F417235

General Info

Members Datasets Scaffolds Average Seq Length
347 207 694 208

Family's Representative Sequence

Representative Sequence 3300041411|Ga0439466_0016709|Ga0439466_0016709_876_1637
Length 253
Sequence VFRKHKPFLVRRNRLDRAAAAVREETLCFGNTKSVRGDPAMSCAFDLAHYRDLLEAAKEGGYRFAFFEDAPREGDLLLRHDVDLSLDAALRLAELEAEAGAVATYFLMTGSVFYNRASPEGEAALARLRELGHRVGLHAVYPRVELDARFEPVLAWHNPDPEYMRAPVEGALNVMEPPWFDPETYRSDSNQHWRSGCPHEELRAGAFPWLQLLTHPEIWVYPGERMGETMRAMLEEEKERRLDQLAADRIDLS

Samples

Sample ID Description Type Environment
1 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
103 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
109 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
110 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
111 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
112 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
129 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
130 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
131 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
132 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
133 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
203 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
204 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 18.73
Rhizosphere 80.12
Stem 0
Stem Tuber 0
Unclassified 18.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439466_0016709 3300041411 Bacteria 2650
2 Ga0070658_10030069 3300005327 Bacteria 4365
3 Ga0070670_101084978 3300005331 Unclassified 730
4 Ga0070680_100151219 3300005336 Bacteria 1949
5 Ga0070682_100415542 3300005337 Unclassified 1021
6 Ga0070682_100767811 3300005337 Bacteria 780
7 Ga0070660_100035161 3300005339 Unclassified 3791
8 Ga0070660_100211425 3300005339 Bacteria 1575
9 Ga0070691_10221336 3300005341 Bacteria 1003
10 Ga0070661_100338685 3300005344 Bacteria 1178
11 Ga0070668_100068961 3300005347 Unclassified 2750
12 Ga0070671_100553716 3300005355 Bacteria 992
13 Ga0070674_100248441 3300005356 Bacteria 1396
14 Ga0070673_100160274 3300005364 Unclassified 1913
15 Ga0070709_10028707 3300005434 Bacteria 3321
16 Ga0070714_100016355 3300005435 Bacteria 5987
17 Ga0070714_100024225 3300005435 Bacteria 4994
18 Ga0070710_10025380 3300005437 Bacteria 3138
19 Ga0070708_100723874 3300005445 Unclassified 936
20 Ga0070708_100735223 3300005445 Unclassified 928
21 Ga0070678_100021286 3300005456 Bacteria 4273
22 Ga0070678_100125103 3300005456 Bacteria 2034
23 Ga0070678_101007596 3300005456 Bacteria 766
24 Ga0070662_100262781 3300005457 Bacteria 1391
25 Ga0070662_100343815 3300005457 Bacteria 1221
26 Ga0070681_10004691 3300005458 Bacteria 13075
27 Ga0070681_10129417 3300005458 Bacteria 2456
28 Ga0070698_100194514 3300005471 Bacteria 1965
29 Ga0070699_100106407 3300005518 Bacteria 2461
30 Ga0070699_100299487 3300005518 Bacteria 1443
31 Ga0070679_100006178 3300005530 Bacteria 11148
32 Ga0070679_100165764 3300005530 Bacteria 2183
33 Ga0070679_100600138 3300005530 Unclassified 1044
34 Ga0070684_100001943 3300005535 Bacteria 15167
35 Ga0070684_100522040 3300005535 Bacteria 1101
36 Ga0070695_100053968 3300005545 Bacteria 2585
37 Ga0070695_100335613 3300005545 Bacteria 1128
38 Ga0070696_100082041 3300005546 Unclassified 2285
39 Ga0070693_100033078 3300005547 Bacteria 2851
40 Ga0070693_100046490 3300005547 Bacteria 2465
41 Ga0070704_100174174 3300005549 Unclassified 1714
42 Ga0068855_100074318 3300005563 Bacteria 3948
43 Ga0070664_100068120 3300005564 Bacteria 3043
44 Ga0068857_100065356 3300005577 Bacteria 3234
45 Ga0068856_100057712 3300005614 Bacteria 3832
46 Ga0068856_100140371 3300005614 Bacteria 2423
47 Ga0068856_100240509 3300005614 Bacteria 1825
48 Ga0070702_100163813 3300005615 Bacteria 1440
49 Ga0070702_100717457 3300005615 Unclassified 764
50 Ga0068866_10155294 3300005718 Bacteria 1329
51 Ga0068870_10549651 3300005840 Bacteria 777
52 Ga0068862_100942943 3300005844 Unclassified 851
53 Ga0081455_10003553 3300005937 Bacteria 17891
54 Ga0081538_10033926 3300005981 Bacteria 3386
55 Ga0075365_10093227 3300006038 Bacteria 2054
56 Ga0075364_10543534 3300006051 Bacteria 794
57 Ga0075432_10097497 3300006058 Bacteria 1083
58 Ga0070715_10001299 3300006163 Bacteria 7175
59 Ga0070716_100053768 3300006173 Unclassified 2297
60 Ga0070712_100003278 3300006175 Bacteria 9957
61 Ga0097621_100218028 3300006237 Bacteria 1662
62 Ga0075431_100657353 3300006847 Bacteria 1028
63 Ga0075433_10386781 3300006852 Bacteria 1235
64 Ga0075434_100028178 3300006871 Bacteria 5517
65 Ga0075434_100239122 3300006871 Unclassified 1836
66 Ga0075434_100811091 3300006871 Bacteria 952
67 Ga0068865_100432964 3300006881 Bacteria 1084
68 Ga0075436_100036483 3300006914 Bacteria 3393
69 Ga0075435_100111492 3300007076 Bacteria 2276
70 Ga0075435_100332582 3300007076 Bacteria 1301
71 Ga0075435_100632192 3300007076 Unclassified 929
72 Ga0111539_10230256 3300009094 Bacteria 2158
73 Ga0105245_10031975 3300009098 Bacteria 4659
74 Ga0105245_10229178 3300009098 Bacteria 1796
75 Ga0105245_10541265 3300009098 Bacteria 1185
76 Ga0114129_10134356 3300009147 Bacteria 3395
77 Ga0114129_10826739 3300009147 Bacteria 1179
78 Ga0105243_10179622 3300009148 Bacteria 1839
79 Ga0105242_10076548 3300009176 Bacteria 2789
80 Ga0105242_11125756 3300009176 Bacteria 800
81 Ga0105248_10210328 3300009177 Unclassified 2192
82 Ga0105249_10381676 3300009553 Bacteria 1435
83 Ga0105239_10317944 3300010375 Unclassified 1755
84 Ga0105239_11238034 3300010375 Bacteria 860
85 Ga0105246_10171575 3300011119 Bacteria 1662
86 Ga0157370_10012410 3300013104 Bacteria 8836
87 Ga0157370_10073277 3300013104 Bacteria 3231
88 Ga0157369_10032149 3300013105 Bacteria 5771
89 Ga0157374_10185132 3300013296 Bacteria 2036
90 Ga0157374_10347419 3300013296 Bacteria 1473
91 Ga0157378_10347367 3300013297 Bacteria 1448
92 Ga0157378_10414419 3300013297 Bacteria 1330
93 Ga0163162_11695736 3300013306 Bacteria 722
94 Ga0157372_11879932 3300013307 Unclassified 688
95 Ga0163163_10483287 3300014325 Bacteria 1300
96 Ga0163163_10771365 3300014325 Bacteria 1025
97 Ga0163163_10837393 3300014325 Bacteria 983
98 Ga0163163_11342695 3300014325 Archaea 777
99 Ga0157380_10213773 3300014326 Archaea 1720
100 Ga0157377_10079240 3300014745 Bacteria 1916
101 Ga0157377_10128010 3300014745 Bacteria 1547
102 Ga0157377_10273852 3300014745 Bacteria 1103
103 Ga0157379_10663175 3300014968 Bacteria 977
104 Ga0157376_10089905 3300014969 Bacteria 2656
105 Ga0157376_10832438 3300014969 Unclassified 937
106 Ga0197907_10659960 3300020069 Bacteria 1571
107 Ga0207653_10010240 3300025885 Bacteria 2925
108 Ga0207699_10020420 3300025906 Bacteria 3551
109 Ga0207705_10748238 3300025909 Unclassified 759
110 Ga0207684_10028499 3300025910 Bacteria 4758
111 Ga0207695_10493987 3300025913 Unclassified 1106
112 Ga0207693_10003807 3300025915 Bacteria 12843
113 Ga0207693_10064448 3300025915 Unclassified 2871
114 Ga0207663_10001579 3300025916 Bacteria 10707
115 Ga0207660_10040935 3300025917 Bacteria 3246
116 Ga0207660_10078427 3300025917 Bacteria 2420
117 Ga0207657_10027092 3300025919 Bacteria 5254
118 Ga0207657_10144565 3300025919 Bacteria 1941
119 Ga0207649_10125742 3300025920 Bacteria 1735
120 Ga0207652_10023892 3300025921 Bacteria 5069
121 Ga0207652_10085035 3300025921 Bacteria 2772
122 Ga0207687_10064020 3300025927 Bacteria 2606
123 Ga0207687_10234733 3300025927 Bacteria 1450
124 Ga0207664_10027525 3300025929 Bacteria 4311
125 Ga0207644_10953959 3300025931 Unclassified 719
126 Ga0207706_10249194 3300025933 Bacteria 1552
127 Ga0207686_10536692 3300025934 Unclassified 913
128 Ga0207669_10138638 3300025937 Bacteria 1685
129 Ga0207704_10316642 3300025938 Bacteria 1202
130 Ga0207665_10003489 3300025939 Bacteria 10503
131 Ga0207691_10588886 3300025940 Bacteria 942
132 Ga0207661_10041405 3300025944 Bacteria 3626
133 Ga0207661_10619781 3300025944 Bacteria 994
134 Ga0207679_10111668 3300025945 Bacteria 2159
135 Ga0207667_10297019 3300025949 Bacteria 1650
136 Ga0207640_10170074 3300025981 Bacteria 1623
137 Ga0207658_10305107 3300025986 Bacteria 1373
138 Ga0207702_10014167 3300026078 Bacteria 6622
139 Ga0207702_10195397 3300026078 Bacteria 1872
140 Ga0207674_10025940 3300026116 Bacteria 6236
141 Ga0207683_10091721 3300026121 Bacteria 2707
142 Ga0207683_10232613 3300026121 Bacteria 1681
143 Ga0207683_10240248 3300026121 Bacteria 1652
144 Ga0207683_10259994 3300026121 Bacteria 1585
145 Ga0207698_10995046 3300026142 Bacteria 849
146 Ga0207428_10393832 3300027907 Bacteria 1015
147 Ga0307405_10641270 3300031731 Unclassified 872
148 Ga0307413_10321658 3300031824 Unclassified 1182
149 Ga0307409_100017142 3300031995 Bacteria 4817
150 Ga0307409_100035005 3300031995 Bacteria 3676
151 Ga0307409_101061853 3300031995 Bacteria 830
152 Ga0307416_100384037 3300032002 Bacteria 1436
153 Ga0307411_10278564 3300032005 Bacteria 1330
154 Ga0307415_100064040 3300032126 Bacteria 2557
155 Ga0373948_0003628 3300034817 Bacteria 2388
156 Ga0373938_0004746 3300034957 Unclassified 2280
157 Ga0373928_0011768 3300035084 Bacteria 1737
158 Ga0373929_0026090 3300035085 Bacteria 1218
159 Ga0373949_0021357 3300035090 Bacteria 1487
160 Ga0373951_0073915 3300035091 Bacteria 872
161 Ga0373932_0020983 3300035112 Unclassified 1719
162 Ga0373941_0008381 3300035115 Unclassified 2564
163 Ga0373960_0020915 3300035121 Unclassified 1734
164 Ga0373943_0225629 3300035170 Unclassified 1045
165 Ga0373961_0007513 3300035241 Bacteria 2638
166 Ga0373962_0004876 3300035242 Bacteria 3243
167 Ga0373931_0003414 3300035691 Bacteria 7128
168 Ga0373947_0018162 3300035725 Bacteria 4047
169 Ga0395899_0027378 3300037312 Bacteria 4299
170 Ga0395899_0225286 3300037312 Bacteria 1297
171 Ga0395899_0311780 3300037312 Bacteria 1062
172 Ga0395899_0361366 3300037312 Bacteria 969
173 Ga0395900_0075734 3300037418 Bacteria 3459
174 Ga0395900_0459512 3300037418 Bacteria 1228
175 Ga0395900_0555243 3300037418 Bacteria 1093
176 Ga0395898_0068137 3300037466 Bacteria 3444
177 Ga0395898_0068229 3300037466 Bacteria 3441
178 Ga0395898_0135573 3300037466 Unclassified 2357
179 Ga0395898_0272365 3300037466 Bacteria 1615
180 Ga0395898_0387118 3300037466 Unclassified 1333
181 Ga0395905_0023792 3300037471 Bacteria 5784
182 Ga0395905_0045984 3300037471 Bacteria 4094
183 Ga0395905_0093736 3300037471 Bacteria 2816
184 Ga0395905_0602491 3300037471 Bacteria 1000
185 Ga0395905_0922927 3300037471 Bacteria 776
186 Ga0395901_0007777 3300038443 Bacteria 10816
187 Ga0395901_0108930 3300038443 Unclassified 2908
188 Ga0395901_0210373 3300038443 Bacteria 2036
189 Ga0395901_0316814 3300038443 Bacteria 1614
190 Ga0395901_0339400 3300038443 Bacteria 1552
191 Ga0395901_0580642 3300038443 Bacteria 1132
192 Ga0439436_0042618 3300041404 Bacteria 1297
193 Ga0450917_003105 3300042120 Unclassified 1197
194 Ga0450920_028642 3300042122 Bacteria 1092
195 Ga0450906_007070 3300042145 Unclassified 2231
196 Ga0450910_017190 3300042147 Bacteria 1076
197 Ga0439446_0004739 3300042156 Bacteria 3460
198 Ga0450918_010766 3300042531 Unclassified 1596
199 Ga0466965_0045141 3300044683 Unclassified 2179
200 Ga0466961_0000537 3300044693 Bacteria 24146
201 Ga0466971_0000419 3300044719 Bacteria 16573
202 Ga0466970_0133550 3300044765 Bacteria 1364
203 Ga0466967_0000239 3300045976 Bacteria 23946
204 Ga0466967_0032451 3300045976 Bacteria 4410
205 Ga0495603_0061583 3300046455 Bacteria 2216
206 Ga0495629_0016222 3300046459 Bacteria 5347
207 Ga0495629_0092674 3300046459 Unclassified 2109
208 Ga0495629_0489693 3300046459 Bacteria 830
209 Ga0495584_0228926 3300046491 Unclassified 945
210 Ga0495594_0159698 3300046499 Unclassified 1281
211 Ga0495630_0119123 3300046517 Unclassified 2002
212 Ga0495644_0148349 3300046523 Bacteria 897
213 Ga0495586_0029243 3300046535 Unclassified 2949
214 Ga0495611_0179743 3300046648 Bacteria 989
215 Ga0495647_0002067 3300046681 Bacteria 6282
216 Ga0495658_0363321 3300046683 Bacteria 920
217 Ga0495613_0036886 3300046689 Bacteria 3624
218 Ga0495613_0162550 3300046689 Unclassified 1588
219 Ga0495670_0233074 3300046691 Bacteria 979
220 Ga0496100_0005724 3300048903 Bacteria 6723
221 Ga0496100_0531375 3300048903 Unclassified 908
222 Ga0496100_0543336 3300048903 Bacteria 898
223 Ga0496100_0605190 3300048903 Bacteria 851
224 Ga0496100_0787947 3300048903 Bacteria 744
225 Ga0496101_0009571 3300048904 Bacteria 6374
226 Ga0496101_0366118 3300048904 Bacteria 1133
227 Ga0496101_0381135 3300048904 Bacteria 1109
228 Ga0496102_0031573 3300048905 Bacteria 4753
229 Ga0496102_0121560 3300048905 Bacteria 2439
230 Ga0496102_0133396 3300048905 Bacteria 2326
231 Ga0496102_0158497 3300048905 Unclassified 2128
232 Ga0496102_0304929 3300048905 Bacteria 1501
233 Ga0496102_0972787 3300048905 Bacteria 769
234 Ga0496103_0076306 3300048906 Unclassified 2103
235 Ga0496103_0077339 3300048906 Bacteria 2089
236 Ga0496103_0239859 3300048906 Bacteria 1166
237 Ga0496104_0000467 3300048907 Bacteria 34852
238 Ga0496104_0040057 3300048907 Bacteria 4390
239 Ga0496104_0190142 3300048907 Bacteria 1964
240 Ga0496104_0392716 3300048907 Unclassified 1299
241 Ga0496105_0015353 3300048908 Bacteria 6102
242 Ga0496105_0043258 3300048908 Bacteria 3714
243 Ga0496105_0090124 3300048908 Bacteria 2533
244 Ga0496105_0211342 3300048908 Bacteria 1581
245 Ga0496106_0040035 3300048909 Unclassified 3508
246 Ga0496106_0187550 3300048909 Bacteria 1643
247 Ga0496107_0038147 3300048910 Unclassified 3447
248 Ga0496107_0053538 3300048910 Unclassified 2911
249 Ga0496107_0366258 3300048910 Bacteria 1072
250 Ga0496108_0029607 3300048911 Bacteria 4536
251 Ga0496108_0116758 3300048911 Unclassified 2286
252 Ga0496108_0182829 3300048911 Bacteria 1816
253 Ga0496109_0001489 3300048912 Bacteria 19459
254 Ga0496109_0049555 3300048912 Bacteria 3823
255 Ga0496109_0087694 3300048912 Unclassified 2874
256 Ga0496109_0087983 3300048912 Unclassified 2870
257 Ga0496109_0753680 3300048912 Bacteria 911
258 Ga0496110_0000385 3300048913 Bacteria 29685
259 Ga0496110_0011363 3300048913 Bacteria 7285
260 Ga0496110_0059555 3300048913 Bacteria 3366
261 Ga0496110_0153185 3300048913 Bacteria 2088
262 Ga0496110_0178512 3300048913 Unclassified 1928
263 Ga0496110_0238245 3300048913 Unclassified 1655
264 Ga0496110_0345076 3300048913 Bacteria 1356
265 Ga0496111_0000034 3300048914 Bacteria 54519
266 Ga0496111_0005010 3300048914 Bacteria 8426
267 Ga0496111_0080784 3300048914 Unclassified 2372
268 Ga0496111_0190315 3300048914 Bacteria 1525
269 Ga0496111_0219563 3300048914 Bacteria 1412
270 Ga0496112_0075595 3300048915 Bacteria 3331
271 Ga0496112_0532108 3300048915 Bacteria 1109
272 Ga0496112_1177888 3300048915 Unclassified 683
273 Ga0496113_0014869 3300048916 Bacteria 5326
274 Ga0496113_0038186 3300048916 Bacteria 3530
275 Ga0496113_0129366 3300048916 Unclassified 1980
276 Ga0496113_0148130 3300048916 Unclassified 1850
277 Ga0496113_0191773 3300048916 Bacteria 1622
278 Ga0496114_0005302 3300048917 Bacteria 10074
279 Ga0496114_0006811 3300048917 Bacteria 9001
280 Ga0496114_0039456 3300048917 Bacteria 3908
281 Ga0496114_0067730 3300048917 Bacteria 2995
282 Ga0496114_0201253 3300048917 Bacteria 1744
283 Ga0496115_0149025 3300048918 Bacteria 1931
284 Ga0496115_0176909 3300048918 Unclassified 1764
285 Ga0501031_0009093 3300049568 Bacteria 6460
286 Ga0501032_0065583 3300049569 Bacteria 2428
287 Ga0501033_0035368 3300049570 Bacteria 3745
288 Ga0501036_0009972 3300049572 Bacteria 7821
289 Ga0501036_0116212 3300049572 Bacteria 2260
290 Ga0501037_0065740 3300049573 Bacteria 2642
291 Ga0501038_0046517 3300049574 Bacteria 3762
292 Ga0501039_0005684 3300049575 Bacteria 9446
293 Ga0501039_0315039 3300049575 Bacteria 1230
294 Ga0501040_0004081 3300049576 Bacteria 9490
295 Ga0501041_0001002 3300049577 Bacteria 15450
296 Ga0501041_0162745 3300049577 Unclassified 1395
297 Ga0501041_0234394 3300049577 Bacteria 1153
298 Ga0501042_0010620 3300049578 Bacteria 6185
299 Ga0501046_0195184 3300049580 Bacteria 1508
300 Ga0501048_0002066 3300049582 Bacteria 15277
301 Ga0501067_0036621 3300049583 Bacteria 2724
302 Ga0501069_0051984 3300049585 Bacteria 2281
303 Ga0501069_0179754 3300049585 Bacteria 1223
304 Ga0501069_0296568 3300049585 Bacteria 947
305 Ga0501070_0192426 3300049586 Bacteria 1676
306 Ga0501070_0698974 3300049586 Bacteria 802
307 Ga0501071_0003233 3300049587 Bacteria 10159
308 Ga0501072_0001091 3300049588 Bacteria 20173
309 Ga0501074_0031356 3300049590 Bacteria 3851
310 Ga0501075_0003584 3300049591 Bacteria 10399
311 Ga0501076_0004090 3300049592 Bacteria 10313
312 Ga0501076_0202101 3300049592 Bacteria 1623
313 Ga0501077_0001531 3300049593 Bacteria 13933
314 Ga0501077_0173455 3300049593 Unclassified 1370
315 Ga0501079_0004475 3300049741 Bacteria 10371
316 Ga0501079_0111545 3300049741 Bacteria 2125
317 Ga0501080_0020241 3300049742 Bacteria 6159
318 Ga0501080_0454644 3300049742 Unclassified 1148
319 Ga0501081_0001497 3300049743 Bacteria 14319
320 Ga0501081_0096650 3300049743 Bacteria 2084
321 Ga0501083_0123918 3300049744 Bacteria 1694
322 Ga0501035_0051593 3300049822 Bacteria 3682
323 Ga0501045_0004364 3300049824 Bacteria 9749
324 Ga0501045_0470800 3300049824 Unclassified 934
325 nmdc:mga00v17_595868_c1 3300050491 Bacteria 713
326 nmdc:mga0yw44_34504_c1 3300050492 Bacteria 2965
327 nmdc:mga05p37_532727_c1 3300050507 Bacteria 1341
328 nmdc:mga0n895_232887_c1 3300050512 Bacteria 1869
329 nmdc:mga0n895_40412_c1 3300050512 Bacteria 4530
330 nmdc:mga0rr50_515638_c1 3300050513 Bacteria 1017
331 nmdc:mga08x19_196253_c1 3300050514 Bacteria 1382
332 nmdc:mga0a205_153555_c1 3300050515 Bacteria 2201
333 nmdc:mga0a205_222055_c1 3300050515 Bacteria 1775
334 nmdc:mga0a205_225127_c1 3300050515 Bacteria 1760
335 Ga0495601_0482076 3300053077 Bacteria 801
336 Ga0501084_0004438 3300054114 Bacteria 11451
337 Ga0501084_0161190 3300054114 Bacteria 1892
338 Ga0501084_0253617 3300054114 Bacteria 1485
339 Ga0590075_016986 3300059424 Bacteria 1792
340 Ga0590077_029660 3300059426 Bacteria 1191
341 Ga0501082_0009780 3300060353 Bacteria 8262
342 Ga0501082_0071164 3300060353 Bacteria 2995
343 Ga0501082_0376962 3300060353 Bacteria 1238
344 Ga0501082_0561070 3300060353 Bacteria 999
345 Ga0466962_0000105 3300061719 Bacteria 34251
346 Ga0530510_0003544 3300061734 Bacteria 10747
347 Ga0530510_0053250 3300061734 Bacteria 2925
348 Ga0439466_0016709
349 Ga0070658_10030069
350 Ga0070670_101084978
351 Ga0070680_100151219
352 Ga0070682_100415542
353 Ga0070682_100767811
354 Ga0070660_100035161
355 Ga0070660_100211425
356 Ga0070691_10221336
357 Ga0070661_100338685
358 Ga0070668_100068961
359 Ga0070671_100553716
360 Ga0070674_100248441
361 Ga0070673_100160274
362 Ga0070709_10028707
363 Ga0070714_100016355
364 Ga0070714_100024225
365 Ga0070710_10025380
366 Ga0070708_100723874
367 Ga0070708_100735223
368 Ga0070678_100021286
369 Ga0070678_100125103
370 Ga0070678_101007596
371 Ga0070662_100262781
372 Ga0070662_100343815
373 Ga0070681_10004691
374 Ga0070681_10129417
375 Ga0070698_100194514
376 Ga0070699_100106407
377 Ga0070699_100299487
378 Ga0070679_100006178
379 Ga0070679_100165764
380 Ga0070679_100600138
381 Ga0070684_100001943
382 Ga0070684_100522040
383 Ga0070695_100053968
384 Ga0070695_100335613
385 Ga0070696_100082041
386 Ga0070693_100033078
387 Ga0070693_100046490
388 Ga0070704_100174174
389 Ga0068855_100074318
390 Ga0070664_100068120
391 Ga0068857_100065356
392 Ga0068856_100057712
393 Ga0068856_100140371
394 Ga0068856_100240509
395 Ga0070702_100163813
396 Ga0070702_100717457
397 Ga0068866_10155294
398 Ga0068870_10549651
399 Ga0068862_100942943
400 Ga0081455_10003553
401 Ga0081538_10033926
402 Ga0075365_10093227
403 Ga0075364_10543534
404 Ga0075432_10097497
405 Ga0070715_10001299
406 Ga0070716_100053768
407 Ga0070712_100003278
408 Ga0097621_100218028
409 Ga0075431_100657353
410 Ga0075433_10386781
411 Ga0075434_100028178
412 Ga0075434_100239122
413 Ga0075434_100811091
414 Ga0068865_100432964
415 Ga0075436_100036483
416 Ga0075435_100111492
417 Ga0075435_100332582
418 Ga0075435_100632192
419 Ga0111539_10230256
420 Ga0105245_10031975
421 Ga0105245_10229178
422 Ga0105245_10541265
423 Ga0114129_10134356
424 Ga0114129_10826739
425 Ga0105243_10179622
426 Ga0105242_10076548
427 Ga0105242_11125756
428 Ga0105248_10210328
429 Ga0105249_10381676
430 Ga0105239_10317944
431 Ga0105239_11238034
432 Ga0105246_10171575
433 Ga0157370_10012410
434 Ga0157370_10073277
435 Ga0157369_10032149
436 Ga0157374_10185132
437 Ga0157374_10347419
438 Ga0157378_10347367
439 Ga0157378_10414419
440 Ga0163162_11695736
441 Ga0157372_11879932
442 Ga0163163_10483287
443 Ga0163163_10771365
444 Ga0163163_10837393
445 Ga0163163_11342695
446 Ga0157380_10213773
447 Ga0157377_10079240
448 Ga0157377_10128010
449 Ga0157377_10273852
450 Ga0157379_10663175
451 Ga0157376_10089905
452 Ga0157376_10832438
453 Ga0197907_10659960
454 Ga0207653_10010240
455 Ga0207699_10020420
456 Ga0207705_10748238
457 Ga0207684_10028499
458 Ga0207695_10493987
459 Ga0207693_10003807
460 Ga0207693_10064448
461 Ga0207663_10001579
462 Ga0207660_10040935
463 Ga0207660_10078427
464 Ga0207657_10027092
465 Ga0207657_10144565
466 Ga0207649_10125742
467 Ga0207652_10023892
468 Ga0207652_10085035
469 Ga0207687_10064020
470 Ga0207687_10234733
471 Ga0207664_10027525
472 Ga0207644_10953959
473 Ga0207706_10249194
474 Ga0207686_10536692
475 Ga0207669_10138638
476 Ga0207704_10316642
477 Ga0207665_10003489
478 Ga0207691_10588886
479 Ga0207661_10041405
480 Ga0207661_10619781
481 Ga0207679_10111668
482 Ga0207667_10297019
483 Ga0207640_10170074
484 Ga0207658_10305107
485 Ga0207702_10014167
486 Ga0207702_10195397
487 Ga0207674_10025940
488 Ga0207683_10091721
489 Ga0207683_10232613
490 Ga0207683_10240248
491 Ga0207683_10259994
492 Ga0207698_10995046
493 Ga0207428_10393832
494 Ga0307405_10641270
495 Ga0307413_10321658
496 Ga0307409_100017142
497 Ga0307409_100035005
498 Ga0307409_101061853
499 Ga0307416_100384037
500 Ga0307411_10278564
501 Ga0307415_100064040
502 Ga0373948_0003628
503 Ga0373938_0004746
504 Ga0373928_0011768
505 Ga0373929_0026090
506 Ga0373949_0021357
507 Ga0373951_0073915
508 Ga0373932_0020983
509 Ga0373941_0008381
510 Ga0373960_0020915
511 Ga0373943_0225629
512 Ga0373961_0007513
513 Ga0373962_0004876
514 Ga0373931_0003414
515 Ga0373947_0018162
516 Ga0395899_0027378
517 Ga0395899_0225286
518 Ga0395899_0311780
519 Ga0395899_0361366
520 Ga0395900_0075734
521 Ga0395900_0459512
522 Ga0395900_0555243
523 Ga0395898_0068137
524 Ga0395898_0068229
525 Ga0395898_0135573
526 Ga0395898_0272365
527 Ga0395898_0387118
528 Ga0395905_0023792
529 Ga0395905_0045984
530 Ga0395905_0093736
531 Ga0395905_0602491
532 Ga0395905_0922927
533 Ga0395901_0007777
534 Ga0395901_0108930
535 Ga0395901_0210373
536 Ga0395901_0316814
537 Ga0395901_0339400
538 Ga0395901_0580642
539 Ga0439436_0042618
540 Ga0450917_003105
541 Ga0450920_028642
542 Ga0450906_007070
543 Ga0450910_017190
544 Ga0439446_0004739
545 Ga0450918_010766
546 Ga0466965_0045141
547 Ga0466961_0000537
548 Ga0466971_0000419
549 Ga0466970_0133550
550 Ga0466967_0000239
551 Ga0466967_0032451
552 Ga0495603_0061583
553 Ga0495629_0016222
554 Ga0495629_0092674
555 Ga0495629_0489693
556 Ga0495584_0228926
557 Ga0495594_0159698
558 Ga0495630_0119123
559 Ga0495644_0148349
560 Ga0495586_0029243
561 Ga0495611_0179743
562 Ga0495647_0002067
563 Ga0495658_0363321
564 Ga0495613_0036886
565 Ga0495613_0162550
566 Ga0495670_0233074
567 Ga0496100_0005724
568 Ga0496100_0531375
569 Ga0496100_0543336
570 Ga0496100_0605190
571 Ga0496100_0787947
572 Ga0496101_0009571
573 Ga0496101_0366118
574 Ga0496101_0381135
575 Ga0496102_0031573
576 Ga0496102_0121560
577 Ga0496102_0133396
578 Ga0496102_0158497
579 Ga0496102_0304929
580 Ga0496102_0972787
581 Ga0496103_0076306
582 Ga0496103_0077339
583 Ga0496103_0239859
584 Ga0496104_0000467
585 Ga0496104_0040057
586 Ga0496104_0190142
587 Ga0496104_0392716
588 Ga0496105_0015353
589 Ga0496105_0043258
590 Ga0496105_0090124
591 Ga0496105_0211342
592 Ga0496106_0040035
593 Ga0496106_0187550
594 Ga0496107_0038147
595 Ga0496107_0053538
596 Ga0496107_0366258
597 Ga0496108_0029607
598 Ga0496108_0116758
599 Ga0496108_0182829
600 Ga0496109_0001489
601 Ga0496109_0049555
602 Ga0496109_0087694
603 Ga0496109_0087983
604 Ga0496109_0753680
605 Ga0496110_0000385
606 Ga0496110_0011363
607 Ga0496110_0059555
608 Ga0496110_0153185
609 Ga0496110_0178512
610 Ga0496110_0238245
611 Ga0496110_0345076
612 Ga0496111_0000034
613 Ga0496111_0005010
614 Ga0496111_0080784
615 Ga0496111_0190315
616 Ga0496111_0219563
617 Ga0496112_0075595
618 Ga0496112_0532108
619 Ga0496112_1177888
620 Ga0496113_0014869
621 Ga0496113_0038186
622 Ga0496113_0129366
623 Ga0496113_0148130
624 Ga0496113_0191773
625 Ga0496114_0005302
626 Ga0496114_0006811
627 Ga0496114_0039456
628 Ga0496114_0067730
629 Ga0496114_0201253
630 Ga0496115_0149025
631 Ga0496115_0176909
632 Ga0501031_0009093
633 Ga0501032_0065583
634 Ga0501033_0035368
635 Ga0501036_0009972
636 Ga0501036_0116212
637 Ga0501037_0065740
638 Ga0501038_0046517
639 Ga0501039_0005684
640 Ga0501039_0315039
641 Ga0501040_0004081
642 Ga0501041_0001002
643 Ga0501041_0162745
644 Ga0501041_0234394
645 Ga0501042_0010620
646 Ga0501046_0195184
647 Ga0501048_0002066
648 Ga0501067_0036621
649 Ga0501069_0051984
650 Ga0501069_0179754
651 Ga0501069_0296568
652 Ga0501070_0192426
653 Ga0501070_0698974
654 Ga0501071_0003233
655 Ga0501072_0001091
656 Ga0501074_0031356
657 Ga0501075_0003584
658 Ga0501076_0004090
659 Ga0501076_0202101
660 Ga0501077_0001531
661 Ga0501077_0173455
662 Ga0501079_0004475
663 Ga0501079_0111545
664 Ga0501080_0020241
665 Ga0501080_0454644
666 Ga0501081_0001497
667 Ga0501081_0096650
668 Ga0501083_0123918
669 Ga0501035_0051593
670 Ga0501045_0004364
671 Ga0501045_0470800
672 nmdc:mga00v17_595868_c1
673 nmdc:mga0yw44_34504_c1
674 nmdc:mga05p37_532727_c1
675 nmdc:mga0n895_232887_c1
676 nmdc:mga0n895_40412_c1
677 nmdc:mga0rr50_515638_c1
678 nmdc:mga08x19_196253_c1
679 nmdc:mga0a205_153555_c1
680 nmdc:mga0a205_222055_c1
681 nmdc:mga0a205_225127_c1
682 Ga0495601_0482076
683 Ga0501084_0004438
684 Ga0501084_0161190
685 Ga0501084_0253617
686 Ga0590075_016986
687 Ga0590077_029660
688 Ga0501082_0009780
689 Ga0501082_0071164
690 Ga0501082_0376962
691 Ga0501082_0561070
692 Ga0466962_0000105
693 Ga0530510_0003544
694 Ga0530510_0053250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8252 31 98
4qys-assembly1.cif.gz_A trpb2 enzymes 0.8008 37 97
2vyo-assembly1.cif.gz_A chitin deacetylase family member from encephalitozoon cuniculi 0.7828 28 98
5ygr-assembly2.cif.gz_C crystal structure of plp bound diaminopropionate ammonia lyase from salmonella typhimurium 0.7791 36 95
7cs2-assembly3.cif.gz_E apo structure of dimeric iiplr1 0.7581 37 99
ID Description Score Start End Superfamily
4qysA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8008 37 97 3.40.50.1100
2vyoA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.7828 28 98 3.20.20.370
af_K7K156_39_177_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7697 38 99 3.40.50.720
af_A0A1D6IP12_4_87_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7531 38 104 3.40.50.20
5c3uA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7426 36 99 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A7W0JLK0-F1-model_v4 Uncharacterized protein 0.9918 1 213
AF-A0A7W1H368-F1-model_v4 Uncharacterized protein 0.9885 1 213
AF-A0A7W0JLK0-F1-model_v4 Uncharacterized protein 0.9872 1 213
AF-A0A7W0TRI9-F1-model_v4 Uncharacterized protein 0.9862 1 183
AF-A0A7W0TRI9-F1-model_v4 Uncharacterized protein 0.9756 1 183

Map