Bacteria 4900426
345 2946060643 2946059875 Bacteria 4386623
346 2954002575 2953998280 Bacteria 4812144
347 8054109263 8054107350 Bacteria 5022511
348 Ga0496102_0284487
349 rootH1_10029217
350 rootH2_10129477
351 Ga0006562J51391_1065743
352 Ga0055542_1005251
353 Ga0065714_10023299
354 Ga0065714_10107031
355 Ga0065714_10108227
356 Ga0065714_10185916
357 Ga0070658_11083576
358 Ga0070676_10151094
359 Ga0070676_10756829
360 Ga0070670_100479498
361 Ga0070677_10131612
362 Ga0070666_10046383
363 Ga0070668_100215683
364 Ga0070675_100073625
365 Ga0070671_100117983
366 Ga0070673_100084868
367 Ga0070667_101006955
368 Ga0070678_100578938
369 Ga0070672_100113813
370 Ga0068851_10664284
371 Ga0075364_10009947
372 Ga0075432_10045400
373 Ga0075367_10314723
374 Ga0105244_10113905
375 Ga0105244_10230084
376 Ga0105245_10317429
377 Ga0105247_10533801
378 Ga0114129_12451233
379 Ga0105243_10065356
380 Ga0105248_10227071
381 Ga0105246_10005656
382 Ga0105246_10181511
383 Ga0157373_10021715
384 Ga0157369_10248948
385 Ga0157369_10510189
386 Ga0157369_10545866
387 Ga0163162_10047493
388 Ga0163162_10267603
389 Ga0157375_10422301
390 Ga0163161_10327988
391 Ga0209148_1004441
392 Ga0207697_10003124
393 Ga0207655_1020832
394 Ga0207713_1029844
395 Ga0207682_10004118
396 Ga0207688_10361042
397 Ga0207645_10002199
398 Ga0207643_10174470
399 Ga0207650_10092248
400 Ga0207650_10217264
401 Ga0207687_10636480
402 Ga0207686_10507360
403 Ga0207691_10023574
404 Ga0207711_10967614
405 Ga0207651_10166608
406 Ga0207658_11276394
407 Ga0207683_10009519
408 Ga0207683_10197251
409 Ga0207428_10002801
410 Ga0207428_10290093
411 Ga0307408_100006145
412 Ga0307408_100008546
413 Ga0307408_100021191
414 Ga0307408_100025722
415 Ga0307408_100032579
416 Ga0307408_100100412
417 Ga0307408_100101630
418 Ga0307408_100121884
419 Ga0307408_100147608
420 Ga0307408_100163705
421 Ga0307408_100224206
422 Ga0307408_100257499
423 Ga0307408_100855368
424 Ga0307405_10001135
425 Ga0307405_10024257
426 Ga0307405_10079854
427 Ga0307405_10124927
428 Ga0307405_10140187
429 Ga0307405_10159098
430 Ga0307405_10188286
431 Ga0307405_10211096
432 Ga0307405_10283466
433 Ga0307405_10330591
434 Ga0307405_10849577
435 Ga0307405_11378695
436 Ga0307413_10027846
437 Ga0307413_10041870
438 Ga0307413_10061905
439 Ga0307413_10068679
440 Ga0307413_10080482
441 Ga0307413_10141348
442 Ga0307413_10238405
443 Ga0307413_10321850
444 Ga0307413_10613094
445 Ga0307413_11209734
446 Ga0307410_10004116
447 Ga0307410_10082042
448 Ga0307410_10124283
449 Ga0307410_10304248
450 Ga0307410_10355543
451 Ga0307410_10415933
452 Ga0307410_10626756
453 Ga0307406_10141450
454 Ga0307406_10184069
455 Ga0307406_10646095
456 Ga0307406_10769846
457 Ga0307406_10946972
458 Ga0307407_10008342
459 Ga0307407_10013899
460 Ga0307407_10037516
461 Ga0307407_10075119
462 Ga0307407_10198470
463 Ga0307407_10586409
464 Ga0307407_10743820
465 Ga0307407_11306321
466 Ga0307412_10000535
467 Ga0307412_10010487
468 Ga0307412_10053137
469 Ga0307412_10100559
470 Ga0307412_10212412
471 Ga0307412_10248363
472 Ga0307412_10255727
473 Ga0307412_10569697
474 Ga0307412_10742541
475 Ga0307412_10999523
476 Ga0307409_100031918
477 Ga0307409_100036369
478 Ga0307409_100043801
479 Ga0307409_100082556
480 Ga0307409_100113457
481 Ga0307409_100175549
482 Ga0307409_100301964
483 Ga0307409_100445907
484 Ga0307409_100455754
485 Ga0307409_101505415
486 Ga0307416_100020995
487 Ga0307416_100035319
488 Ga0307416_100044722
489 Ga0307416_100063634
490 Ga0307416_100072240
491 Ga0307416_100090100
492 Ga0307416_100124860
493 Ga0307416_100137501
494 Ga0307416_100174870
495 Ga0307416_100191205
496 Ga0307416_100213305
497 Ga0307416_100658630
498 Ga0307416_100760396
499 Ga0307416_101158554
500 Ga0307416_101221634
501 Ga0307414_10011224
502 Ga0307414_10071191
503 Ga0307414_10202936
504 Ga0307414_10458333
505 Ga0307414_10579596
506 Ga0307411_10001115
507 Ga0307411_10073979
508 Ga0307411_10188685
509 Ga0307415_100042176
510 Ga0307415_100105642
511 Ga0307415_100241369
512 Ga0307415_100347175
513 Ga0307415_100472850
514 Ga0307415_100486662
515 Ga0307415_101149116
516 Ga0307415_101509414
517 Ga0395899_0067725
518 Ga0395899_0124837
519 Ga0395899_0392163
520 Ga0395900_0134982
521 Ga0395900_0178484
522 Ga0395900_0190664
523 Ga0395898_0432235
524 Ga0395905_0075686
525 Ga0395905_1777341
526 Ga0395901_0100665
527 Ga0395901_0120977
528 Ga0395901_0155316
529 Ga0395901_0776669
530 Ga0439439_0006237
531 Ga0439461_0009163
532 Ga0439466_0004392
533 Ga0439465_0005069
534 Ga0451800_0353823
535 Ga0439433_0000437
536 Ga0439433_0044064
537 Ga0439442_000015
538 Ga0439442_000502
539 Ga0439442_003271
540 Ga0439432_013990
541 Ga0439432_040194
542 Ga0439449_0011183
543 Ga0439449_0021138
544 Ga0439449_0079890
545 Ga0439457_063996
546 Ga0439462_0106120
547 Ga0450920_000208
548 Ga0450920_001077
549 Ga0450907_000019
550 Ga0450907_015608
551 Ga0439434_0000734
552 Ga0439434_0074093
553 Ga0439434_0135653
554 Ga0450918_000306
555 Ga0495590_0216000
556 Ga0495629_0058619
557 Ga0495653_0011758
558 Ga0495580_0270164
559 Ga0495582_0154203
560 Ga0495639_0001277
561 Ga0495639_0257920
562 Ga0495662_0030900
563 Ga0495664_0018746
564 Ga0495594_0063901
565 Ga0495594_0175520
566 Ga0495606_0001231
567 Ga0495610_0047818
568 Ga0495631_0154085
569 Ga0495642_0120113
570 Ga0495665_0000223
571 Ga0495665_0194503
572 Ga0495586_0032074
573 Ga0495587_0019049
574 Ga0495645_0026586
575 Ga0495667_0012135
576 Ga0495656_0001038
577 Ga0495656_0210699
578 Ga0495668_0000326
579 Ga0495625_0000770
580 Ga0495659_0202499
581 Ga0495661_0091661
582 Ga0495588_0044773
583 Ga0495588_0088438
584 Ga0495588_0116902
585 Ga0495588_0453651
586 Ga0495657_0060310
587 Ga0495623_0441455
588 Ga0495670_0004902
589 Ga0495670_0405580
590 Ga0495600_0029186
591 Ga0495600_0087144
592 Ga0495581_0031487
593 Ga0495581_0065253
594 Ga0495581_0101615
595 Ga0495581_0158880
596 Ga0495581_0169779
597 Ga0495581_0752116
598 Ga0495604_0543062
599 Ga0495636_0012789
600 Ga0495680_0013925
601 Ga0495683_0128677
602 Ga0495675_0093564
603 Ga0495677_0151059
604 Ga0495593_0197492
605 Ga0495615_0118159
606 Ga0495626_0000046
607 Ga0496100_0106401
608 Ga0496100_0126453
609 Ga0496101_0161454
610 Ga0496101_0415794
611 Ga0496101_0443943
612 Ga0496101_0755035
613 Ga0496102_0117919
614 Ga0496102_0147088
615 Ga0496102_0156316
616 Ga0496102_0192171
617 Ga0496102_0243790
618 Ga0496102_0680809
619 Ga0496103_0006684
620 Ga0496103_0035678
621 Ga0496103_0050157
622 Ga0496103_0164282
623 Ga0496104_0770689
624 Ga0496106_0189317
625 Ga0496106_0474912
626 Ga0496106_0797442
627 Ga0496107_0156315
628 Ga0496107_0310256
629 Ga0496107_0457645
630 Ga0496108_0112989
631 Ga0496108_0354766
632 Ga0496108_0510570
633 Ga0496109_0298738
634 Ga0496109_1063909
635 Ga0496110_0016045
636 Ga0496110_0074869
637 Ga0496110_0736476
638 Ga0496111_0030999
639 Ga0496111_0607169
640 Ga0496113_0108814
641 Ga0496113_0114484
642 Ga0496113_0505331
643 Ga0496114_0042778
644 Ga0496114_0058146
645 Ga0496114_0196770
646 Ga0496115_0029536
647 Ga0496119_0400772
648 Ga0496125_0122727
649 Ga0496125_0307019
650 Ga0501315_024312
651 Ga0501316_015531
652 Ga0501032_0972228
653 Ga0501037_0019532
654 Ga0501038_0018436
655 Ga0501038_0096147
656 Ga0501039_0894859
657 Ga0501202_041714
658 Ga0501202_089813
659 Ga0501216_032261
660 Ga0501217_023273
661 Ga0501235_210063
662 Ga0501243_010983
663 Ga0501252_007526
664 Ga0501253_031769
665 Ga0501261_064735
666 Ga0501229_038532
667 Ga0501234_037956
668 Ga0501266_014820
669 Ga0501279_021025
670 nmdc:mga00v17_29099_c1
671 Ga0495655_0002092
672 Ga0590075_094393
673 2623499061
674 2644102407
675 2644118069
676 2691512030
677 2775657065
678 2808829192
679 2808850416
680 2808893437
681 2808898496
682 2812319064
683 2887480069
684 2919051892
685 2919392610
686 2939601693
687 2945916814
688 2945922914
689 2945945220
690 2945956409
691 2946041393
692 2946060643
693 2954002575
694 8054109263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

42

128

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9013 6 153
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.884 6 153
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8782 14 148
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8595 14 148
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8546 10 153
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9046 6 153 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8817 6 153 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8568 7 144 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8565 7 144 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8325 34 151 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A495EFB3-F1-model_v4 AhpD family alkylhydroperoxidase 0.9903 4 155 GO:0051920
AF-A0A177YF52-F1-model_v4 Carboxymuconolactone decarboxylase 0.9895 6 154 GO:0051920
AF-A0A1G9HVZ7-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 0.9894 1 155 GO:0051920
AF-A0A7X6HFW8-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9885 6 155 GO:0051920
AF-A0A2L0QTR0-F1-model_v4 Carboxymuconolactone decarboxylase 0.9883 1 154 GO:0051920

Map