F417252

General Info

Members Datasets Scaffolds Average Seq Length
347 189 694 82

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_1571805|Ga0466967_1571805_88_354
Length 88
Sequence VNASNNRLLVWLAVIVGLLLIAVAVVYWAEPAHSLPSFFPGHVGAGSSEAHHHHVKHGIAAFLVGLACLAYAWFQTGSGRTRPAAPAP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
5 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
44 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
45 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
65 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
66 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
69 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
75 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
76 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
77 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
87 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
88 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
89 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
90 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
93 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
106 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
107 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 14.99
Rhizosphere 83.29
Stem 0
Stem Tuber 0
Unclassified 9.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_1571805 3300045976 Unclassified 655
2 Ga0070692_10621945 3300005345 Bacteria 717
3 Ga0070671_100264473 3300005355 Bacteria 1462
4 Ga0070673_100344563 3300005364 Bacteria 1321
5 Ga0070703_10456866 3300005406 Bacteria 567
6 Ga0070709_10140564 3300005434 Bacteria 1658
7 Ga0070709_10277914 3300005434 Bacteria 1216
8 Ga0070714_100064370 3300005435 Bacteria 3156
9 Ga0070714_100232560 3300005435 Bacteria 1699
10 Ga0070714_100780734 3300005435 Bacteria 924
11 Ga0070714_101039267 3300005435 Bacteria 798
12 Ga0070714_101762356 3300005435 Bacteria 605
13 Ga0070713_100320250 3300005436 Bacteria 1432
14 Ga0070713_100355464 3300005436 Unclassified 1360
15 Ga0070713_100533728 3300005436 Bacteria 1110
16 Ga0070713_101123474 3300005436 Bacteria 760
17 Ga0070713_101244138 3300005436 Bacteria 721
18 Ga0070713_101762649 3300005436 Unclassified 601
19 Ga0070713_101826441 3300005436 Bacteria 590
20 Ga0070710_10421643 3300005437 Bacteria 899
21 Ga0070710_10859730 3300005437 Bacteria 652
22 Ga0070710_11352309 3300005437 Unclassified 531
23 Ga0070711_100569679 3300005439 Bacteria 941
24 Ga0070711_100627818 3300005439 Bacteria 899
25 Ga0070711_100852145 3300005439 Bacteria 775
26 Ga0070711_101178760 3300005439 Bacteria 662
27 Ga0070705_100953205 3300005440 Bacteria 693
28 Ga0070708_100222033 3300005445 Bacteria 1772
29 Ga0070708_100589540 3300005445 Bacteria 1048
30 Ga0070708_100710771 3300005445 Bacteria 946
31 Ga0070681_10509268 3300005458 Bacteria 1117
32 Ga0070706_101916040 3300005467 Bacteria 538
33 Ga0070707_100103581 3300005468 Bacteria 2758
34 Ga0070707_100190093 3300005468 Bacteria 2002
35 Ga0070707_100358772 3300005468 Bacteria 1416
36 Ga0070707_100429943 3300005468 Bacteria 1281
37 Ga0070707_100621352 3300005468 Bacteria 1043
38 Ga0070707_100762737 3300005468 Bacteria 931
39 Ga0070707_101613031 3300005468 Bacteria 616
40 Ga0070707_101815844 3300005468 Bacteria 577
41 Ga0070698_100187068 3300005471 Bacteria 2009
42 Ga0070698_100776020 3300005471 Bacteria 902
43 Ga0070698_100972269 3300005471 Bacteria 796
44 Ga0070679_100163879 3300005530 Bacteria 2197
45 Ga0070679_101338700 3300005530 Bacteria 662
46 Ga0070679_101639316 3300005530 Bacteria 591
47 Ga0070695_100828704 3300005545 Bacteria 743
48 Ga0070695_100974273 3300005545 Bacteria 688
49 Ga0070696_100526482 3300005546 Bacteria 944
50 Ga0070704_100649078 3300005549 Unclassified 931
51 Ga0068860_100771086 3300005843 Bacteria 974
52 Ga0070717_10262875 3300006028 Bacteria 1527
53 Ga0070717_10736782 3300006028 Bacteria 896
54 Ga0075432_10041027 3300006058 Bacteria 1616
55 Ga0075432_10130330 3300006058 Bacteria 952
56 Ga0070715_10032783 3300006163 Bacteria 2118
57 Ga0070716_100042444 3300006173 Unclassified 2539
58 Ga0070716_101808807 3300006173 Bacteria 506
59 Ga0070712_101086966 3300006175 Bacteria 694
60 Ga0070712_101340725 3300006175 Bacteria 624
61 Ga0097621_100631884 3300006237 Bacteria 981
62 Ga0075433_10363725 3300006852 Unclassified 1278
63 Ga0075433_11026594 3300006852 Bacteria 718
64 Ga0075434_100760224 3300006871 Bacteria 986
65 Ga0075436_100007807 3300006914 Bacteria 7318
66 Ga0075436_100286220 3300006914 Unclassified 1179
67 Ga0075435_100207848 3300007076 Bacteria 1660
68 Ga0075435_100836006 3300007076 Bacteria 802
69 Ga0105247_10108794 3300009101 Bacteria 1781
70 Ga0114129_10757914 3300009147 Bacteria 1242
71 Ga0114129_12769619 3300009147 Bacteria 583
72 Ga0105241_11055979 3300009174 Bacteria 763
73 Ga0105242_12231677 3300009176 Bacteria 593
74 Ga0157320_1038123 3300012481 Unclassified 511
75 Ga0157370_10416500 3300013104 Bacteria 1236
76 Ga0157369_10374104 3300013105 Bacteria 1479
77 Ga0157374_10557847 3300013296 Bacteria 1153
78 Ga0157378_11794636 3300013297 Bacteria 661
79 Ga0157379_10322703 3300014968 Bacteria 1410
80 Ga0157376_10653315 3300014969 Bacteria 1052
81 Ga0213874_10466001 3300021377 Bacteria 501
82 Ga0213876_10159580 3300021384 Unclassified 1199
83 Ga0213871_10096890 3300021441 Bacteria 860
84 Ga0207692_10155516 3300025898 Bacteria 1313
85 Ga0207692_10501357 3300025898 Unclassified 770
86 Ga0207692_10710197 3300025898 Bacteria 653
87 Ga0207685_10090552 3300025905 Bacteria 1287
88 Ga0207699_10088274 3300025906 Bacteria 1940
89 Ga0207684_10187841 3300025910 Bacteria 1782
90 Ga0207684_10209245 3300025910 Bacteria 1683
91 Ga0207707_11663807 3300025912 Bacteria 501
92 Ga0207671_11461898 3300025914 Bacteria 528
93 Ga0207693_10270871 3300025915 Bacteria 1330
94 Ga0207693_10379441 3300025915 Bacteria 1106
95 Ga0207693_10534285 3300025915 Bacteria 915
96 Ga0207663_10047061 3300025916 Bacteria 2661
97 Ga0207663_10201598 3300025916 Bacteria 1436
98 Ga0207663_10704202 3300025916 Bacteria 800
99 Ga0207652_10483963 3300025921 Bacteria 1114
100 Ga0207652_10765263 3300025921 Bacteria 859
101 Ga0207652_10868790 3300025921 Bacteria 798
102 Ga0207646_10027291 3300025922 Bacteria 5207
103 Ga0207646_10135773 3300025922 Bacteria 2215
104 Ga0207646_10425653 3300025922 Bacteria 1198
105 Ga0207646_10585105 3300025922 Bacteria 1002
106 Ga0207687_10995842 3300025927 Bacteria 719
107 Ga0207700_10046445 3300025928 Bacteria 3211
108 Ga0207700_10431490 3300025928 Bacteria 1159
109 Ga0207700_10530596 3300025928 Bacteria 1043
110 Ga0207700_10813322 3300025928 Bacteria 836
111 Ga0207700_11201311 3300025928 Bacteria 677
112 Ga0207664_10222220 3300025929 Bacteria 1638
113 Ga0207664_10249915 3300025929 Bacteria 1547
114 Ga0207664_10285811 3300025929 Bacteria 1448
115 Ga0207664_10307383 3300025929 Bacteria 1396
116 Ga0207664_10574917 3300025929 Bacteria 1012
117 Ga0207664_11288938 3300025929 Bacteria 650
118 Ga0207686_11319252 3300025934 Bacteria 593
119 Ga0207665_10034672 3300025939 Bacteria 3348
120 Ga0207651_10409678 3300025960 Bacteria 1155
121 Ga0207702_11281280 3300026078 Bacteria 727
122 Ga0268264_10966233 3300028381 Bacteria 857
123 Ga0265326_10054629 3300028558 Bacteria 1130
124 Ga0265319_1004016 3300028563 Bacteria 7453
125 Ga0265334_10166646 3300028573 Unclassified 773
126 Ga0265334_10192815 3300028573 Unclassified 709
127 Ga0265334_10200942 3300028573 Bacteria 692
128 Ga0265318_10000633 3300028577 Bacteria 24181
129 Ga0265318_10017055 3300028577 Bacteria 2988
130 Ga0265322_10033887 3300028654 Bacteria 1456
131 Ga0265336_10071117 3300028666 Bacteria 1040
132 Ga0265336_10108699 3300028666 Bacteria 826
133 Ga0265338_10000811 3300028800 Bacteria 52712
134 Ga0265338_10011482 3300028800 Bacteria 10226
135 Ga0265338_10070756 3300028800 Bacteria 2988
136 Ga0265338_10229751 3300028800 Bacteria 1380
137 Ga0265338_10917077 3300028800 Bacteria 596
138 Ga0265324_10018349 3300029957 Bacteria 2532
139 Ga0265330_10002570 3300031235 Bacteria 9854
140 Ga0265330_10147584 3300031235 Unclassified 1000
141 Ga0265332_10010937 3300031238 Bacteria 4030
142 Ga0265332_10094487 3300031238 Bacteria 1263
143 Ga0265332_10128703 3300031238 Bacteria 1062
144 Ga0265332_10267751 3300031238 Bacteria 706
145 Ga0265328_10032599 3300031239 Bacteria 1933
146 Ga0265328_10235546 3300031239 Bacteria 699
147 Ga0265320_10016238 3300031240 Bacteria 4179
148 Ga0265320_10078665 3300031240 Unclassified 1542
149 Ga0265320_10172240 3300031240 Bacteria 972
150 Ga0265325_10405911 3300031241 Bacteria 596
151 Ga0265325_10405913 3300031241 Unclassified 596
152 Ga0265329_10156495 3300031242 Bacteria 739
153 Ga0265329_10314461 3300031242 Bacteria 531
154 Ga0265340_10059557 3300031247 Bacteria 1831
155 Ga0265339_10012547 3300031249 Bacteria 5170
156 Ga0265339_10218335 3300031249 Unclassified 933
157 Ga0265339_10321744 3300031249 Unclassified 733
158 Ga0265331_10202666 3300031250 Bacteria 893
159 Ga0265327_10001778 3300031251 Bacteria 25403
160 Ga0265327_10045276 3300031251 Bacteria 2340
161 Ga0265327_10081286 3300031251 Bacteria 1600
162 Ga0265327_10467139 3300031251 Bacteria 545
163 Ga0265316_10034615 3300031344 Bacteria 4101
164 Ga0265316_10291340 3300031344 Bacteria 1191
165 Ga0265316_10773578 3300031344 Bacteria 674
166 Ga0265313_10012054 3300031595 Bacteria 5324
167 Ga0265313_10292848 3300031595 Bacteria 655
168 Ga0265314_10017184 3300031711 Bacteria 5684
169 Ga0265314_10027406 3300031711 Bacteria 4266
170 Ga0265314_10147969 3300031711 Bacteria 1444
171 Ga0265342_10015125 3300031712 Bacteria 5089
172 Ga0265342_10206405 3300031712 Bacteria 1065
173 Ga0373948_0001379 3300034817 Bacteria 3347
174 Ga0373948_0128646 3300034817 Unclassified 618
175 Ga0373950_0038113 3300034818 Bacteria 912
176 Ga0373958_0030961 3300034819 Bacteria 1049
177 Ga0373959_0050146 3300034820 Bacteria 899
178 Ga0373938_0010339 3300034957 Bacteria 1713
179 Ga0373928_0044085 3300035084 Unclassified 1034
180 Ga0373929_0004709 3300035085 Bacteria 2447
181 Ga0373940_0161664 3300035088 Bacteria 719
182 Ga0373949_0127520 3300035090 Bacteria 719
183 Ga0373951_0001162 3300035091 Bacteria 6963
184 Ga0373952_0004718 3300035092 Bacteria 2478
185 Ga0373923_0185005 3300035111 Bacteria 958
186 Ga0373932_0019758 3300035112 Bacteria 1759
187 Ga0373932_0239525 3300035112 Bacteria 658
188 Ga0373939_0008595 3300035114 Bacteria 2507
189 Ga0373941_0257263 3300035115 Bacteria 683
190 Ga0373953_0115459 3300035117 Bacteria 1138
191 Ga0373956_0362711 3300035119 Bacteria 691
192 Ga0373960_0000483 3300035121 Bacteria 7887
193 Ga0373955_0030039 3300035172 Bacteria 2833
194 Ga0373942_0045809 3300035207 Bacteria 1209
195 Ga0373961_0010072 3300035241 Bacteria 2325
196 Ga0373962_0177299 3300035242 Bacteria 711
197 Ga0373931_0064734 3300035691 Bacteria 1979
198 Ga0373931_0106017 3300035691 Bacteria 1588
199 Ga0373933_0020996 3300035724 Bacteria 3705
200 Ga0373933_0539628 3300035724 Archaea 765
201 Ga0373947_0005706 3300035725 Bacteria 7259
202 Ga0373937_0005253 3300036401 Bacteria 11057
203 Ga0373937_1455596 3300036401 Bacteria 633
204 Ga0395899_0051801 3300037312 Bacteria 3045
205 Ga0395900_0541495 3300037418 Bacteria 1110
206 Ga0395900_0715799 3300037418 Bacteria 934
207 Ga0395900_0833673 3300037418 Bacteria 848
208 Ga0395900_1705893 3300037418 Bacteria 541
209 Ga0395898_1054255 3300037466 Bacteria 747
210 Ga0395898_1741330 3300037466 Bacteria 545
211 Ga0395905_0081498 3300037471 Bacteria 3032
212 Ga0395901_0256352 3300038443 Bacteria 1821
213 Ga0436365_1051947 3300039437 Bacteria 8860
214 Ga0436365_1513145 3300039437 Bacteria 2967
215 Ga0436360_0700288 3300039438 Bacteria 6291
216 Ga0436360_0731594 3300039438 Bacteria 15643
217 Ga0436363_1086184 3300039450 Bacteria 669
218 Ga0436363_1300003 3300039450 Bacteria 530
219 Ga0436362_0389061 3300039453 Bacteria 1089
220 Ga0451800_0138834 3300041459 Bacteria 843
221 Ga0466963_0224489 3300044694 Bacteria 1316
222 Ga0466957_0061865 3300044842 Bacteria 2299
223 Ga0466960_0005010 3300044901 Bacteria 5225
224 Ga0466960_0064389 3300044901 Bacteria 1808
225 Ga0466960_0360327 3300044901 Bacteria 831
226 Ga0466960_0700703 3300044901 Bacteria 607
227 Ga0466958_0016327 3300045836 Bacteria 4273
228 Ga0466958_1167771 3300045836 Bacteria 503
229 Ga0466967_0009671 3300045976 Bacteria 7172
230 Ga0466967_0035085 3300045976 Bacteria 4265
231 Ga0466967_0219817 3300045976 Bacteria 1805
232 Ga0466967_0219853 3300045976 Bacteria 1804
233 Ga0466967_0244777 3300045976 Bacteria 1711
234 Ga0466967_0546560 3300045976 Bacteria 1140
235 Ga0495592_0399239 3300046454 Bacteria 871
236 Ga0495641_0180112 3300046461 Unclassified 946
237 Ga0495641_0246162 3300046461 Bacteria 803
238 Ga0495651_0141468 3300046462 Bacteria 1744
239 Ga0495653_0008519 3300046463 Bacteria 8410
240 Ga0495582_0106512 3300046473 Bacteria 1573
241 Ga0495582_0187022 3300046473 Bacteria 1181
242 Ga0495594_0553861 3300046499 Bacteria 652
243 Ga0495608_0075450 3300046511 Bacteria 2197
244 Ga0495628_0698087 3300046516 Bacteria 717
245 Ga0495652_0595517 3300046529 Bacteria 755
246 Ga0495587_0304458 3300046536 Bacteria 891
247 Ga0495645_0224618 3300046543 Unclassified 1261
248 Ga0495667_0004579 3300046559 Bacteria 9345
249 Ga0495634_0011958 3300046642 Bacteria 6297
250 Ga0495634_0352664 3300046642 Unclassified 881
251 Ga0495634_0701336 3300046642 Bacteria 582
252 Ga0495635_0025912 3300046663 Bacteria 4084
253 Ga0495588_0002113 3300046674 Bacteria 8529
254 Ga0495657_0043191 3300046675 Bacteria 3075
255 Ga0495599_0769942 3300046678 Bacteria 551
256 Ga0495623_0599543 3300046679 Bacteria 572
257 Ga0495658_0251205 3300046683 Unclassified 1112
258 Ga0495613_0363181 3300046689 Bacteria 992
259 Ga0495624_0307877 3300046690 Bacteria 955
260 Ga0495600_0315767 3300046809 Bacteria 983
261 Ga0495581_0823745 3300047315 Bacteria 532
262 Ga0495674_0392924 3300047319 Bacteria 1121
263 Ga0495680_0094101 3300047322 Bacteria 2242
264 Ga0495675_0777006 3300047444 Unclassified 532
265 Ga0495684_0226614 3300047471 Bacteria 1368
266 Ga0495602_0848375 3300048088 Bacteria 611
267 Ga0496100_0033900 3300048903 Bacteria 3198
268 Ga0496100_0035025 3300048903 Bacteria 3155
269 Ga0496100_1363912 3300048903 Bacteria 560
270 Ga0496101_0202352 3300048904 Bacteria 1535
271 Ga0496101_0484777 3300048904 Bacteria 976
272 Ga0496101_1254387 3300048904 Bacteria 580
273 Ga0496102_0249074 3300048905 Bacteria 1675
274 Ga0496102_0359246 3300048905 Unclassified 1371
275 Ga0496102_1376924 3300048905 Bacteria 624
276 Ga0496103_0029435 3300048906 Bacteria 3338
277 Ga0496103_0155155 3300048906 Bacteria 1467
278 Ga0496104_0141354 3300048907 Bacteria 2312
279 Ga0496104_0547872 3300048907 Bacteria 1068
280 Ga0496104_0896449 3300048907 Bacteria 792
281 Ga0496105_0124999 3300048908 Bacteria 2120
282 Ga0496105_0187273 3300048908 Bacteria 1693
283 Ga0496105_0662431 3300048908 Bacteria 804
284 Ga0496105_1067250 3300048908 Bacteria 601
285 Ga0496106_0150498 3300048909 Bacteria 1835
286 Ga0496106_1000585 3300048909 Bacteria 657
287 Ga0496106_1522705 3300048909 Unclassified 514
288 Ga0496107_0028668 3300048910 Bacteria 3957
289 Ga0496107_0376154 3300048910 Bacteria 1056
290 Ga0496107_0512440 3300048910 Bacteria 889
291 Ga0496107_0811836 3300048910 Bacteria 685
292 Ga0496108_0001522 3300048911 Bacteria 18337
293 Ga0496108_0016309 3300048911 Bacteria 6059
294 Ga0496109_0105231 3300048912 Bacteria 2620
295 Ga0496109_0311717 3300048912 Bacteria 1484
296 Ga0496109_0360682 3300048912 Bacteria 1373
297 Ga0496109_0419045 3300048912 Bacteria 1265
298 Ga0496109_1522031 3300048912 Bacteria 604
299 Ga0496110_0052967 3300048913 Bacteria 3566
300 Ga0496110_0055467 3300048913 Bacteria 3487
301 Ga0496111_0055121 3300048914 Bacteria 2875
302 Ga0496111_0285758 3300048914 Bacteria 1223
303 Ga0496111_1081774 3300048914 Archaea 572
304 Ga0496112_0028782 3300048915 Bacteria 5366
305 Ga0496112_0226507 3300048915 Bacteria 1825
306 Ga0496112_0257361 3300048915 Bacteria 1695
307 Ga0496112_0264416 3300048915 Bacteria 1669
308 Ga0496112_0488173 3300048915 Bacteria 1168
309 Ga0496113_0160057 3300048916 Bacteria 1779
310 Ga0496113_0271466 3300048916 Bacteria 1355
311 Ga0496113_1112823 3300048916 Bacteria 619
312 Ga0496114_0043689 3300048917 Bacteria 3716
313 Ga0496114_0155309 3300048917 Bacteria 1987
314 Ga0496114_0220084 3300048917 Bacteria 1666
315 Ga0496115_0009644 3300048918 Bacteria 7183
316 Ga0496115_0022210 3300048918 Bacteria 4913
317 Ga0496115_0336648 3300048918 Bacteria 1232
318 Ga0501032_1003247 3300049569 Bacteria 524
319 Ga0501034_0227360 3300049571 Bacteria 1816
320 Ga0501046_0753245 3300049580 Bacteria 684
321 Ga0501047_0346670 3300049581 Bacteria 1322
322 Ga0501069_0804621 3300049585 Bacteria 570
323 Ga0501080_0551047 3300049742 Bacteria 1027
324 nmdc:mga05p37_1038941_c1 3300050507 Unclassified 866
325 nmdc:mga05p37_16747_c1 3300050507 Bacteria 8836
326 nmdc:mga05p37_831129_c1 3300050507 Bacteria 1006
327 nmdc:mga08y16_210155_c1 3300050511 Bacteria 2015
328 nmdc:mga08y16_767758_c1 3300050511 Bacteria 959
329 nmdc:mga0n895_2132609_c1 3300050512 Bacteria 517
330 nmdc:mga0n895_33842_c1 3300050512 Bacteria 4913
331 nmdc:mga0n895_448625_c1 3300050512 Bacteria 1302
332 nmdc:mga0rr50_1441426_c1 3300050513 Bacteria 583
333 nmdc:mga08x19_175707_c1 3300050514 Unclassified 1460
334 nmdc:mga08x19_22927_c1 3300050514 Bacteria 3871
335 nmdc:mga08x19_678217_c1 3300050514 Bacteria 731
336 nmdc:mga0a205_373327_c1 3300050515 Unclassified 1292
337 nmdc:mga0a205_508414_c1 3300050515 Bacteria 1062
338 nmdc:mga0a205_74132_c2 3300050515 Bacteria 1528
339 Ga0495655_0004849 3300053083 Unclassified 2335
340 Ga0495595_0111565 3300053084 Bacteria 1326
341 Ga0495595_0496876 3300053084 Unclassified 622
342 Ga0495619_0187091 3300053085 Unclassified 1433
343 Ga0587066_074064 3300059490 Bacteria 723
344 Ga0587070_079610 3300059491 Bacteria 716
345 Ga0587080_058050 3300059503 Bacteria 747
346 Ga0587079_242496 3300059647 Bacteria 510
347 Ga0587114_119009 3300059655 Bacteria 533
348 Ga0466967_1571805
349 Ga0070692_10621945
350 Ga0070671_100264473
351 Ga0070673_100344563
352 Ga0070703_10456866
353 Ga0070709_10140564
354 Ga0070709_10277914
355 Ga0070714_100064370
356 Ga0070714_100232560
357 Ga0070714_100780734
358 Ga0070714_101039267
359 Ga0070714_101762356
360 Ga0070713_100320250
361 Ga0070713_100355464
362 Ga0070713_100533728
363 Ga0070713_101123474
364 Ga0070713_101244138
365 Ga0070713_101762649
366 Ga0070713_101826441
367 Ga0070710_10421643
368 Ga0070710_10859730
369 Ga0070710_11352309
370 Ga0070711_100569679
371 Ga0070711_100627818
372 Ga0070711_100852145
373 Ga0070711_101178760
374 Ga0070705_100953205
375 Ga0070708_100222033
376 Ga0070708_100589540
377 Ga0070708_100710771
378 Ga0070681_10509268
379 Ga0070706_101916040
380 Ga0070707_100103581
381 Ga0070707_100190093
382 Ga0070707_100358772
383 Ga0070707_100429943
384 Ga0070707_100621352
385 Ga0070707_100762737
386 Ga0070707_101613031
387 Ga0070707_101815844
388 Ga0070698_100187068
389 Ga0070698_100776020
390 Ga0070698_100972269
391 Ga0070679_100163879
392 Ga0070679_101338700
393 Ga0070679_101639316
394 Ga0070695_100828704
395 Ga0070695_100974273
396 Ga0070696_100526482
397 Ga0070704_100649078
398 Ga0068860_100771086
399 Ga0070717_10262875
400 Ga0070717_10736782
401 Ga0075432_10041027
402 Ga0075432_10130330
403 Ga0070715_10032783
404 Ga0070716_100042444
405 Ga0070716_101808807
406 Ga0070712_101086966
407 Ga0070712_101340725
408 Ga0097621_100631884
409 Ga0075433_10363725
410 Ga0075433_11026594
411 Ga0075434_100760224
412 Ga0075436_100007807
413 Ga0075436_100286220
414 Ga0075435_100207848
415 Ga0075435_100836006
416 Ga0105247_10108794
417 Ga0114129_10757914
418 Ga0114129_12769619
419 Ga0105241_11055979
420 Ga0105242_12231677
421 Ga0157320_1038123
422 Ga0157370_10416500
423 Ga0157369_10374104
424 Ga0157374_10557847
425 Ga0157378_11794636
426 Ga0157379_10322703
427 Ga0157376_10653315
428 Ga0213874_10466001
429 Ga0213876_10159580
430 Ga0213871_10096890
431 Ga0207692_10155516
432 Ga0207692_10501357
433 Ga0207692_10710197
434 Ga0207685_10090552
435 Ga0207699_10088274
436 Ga0207684_10187841
437 Ga0207684_10209245
438 Ga0207707_11663807
439 Ga0207671_11461898
440 Ga0207693_10270871
441 Ga0207693_10379441
442 Ga0207693_10534285
443 Ga0207663_10047061
444 Ga0207663_10201598
445 Ga0207663_10704202
446 Ga0207652_10483963
447 Ga0207652_10765263
448 Ga0207652_10868790
449 Ga0207646_10027291
450 Ga0207646_10135773
451 Ga0207646_10425653
452 Ga0207646_10585105
453 Ga0207687_10995842
454 Ga0207700_10046445
455 Ga0207700_10431490
456 Ga0207700_10530596
457 Ga0207700_10813322
458 Ga0207700_11201311
459 Ga0207664_10222220
460 Ga0207664_10249915
461 Ga0207664_10285811
462 Ga0207664_10307383
463 Ga0207664_10574917
464 Ga0207664_11288938
465 Ga0207686_11319252
466 Ga0207665_10034672
467 Ga0207651_10409678
468 Ga0207702_11281280
469 Ga0268264_10966233
470 Ga0265326_10054629
471 Ga0265319_1004016
472 Ga0265334_10166646
473 Ga0265334_10192815
474 Ga0265334_10200942
475 Ga0265318_10000633
476 Ga0265318_10017055
477 Ga0265322_10033887
478 Ga0265336_10071117
479 Ga0265336_10108699
480 Ga0265338_10000811
481 Ga0265338_10011482
482 Ga0265338_10070756
483 Ga0265338_10229751
484 Ga0265338_10917077
485 Ga0265324_10018349
486 Ga0265330_10002570
487 Ga0265330_10147584
488 Ga0265332_10010937
489 Ga0265332_10094487
490 Ga0265332_10128703
491 Ga0265332_10267751
492 Ga0265328_10032599
493 Ga0265328_10235546
494 Ga0265320_10016238
495 Ga0265320_10078665
496 Ga0265320_10172240
497 Ga0265325_10405911
498 Ga0265325_10405913
499 Ga0265329_10156495
500 Ga0265329_10314461
501 Ga0265340_10059557
502 Ga0265339_10012547
503 Ga0265339_10218335
504 Ga0265339_10321744
505 Ga0265331_10202666
506 Ga0265327_10001778
507 Ga0265327_10045276
508 Ga0265327_10081286
509 Ga0265327_10467139
510 Ga0265316_10034615
511 Ga0265316_10291340
512 Ga0265316_10773578
513 Ga0265313_10012054
514 Ga0265313_10292848
515 Ga0265314_10017184
516 Ga0265314_10027406
517 Ga0265314_10147969
518 Ga0265342_10015125
519 Ga0265342_10206405
520 Ga0373948_0001379
521 Ga0373948_0128646
522 Ga0373950_0038113
523 Ga0373958_0030961
524 Ga0373959_0050146
525 Ga0373938_0010339
526 Ga0373928_0044085
527 Ga0373929_0004709
528 Ga0373940_0161664
529 Ga0373949_0127520
530 Ga0373951_0001162
531 Ga0373952_0004718
532 Ga0373923_0185005
533 Ga0373932_0019758
534 Ga0373932_0239525
535 Ga0373939_0008595
536 Ga0373941_0257263
537 Ga0373953_0115459
538 Ga0373956_0362711
539 Ga0373960_0000483
540 Ga0373955_0030039
541 Ga0373942_0045809
542 Ga0373961_0010072
543 Ga0373962_0177299
544 Ga0373931_0064734
545 Ga0373931_0106017
546 Ga0373933_0020996
547 Ga0373933_0539628
548 Ga0373947_0005706
549 Ga0373937_0005253
550 Ga0373937_1455596
551 Ga0395899_0051801
552 Ga0395900_0541495
553 Ga0395900_0715799
554 Ga0395900_0833673
555 Ga0395900_1705893
556 Ga0395898_1054255
557 Ga0395898_1741330
558 Ga0395905_0081498
559 Ga0395901_0256352
560 Ga0436365_1051947
561 Ga0436365_1513145
562 Ga0436360_0700288
563 Ga0436360_0731594
564 Ga0436363_1086184
565 Ga0436363_1300003
566 Ga0436362_0389061
567 Ga0451800_0138834
568 Ga0466963_0224489
569 Ga0466957_0061865
570 Ga0466960_0005010
571 Ga0466960_0064389
572 Ga0466960_0360327
573 Ga0466960_0700703
574 Ga0466958_0016327
575 Ga0466958_1167771
576 Ga0466967_0009671
577 Ga0466967_0035085
578 Ga0466967_0219817
579 Ga0466967_0219853
580 Ga0466967_0244777
581 Ga0466967_0546560
582 Ga0495592_0399239
583 Ga0495641_0180112
584 Ga0495641_0246162
585 Ga0495651_0141468
586 Ga0495653_0008519
587 Ga0495582_0106512
588 Ga0495582_0187022
589 Ga0495594_0553861
590 Ga0495608_0075450
591 Ga0495628_0698087
592 Ga0495652_0595517
593 Ga0495587_0304458
594 Ga0495645_0224618
595 Ga0495667_0004579
596 Ga0495634_0011958
597 Ga0495634_0352664
598 Ga0495634_0701336
599 Ga0495635_0025912
600 Ga0495588_0002113
601 Ga0495657_0043191
602 Ga0495599_0769942
603 Ga0495623_0599543
604 Ga0495658_0251205
605 Ga0495613_0363181
606 Ga0495624_0307877
607 Ga0495600_0315767
608 Ga0495581_0823745
609 Ga0495674_0392924
610 Ga0495680_0094101
611 Ga0495675_0777006
612 Ga0495684_0226614
613 Ga0495602_0848375
614 Ga0496100_0033900
615 Ga0496100_0035025
616 Ga0496100_1363912
617 Ga0496101_0202352
618 Ga0496101_0484777
619 Ga0496101_1254387
620 Ga0496102_0249074
621 Ga0496102_0359246
622 Ga0496102_1376924
623 Ga0496103_0029435
624 Ga0496103_0155155
625 Ga0496104_0141354
626 Ga0496104_0547872
627 Ga0496104_0896449
628 Ga0496105_0124999
629 Ga0496105_0187273
630 Ga0496105_0662431
631 Ga0496105_1067250
632 Ga0496106_0150498
633 Ga0496106_1000585
634 Ga0496106_1522705
635 Ga0496107_0028668
636 Ga0496107_0376154
637 Ga0496107_0512440
638 Ga0496107_0811836
639 Ga0496108_0001522
640 Ga0496108_0016309
641 Ga0496109_0105231
642 Ga0496109_0311717
643 Ga0496109_0360682
644 Ga0496109_0419045
645 Ga0496109_1522031
646 Ga0496110_0052967
647 Ga0496110_0055467
648 Ga0496111_0055121
649 Ga0496111_0285758
650 Ga0496111_1081774
651 Ga0496112_0028782
652 Ga0496112_0226507
653 Ga0496112_0257361
654 Ga0496112_0264416
655 Ga0496112_0488173
656 Ga0496113_0160057
657 Ga0496113_0271466
658 Ga0496113_1112823
659 Ga0496114_0043689
660 Ga0496114_0155309
661 Ga0496114_0220084
662 Ga0496115_0009644
663 Ga0496115_0022210
664 Ga0496115_0336648
665 Ga0501032_1003247
666 Ga0501034_0227360
667 Ga0501046_0753245
668 Ga0501047_0346670
669 Ga0501069_0804621
670 Ga0501080_0551047
671 nmdc:mga05p37_1038941_c1
672 nmdc:mga05p37_16747_c1
673 nmdc:mga05p37_831129_c1
674 nmdc:mga08y16_210155_c1
675 nmdc:mga08y16_767758_c1
676 nmdc:mga0n895_2132609_c1
677 nmdc:mga0n895_33842_c1
678 nmdc:mga0n895_448625_c1
679 nmdc:mga0rr50_1441426_c1
680 nmdc:mga08x19_175707_c1
681 nmdc:mga08x19_22927_c1
682 nmdc:mga08x19_678217_c1
683 nmdc:mga0a205_373327_c1
684 nmdc:mga0a205_508414_c1
685 nmdc:mga0a205_74132_c2
686 Ga0495655_0004849
687 Ga0495595_0111565
688 Ga0495595_0496876
689 Ga0495619_0187091
690 Ga0587066_074064
691 Ga0587070_079610
692 Ga0587080_058050
693 Ga0587079_242496
694 Ga0587114_119009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tz5-assembly1.cif.gz_AA cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (left-handed) 0.8668 3 71
6tz4-assembly1.cif.gz_JB cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (right-handed) 0.824 3 71
6e8g-assembly1.cif.gz_T cryoem reconstruction of ist1-chmp1b copolymer filament bound to ssdna at 2.9 angstrom resolution 0.7862 3 78
6grj-assembly1.cif.gz_E structure of the ahlb pore of the tripartite alpha-pore forming toxin, ahl, from aeromonas hydrophila. 0.7352 2 69
7a0g-assembly1.cif.gz_EEE structure of the smhb pore of the tripartite alpha-pore forming toxin, smh, from serratia marcescens. 0.7302 2 69
ID Description Score Start End Superfamily
af_Q9VRD7_1_131_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.8913 4 69 1.20.1070.10
af_Q4D6U6_190_409_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8187 2 69 1.20.1270.60
af_A0A0R0JDR7_566_680_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.814 2 69 1.20.140.150
af_A0A0R0HET1_39_153_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8122 2 69 1.20.140.150
af_A0A0R0GSE8_336_548_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7925 2 71 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1V8YDQ6-F1-model_v4 Uncharacterized protein 0.869 1 70 GO:0016020
AF-A0A7Y9SZN4-F1-model_v4 Uncharacterized protein 0.8567 2 70 GO:0016020
AF-A0A318LBP3-F1-model_v4 Uncharacterized protein 0.8383 7 66 GO:0016020
AF-A0A1B4BRW4-F1-model_v4 deleted 0.8325 2 69
AF-E8N7W0-F1-model_v4 Signal transduction histidine kinase 0.8294 1 74 GO:0016020
GO:0016301

Map