F417188

General Info

Members Datasets Scaffolds Average Seq Length
347 163 694 82

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10012583|Ga0268264_1001258311
Length 94
Sequence LTDVEIRNYNVVMKSQIIQIGNSQGIRIPKVLLEESGLRGDVDLELCPEGVLIRNIQKPRAGWDEAFKTMTENEDDDLQGSDVSTAFEKKEWQW

Samples

Sample ID Description Type Environment
1 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
146 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
147 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
152 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
153 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
154 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
155 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
158 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
159 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
160 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
161 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.88
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 14.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268264_10012583 3300028381 Bacteria 6969
2 Ga0065704_10224818 3300005289 Unclassified 1062
3 Ga0065712_10129989 3300005290 Bacteria 1561
4 Ga0065715_10988937 3300005293 Bacteria 548
5 Ga0070690_100257088 3300005330 Bacteria 1237
6 Ga0070670_100002158 3300005331 Bacteria 16150
7 Ga0070670_100063757 3300005331 Bacteria 3162
8 Ga0070677_10255217 3300005333 Bacteria 872
9 Ga0070677_10267277 3300005333 Bacteria 856
10 Ga0070677_10289275 3300005333 Bacteria 828
11 Ga0068869_100164796 3300005334 Bacteria 1728
12 Ga0068869_101078751 3300005334 Bacteria 702
13 Ga0070666_10030634 3300005335 Bacteria 3546
14 Ga0068868_100303402 3300005338 Bacteria 1357
15 Ga0068868_100549872 3300005338 Bacteria 1017
16 Ga0070689_100407055 3300005340 Bacteria 1151
17 Ga0070692_10489263 3300005345 Bacteria 795
18 Ga0070668_100161281 3300005347 Bacteria 1820
19 Ga0070668_100235874 3300005347 Bacteria 1514
20 Ga0070668_100383822 3300005347 Bacteria 1196
21 Ga0070675_100012592 3300005354 Bacteria 6632
22 Ga0070675_100097301 3300005354 Bacteria 2474
23 Ga0070675_100370880 3300005354 Bacteria 1272
24 Ga0070671_100247865 3300005355 Bacteria 1513
25 Ga0070671_100275439 3300005355 Bacteria 1430
26 Ga0070671_100419213 3300005355 Bacteria 1146
27 Ga0070671_100828717 3300005355 Bacteria 806
28 Ga0070674_100014135 3300005356 Bacteria 4956
29 Ga0070674_100138966 3300005356 Bacteria 1821
30 Ga0070673_100095529 3300005364 Bacteria 2438
31 Ga0070673_102290344 3300005364 Unclassified 513
32 Ga0070688_100735000 3300005365 Bacteria 767
33 Ga0070659_101089362 3300005366 Unclassified 704
34 Ga0070667_100018385 3300005367 Bacteria 5797
35 Ga0070667_100233105 3300005367 Bacteria 1642
36 Ga0070701_10363676 3300005438 Bacteria 907
37 Ga0070663_100996178 3300005455 Bacteria 728
38 Ga0070678_100052484 3300005456 Bacteria 2961
39 Ga0070678_100543759 3300005456 Bacteria 1030
40 Ga0070678_100546409 3300005456 Bacteria 1028
41 Ga0070662_100283923 3300005457 Bacteria 1340
42 Ga0068867_100120024 3300005459 Bacteria 2031
43 Ga0068867_100187963 3300005459 Bacteria 1647
44 Ga0068867_100443675 3300005459 Bacteria 1104
45 Ga0068867_101286579 3300005459 Unclassified 674
46 Ga0068867_102211133 3300005459 Unclassified 522
47 Ga0070685_10051358 3300005466 Bacteria 2384
48 Ga0070685_11101483 3300005466 Unclassified 600
49 Ga0070698_100074861 3300005471 Bacteria 3391
50 Ga0070679_101123177 3300005530 Bacteria 731
51 Ga0070684_100736731 3300005535 Unclassified 920
52 Ga0070684_101545610 3300005535 Bacteria 626
53 Ga0068853_100062432 3300005539 Bacteria 3224
54 Ga0070672_100044127 3300005543 Bacteria 3442
55 Ga0070672_100049218 3300005543 Bacteria 3278
56 Ga0070672_101409497 3300005543 Unclassified 623
57 Ga0070686_100092081 3300005544 Bacteria 2029
58 Ga0070696_100741622 3300005546 Bacteria 804
59 Ga0068855_100403025 3300005563 Bacteria 1499
60 Ga0070664_100040892 3300005564 Bacteria 3911
61 Ga0070664_100227758 3300005564 Bacteria 1670
62 Ga0070664_100861576 3300005564 Bacteria 848
63 Ga0068857_100980503 3300005577 Bacteria 813
64 Ga0068854_101378480 3300005578 Bacteria 637
65 Ga0068854_102264558 3300005578 Bacteria 503
66 Ga0070702_100027864 3300005615 Bacteria 3054
67 Ga0068852_100401202 3300005616 Bacteria 1349
68 Ga0068852_100808943 3300005616 Bacteria 952
69 Ga0068859_100028886 3300005617 Bacteria 5562
70 Ga0068859_100748102 3300005617 Bacteria 1066
71 Ga0068864_100226039 3300005618 Bacteria 1729
72 Ga0068864_100612672 3300005618 Bacteria 1057
73 Ga0068864_101374645 3300005618 Bacteria 707
74 Ga0068866_11005045 3300005718 Bacteria 593
75 Ga0068861_100743334 3300005719 Bacteria 916
76 Ga0068861_101359665 3300005719 Bacteria 692
77 Ga0068870_10664736 3300005840 Bacteria 715
78 Ga0068863_100491758 3300005841 Bacteria 1207
79 Ga0068863_100807993 3300005841 Unclassified 935
80 Ga0068863_102737876 3300005841 Bacteria 502
81 Ga0068858_100113671 3300005842 Bacteria 2528
82 Ga0068858_100285193 3300005842 Bacteria 1573
83 Ga0068858_100371581 3300005842 Bacteria 1371
84 Ga0068860_100043733 3300005843 Bacteria 4271
85 Ga0068860_100070878 3300005843 Bacteria 3313
86 Ga0068860_100081286 3300005843 Bacteria 3081
87 Ga0068860_100689325 3300005843 Bacteria 1031
88 Ga0068862_100510987 3300005844 Bacteria 1142
89 Ga0068862_100745040 3300005844 Unclassified 953
90 Ga0097621_100101460 3300006237 Bacteria 2421
91 Ga0097621_100171739 3300006237 Unclassified 1869
92 Ga0097621_100824757 3300006237 Bacteria 860
93 Ga0068871_100062040 3300006358 Bacteria 3054
94 Ga0068871_100132219 3300006358 Bacteria 2116
95 Ga0068871_100339619 3300006358 Bacteria 1326
96 Ga0068871_101477074 3300006358 Unclassified 642
97 Ga0075428_101706582 3300006844 Bacteria 657
98 Ga0068865_100057112 3300006881 Bacteria 2722
99 Ga0068865_100386981 3300006881 Bacteria 1142
100 Ga0068865_100445661 3300006881 Bacteria 1069
101 Ga0097620_100028886 3300006931 Bacteria 5562
102 Ga0097620_100748102 3300006931 Bacteria 1066
103 Ga0105240_11643064 3300009093 Unclassified 672
104 Ga0111539_10021901 3300009094 Bacteria 7856
105 Ga0105245_11749096 3300009098 Bacteria 674
106 Ga0105247_10011609 3300009101 Bacteria 5307
107 Ga0105241_11302895 3300009174 Unclassified 692
108 Ga0105242_10104992 3300009176 Bacteria 2399
109 Ga0105242_10521359 3300009176 Bacteria 1134
110 Ga0105242_11644675 3300009176 Bacteria 677
111 Ga0105242_11972115 3300009176 Unclassified 626
112 Ga0105248_10141095 3300009177 Bacteria 2718
113 Ga0105248_10221020 3300009177 Unclassified 2133
114 Ga0105248_12038294 3300009177 Unclassified 652
115 Ga0105237_11531729 3300009545 Bacteria 673
116 Ga0105249_10062297 3300009553 Bacteria 3425
117 Ga0105249_10092131 3300009553 Bacteria 2837
118 Ga0105249_10146072 3300009553 Bacteria 2272
119 Ga0105249_10178666 3300009553 Bacteria 2063
120 Ga0105239_11023880 3300010375 Bacteria 950
121 Ga0105246_10885757 3300011119 Unclassified 799
122 Ga0105246_11436446 3300011119 Bacteria 645
123 Ga0157371_10122033 3300013102 Bacteria 1853
124 Ga0157370_10831118 3300013104 Unclassified 840
125 Ga0157369_11351627 3300013105 Bacteria 726
126 Ga0157374_10052744 3300013296 Bacteria 3789
127 Ga0157374_11032147 3300013296 Bacteria 842
128 Ga0157374_11307028 3300013296 Bacteria 747
129 Ga0157374_12836307 3300013296 Bacteria 512
130 Ga0157378_10561142 3300013297 Unclassified 1148
131 Ga0157378_11925263 3300013297 Bacteria 640
132 Ga0157378_11974889 3300013297 Bacteria 633
133 Ga0157378_12877036 3300013297 Bacteria 534
134 Ga0163162_10043788 3300013306 Bacteria 4482
135 Ga0163162_10164524 3300013306 Bacteria 2342
136 Ga0163162_10202247 3300013306 Bacteria 2115
137 Ga0163162_10711471 3300013306 Unclassified 1125
138 Ga0163162_10715635 3300013306 Bacteria 1122
139 Ga0163162_11725308 3300013306 Bacteria 715
140 Ga0157372_10311429 3300013307 Bacteria 1832
141 Ga0157375_10057210 3300013308 Bacteria 3853
142 Ga0157375_10135044 3300013308 Bacteria 2590
143 Ga0157375_10158199 3300013308 Bacteria 2406
144 Ga0157375_10232528 3300013308 Bacteria 2002
145 Ga0157375_10680199 3300013308 Unclassified 1184
146 Ga0157375_10684405 3300013308 Bacteria 1180
147 Ga0157375_13644799 3300013308 Unclassified 512
148 Ga0157375_13644800 3300013308 Bacteria 512
149 Ga0163163_10015220 3300014325 Bacteria 7106
150 Ga0163163_10263905 3300014325 Bacteria 1773
151 Ga0163163_10501278 3300014325 Bacteria 1276
152 Ga0163163_10646002 3300014325 Bacteria 1121
153 Ga0163163_11851606 3300014325 Bacteria 664
154 Ga0157380_10169324 3300014326 Bacteria 1907
155 Ga0157380_10340393 3300014326 Bacteria 1399
156 Ga0157380_10433909 3300014326 Bacteria 1257
157 Ga0157377_10100259 3300014745 Bacteria 1724
158 Ga0157377_11095152 3300014745 Bacteria 610
159 Ga0157376_10034478 3300014969 Bacteria 4087
160 Ga0157376_10101954 3300014969 Bacteria 2509
161 Ga0157376_10422273 3300014969 Unclassified 1294
162 Ga0157376_10985435 3300014969 Bacteria 865
163 Ga0157376_11121471 3300014969 Bacteria 813
164 Ga0157376_11388311 3300014969 Bacteria 734
165 Ga0163161_10001466 3300017792 Bacteria 17447
166 Ga0163161_10036276 3300017792 Bacteria 3531
167 Ga0163161_10080449 3300017792 Bacteria 2398
168 Ga0207697_10096294 3300025315 Bacteria 1258
169 Ga0207682_10049979 3300025893 Bacteria 1727
170 Ga0207642_10893335 3300025899 Unclassified 569
171 Ga0207710_10015790 3300025900 Bacteria 3193
172 Ga0207643_10038796 3300025908 Bacteria 2677
173 Ga0207705_10002127 3300025909 Bacteria 15372
174 Ga0207654_10405134 3300025911 Bacteria 949
175 Ga0207652_10965372 3300025921 Bacteria 750
176 Ga0207650_10031089 3300025925 Bacteria 3853
177 Ga0207650_10126450 3300025925 Bacteria 1996
178 Ga0207650_10336809 3300025925 Bacteria 1238
179 Ga0207650_10615292 3300025925 Bacteria 914
180 Ga0207650_11003007 3300025925 Bacteria 710
181 Ga0207659_10131632 3300025926 Bacteria 1932
182 Ga0207659_10396791 3300025926 Bacteria 1153
183 Ga0207659_10557900 3300025926 Bacteria 974
184 Ga0207644_10754648 3300025931 Bacteria 813
185 Ga0207644_11128096 3300025931 Unclassified 659
186 Ga0207706_10133276 3300025933 Bacteria 2185
187 Ga0207670_10430750 3300025936 Bacteria 1060
188 Ga0207670_11186924 3300025936 Bacteria 646
189 Ga0207669_10150411 3300025937 Bacteria 1630
190 Ga0207669_10553647 3300025937 Bacteria 928
191 Ga0207669_10701183 3300025937 Bacteria 832
192 Ga0207704_10321466 3300025938 Bacteria 1194
193 Ga0207704_10444012 3300025938 Bacteria 1034
194 Ga0207704_10930372 3300025938 Bacteria 732
195 Ga0207704_11434988 3300025938 Bacteria 592
196 Ga0207704_11758723 3300025938 Unclassified 533
197 Ga0207691_10035359 3300025940 Bacteria 4638
198 Ga0207691_10058984 3300025940 Bacteria 3490
199 Ga0207691_10362754 3300025940 Unclassified 1238
200 Ga0207711_10310295 3300025941 Bacteria 1456
201 Ga0207689_10215777 3300025942 Bacteria 1585
202 Ga0207689_10421572 3300025942 Bacteria 1114
203 Ga0207689_10607764 3300025942 Bacteria 920
204 Ga0207661_11067918 3300025944 Bacteria 744
205 Ga0207679_10075990 3300025945 Bacteria 2551
206 Ga0207679_10741594 3300025945 Bacteria 893
207 Ga0207667_10212263 3300025949 Bacteria 1984
208 Ga0207651_10251827 3300025960 Bacteria 1445
209 Ga0207651_10262357 3300025960 Bacteria 1419
210 Ga0207651_11834337 3300025960 Unclassified 546
211 Ga0207712_10016625 3300025961 Bacteria 4770
212 Ga0207712_10065375 3300025961 Bacteria 2596
213 Ga0207712_10067377 3300025961 Bacteria 2562
214 Ga0207712_10407687 3300025961 Unclassified 1144
215 Ga0207668_10141681 3300025972 Bacteria 1850
216 Ga0207668_10372367 3300025972 Bacteria 1200
217 Ga0207640_10910739 3300025981 Bacteria 769
218 Ga0207640_12008459 3300025981 Unclassified 524
219 Ga0207658_10203293 3300025986 Bacteria 1655
220 Ga0207658_10337818 3300025986 Bacteria 1308
221 Ga0207677_10051727 3300026023 Bacteria 2787
222 Ga0207677_10885650 3300026023 Bacteria 804
223 Ga0207703_10130728 3300026035 Bacteria 2168
224 Ga0207703_10701910 3300026035 Bacteria 962
225 Ga0207639_10005815 3300026041 Bacteria 8357
226 Ga0207639_12195410 3300026041 Unclassified 513
227 Ga0207678_10377254 3300026067 Bacteria 1226
228 Ga0207641_10107687 3300026088 Bacteria 2465
229 Ga0207641_12530329 3300026088 Unclassified 511
230 Ga0207648_10112550 3300026089 Bacteria 2390
231 Ga0207648_10306938 3300026089 Bacteria 1424
232 Ga0207676_10041969 3300026095 Bacteria 3516
233 Ga0207676_10100893 3300026095 Bacteria 2392
234 Ga0207674_10095428 3300026116 Bacteria 2960
235 Ga0207675_101261917 3300026118 Bacteria 759
236 Ga0207683_10151683 3300026121 Bacteria 2091
237 Ga0207683_10564693 3300026121 Unclassified 1052
238 Ga0207683_10914892 3300026121 Bacteria 814
239 Ga0207698_10686070 3300026142 Bacteria 1018
240 Ga0207698_10984127 3300026142 Bacteria 854
241 Ga0209974_10148298 3300027876 Unclassified 845
242 Ga0207428_10377396 3300027907 Bacteria 1040
243 Ga0268265_10037227 3300028380 Bacteria 3569
244 Ga0268265_10784363 3300028380 Bacteria 927
245 Ga0268265_11059250 3300028380 Bacteria 803
246 Ga0268264_10023783 3300028381 Bacteria 4998
247 Ga0268264_10909941 3300028381 Unclassified 883
248 Ga0268264_11030166 3300028381 Unclassified 830
249 Ga0268264_11747932 3300028381 Bacteria 632
250 Ga0265336_10104992 3300028666 Unclassified 841
251 Ga0307408_100062020 3300031548 Bacteria 2731
252 Ga0307408_100083808 3300031548 Unclassified 2390
253 Ga0307408_100277210 3300031548 Unclassified 1395
254 Ga0307408_100313658 3300031548 Bacteria 1318
255 Ga0307408_100610687 3300031548 Bacteria 970
256 Ga0307405_10068905 3300031731 Bacteria 2266
257 Ga0307405_10101916 3300031731 Bacteria 1927
258 Ga0307405_10219433 3300031731 Bacteria 1394
259 Ga0307405_11137482 3300031731 Unclassified 672
260 Ga0307413_10004625 3300031824 Bacteria 6017
261 Ga0307413_10015890 3300031824 Bacteria 3871
262 Ga0307413_10028181 3300031824 Bacteria 3123
263 Ga0307413_10079153 3300031824 Bacteria 2100
264 Ga0307410_10003713 3300031852 Bacteria 7727
265 Ga0307410_10003862 3300031852 Bacteria 7618
266 Ga0307410_10011896 3300031852 Bacteria 5002
267 Ga0307410_10040173 3300031852 Bacteria 3077
268 Ga0307410_10167181 3300031852 Bacteria 1654
269 Ga0307410_10223596 3300031852 Bacteria 1449
270 Ga0307410_10351655 3300031852 Bacteria 1178
271 Ga0307410_10458548 3300031852 Bacteria 1041
272 Ga0307406_10008415 3300031901 Bacteria 5753
273 Ga0307406_10075785 3300031901 Unclassified 2220
274 Ga0307406_10100866 3300031901 Bacteria 1966
275 Ga0307406_10146172 3300031901 Bacteria 1680
276 Ga0307406_10395780 3300031901 Bacteria 1093
277 Ga0307407_10084239 3300031903 Bacteria 1931
278 Ga0307407_10119086 3300031903 Bacteria 1670
279 Ga0307407_10137176 3300031903 Bacteria 1573
280 Ga0307407_10147319 3300031903 Bacteria 1526
281 Ga0307407_10151533 3300031903 Bacteria 1507
282 Ga0307407_11009763 3300031903 Unclassified 643
283 Ga0307412_10021792 3300031911 Bacteria 3919
284 Ga0307412_10161827 3300031911 Bacteria 1664
285 Ga0307409_100016440 3300031995 Bacteria 4895
286 Ga0307409_100020036 3300031995 Bacteria 4547
287 Ga0307409_100022996 3300031995 Bacteria 4309
288 Ga0307409_100050242 3300031995 Bacteria 3184
289 Ga0307409_100401331 3300031995 Bacteria 1309
290 Ga0307409_100483908 3300031995 Bacteria 1201
291 Ga0307416_100011923 3300032002 Bacteria 5831
292 Ga0307416_100256601 3300032002 Bacteria 1705
293 Ga0307416_100288474 3300032002 Bacteria 1623
294 Ga0307416_100300972 3300032002 Bacteria 1594
295 Ga0307416_100654736 3300032002 Bacteria 1135
296 Ga0307414_10035221 3300032004 Bacteria 3329
297 Ga0307414_10046945 3300032004 Bacteria 2969
298 Ga0307414_10176544 3300032004 Bacteria 1714
299 Ga0307414_11280194 3300032004 Unclassified 680
300 Ga0307414_12174825 3300032004 Bacteria 518
301 Ga0307411_10001470 3300032005 Bacteria 9670
302 Ga0307411_10006416 3300032005 Bacteria 5884
303 Ga0307411_10083590 3300032005 Bacteria 2205
304 Ga0307411_10174845 3300032005 Bacteria 1623
305 Ga0307411_11435578 3300032005 Bacteria 632
306 Ga0307411_11553591 3300032005 Unclassified 609
307 Ga0307415_100006754 3300032126 Bacteria 6220
308 Ga0307415_100008783 3300032126 Bacteria 5624
309 Ga0307415_100069751 3300032126 Bacteria 2466
310 Ga0307415_100159101 3300032126 Bacteria 1748
311 Ga0307415_100630662 3300032126 Bacteria 958
312 Ga0436362_1285648 3300039453 Bacteria 1222
313 Ga0451789_0603677 3300041443 Bacteria 582
314 Ga0451791_1406720 3300041451 Bacteria 1082
315 Ga0451791_1531823 3300041451 Bacteria 743
316 Ga0451807_1151657 3300041486 Bacteria 855
317 Ga0451837_0063136 3300041494 Bacteria 2956
318 Ga0466961_0031519 3300044693 Bacteria 3408
319 Ga0451576_1676365 3300045051 Bacteria 659
320 Ga0495672_0191506 3300047320 Bacteria 1028
321 Ga0496104_0844500 3300048907 Bacteria 821
322 Ga0496105_0472228 3300048908 Bacteria 988
323 Ga0496109_0340484 3300048912 Bacteria 1416
324 Ga0496111_0624403 3300048914 Bacteria 788
325 Ga0496112_1356817 3300048915 Bacteria 626
326 Ga0496114_0385970 3300048917 Bacteria 1240
327 Ga0501292_014022 3300049515 Unclassified 1238
328 Ga0501072_0002774 3300049588 Bacteria 13167
329 Ga0501216_004602 3300049660 Unclassified 2052
330 Ga0501217_030293 3300049661 Bacteria 1328
331 Ga0501233_253684 3300049668 Unclassified 530
332 Ga0501235_025127 3300049669 Bacteria 1332
333 Ga0501242_016230 3300049674 Bacteria 931
334 Ga0501242_032322 3300049674 Bacteria 713
335 Ga0501247_008872 3300049677 Bacteria 1180
336 Ga0501249_078880 3300049679 Unclassified 773
337 Ga0501257_033197 3300049686 Bacteria 1250
338 Ga0501257_065392 3300049686 Unclassified 923
339 Ga0501258_011939 3300049687 Unclassified 937
340 Ga0501221_013208 3300049704 Bacteria 1516
341 Ga0501263_011189 3300049760 Bacteria 1110
342 Ga0501268_001076 3300049765 Bacteria 3277
343 Ga0501270_012726 3300049767 Bacteria 1154
344 Ga0501272_005218 3300049769 Bacteria 1364
345 Ga0501273_013161 3300049770 Unclassified 1052
346 nmdc:mga08y16_60998_c1 3300050511 Bacteria 3938
347 Ga0590071_170189 3300059421 Archaea 569
348 Ga0268264_10012583
349 Ga0065704_10224818
350 Ga0065712_10129989
351 Ga0065715_10988937
352 Ga0070690_100257088
353 Ga0070670_100002158
354 Ga0070670_100063757
355 Ga0070677_10255217
356 Ga0070677_10267277
357 Ga0070677_10289275
358 Ga0068869_100164796
359 Ga0068869_101078751
360 Ga0070666_10030634
361 Ga0068868_100303402
362 Ga0068868_100549872
363 Ga0070689_100407055
364 Ga0070692_10489263
365 Ga0070668_100161281
366 Ga0070668_100235874
367 Ga0070668_100383822
368 Ga0070675_100012592
369 Ga0070675_100097301
370 Ga0070675_100370880
371 Ga0070671_100247865
372 Ga0070671_100275439
373 Ga0070671_100419213
374 Ga0070671_100828717
375 Ga0070674_100014135
376 Ga0070674_100138966
377 Ga0070673_100095529
378 Ga0070673_102290344
379 Ga0070688_100735000
380 Ga0070659_101089362
381 Ga0070667_100018385
382 Ga0070667_100233105
383 Ga0070701_10363676
384 Ga0070663_100996178
385 Ga0070678_100052484
386 Ga0070678_100543759
387 Ga0070678_100546409
388 Ga0070662_100283923
389 Ga0068867_100120024
390 Ga0068867_100187963
391 Ga0068867_100443675
392 Ga0068867_101286579
393 Ga0068867_102211133
394 Ga0070685_10051358
395 Ga0070685_11101483
396 Ga0070698_100074861
397 Ga0070679_101123177
398 Ga0070684_100736731
399 Ga0070684_101545610
400 Ga0068853_100062432
401 Ga0070672_100044127
402 Ga0070672_100049218
403 Ga0070672_101409497
404 Ga0070686_100092081
405 Ga0070696_100741622
406 Ga0068855_100403025
407 Ga0070664_100040892
408 Ga0070664_100227758
409 Ga0070664_100861576
410 Ga0068857_100980503
411 Ga0068854_101378480
412 Ga0068854_102264558
413 Ga0070702_100027864
414 Ga0068852_100401202
415 Ga0068852_100808943
416 Ga0068859_100028886
417 Ga0068859_100748102
418 Ga0068864_100226039
419 Ga0068864_100612672
420 Ga0068864_101374645
421 Ga0068866_11005045
422 Ga0068861_100743334
423 Ga0068861_101359665
424 Ga0068870_10664736
425 Ga0068863_100491758
426 Ga0068863_100807993
427 Ga0068863_102737876
428 Ga0068858_100113671
429 Ga0068858_100285193
430 Ga0068858_100371581
431 Ga0068860_100043733
432 Ga0068860_100070878
433 Ga0068860_100081286
434 Ga0068860_100689325
435 Ga0068862_100510987
436 Ga0068862_100745040
437 Ga0097621_100101460
438 Ga0097621_100171739
439 Ga0097621_100824757
440 Ga0068871_100062040
441 Ga0068871_100132219
442 Ga0068871_100339619
443 Ga0068871_101477074
444 Ga0075428_101706582
445 Ga0068865_100057112
446 Ga0068865_100386981
447 Ga0068865_100445661
448 Ga0097620_100028886
449 Ga0097620_100748102
450 Ga0105240_11643064
451 Ga0111539_10021901
452 Ga0105245_11749096
453 Ga0105247_10011609
454 Ga0105241_11302895
455 Ga0105242_10104992
456 Ga0105242_10521359
457 Ga0105242_11644675
458 Ga0105242_11972115
459 Ga0105248_10141095
460 Ga0105248_10221020
461 Ga0105248_12038294
462 Ga0105237_11531729
463 Ga0105249_10062297
464 Ga0105249_10092131
465 Ga0105249_10146072
466 Ga0105249_10178666
467 Ga0105239_11023880
468 Ga0105246_10885757
469 Ga0105246_11436446
470 Ga0157371_10122033
471 Ga0157370_10831118
472 Ga0157369_11351627
473 Ga0157374_10052744
474 Ga0157374_11032147
475 Ga0157374_11307028
476 Ga0157374_12836307
477 Ga0157378_10561142
478 Ga0157378_11925263
479 Ga0157378_11974889
480 Ga0157378_12877036
481 Ga0163162_10043788
482 Ga0163162_10164524
483 Ga0163162_10202247
484 Ga0163162_10711471
485 Ga0163162_10715635
486 Ga0163162_11725308
487 Ga0157372_10311429
488 Ga0157375_10057210
489 Ga0157375_10135044
490 Ga0157375_10158199
491 Ga0157375_10232528
492 Ga0157375_10680199
493 Ga0157375_10684405
494 Ga0157375_13644799
495 Ga0157375_13644800
496 Ga0163163_10015220
497 Ga0163163_10263905
498 Ga0163163_10501278
499 Ga0163163_10646002
500 Ga0163163_11851606
501 Ga0157380_10169324
502 Ga0157380_10340393
503 Ga0157380_10433909
504 Ga0157377_10100259
505 Ga0157377_11095152
506 Ga0157376_10034478
507 Ga0157376_10101954
508 Ga0157376_10422273
509 Ga0157376_10985435
510 Ga0157376_11121471
511 Ga0157376_11388311
512 Ga0163161_10001466
513 Ga0163161_10036276
514 Ga0163161_10080449
515 Ga0207697_10096294
516 Ga0207682_10049979
517 Ga0207642_10893335
518 Ga0207710_10015790
519 Ga0207643_10038796
520 Ga0207705_10002127
521 Ga0207654_10405134
522 Ga0207652_10965372
523 Ga0207650_10031089
524 Ga0207650_10126450
525 Ga0207650_10336809
526 Ga0207650_10615292
527 Ga0207650_11003007
528 Ga0207659_10131632
529 Ga0207659_10396791
530 Ga0207659_10557900
531 Ga0207644_10754648
532 Ga0207644_11128096
533 Ga0207706_10133276
534 Ga0207670_10430750
535 Ga0207670_11186924
536 Ga0207669_10150411
537 Ga0207669_10553647
538 Ga0207669_10701183
539 Ga0207704_10321466
540 Ga0207704_10444012
541 Ga0207704_10930372
542 Ga0207704_11434988
543 Ga0207704_11758723
544 Ga0207691_10035359
545 Ga0207691_10058984
546 Ga0207691_10362754
547 Ga0207711_10310295
548 Ga0207689_10215777
549 Ga0207689_10421572
550 Ga0207689_10607764
551 Ga0207661_11067918
552 Ga0207679_10075990
553 Ga0207679_10741594
554 Ga0207667_10212263
555 Ga0207651_10251827
556 Ga0207651_10262357
557 Ga0207651_11834337
558 Ga0207712_10016625
559 Ga0207712_10065375
560 Ga0207712_10067377
561 Ga0207712_10407687
562 Ga0207668_10141681
563 Ga0207668_10372367
564 Ga0207640_10910739
565 Ga0207640_12008459
566 Ga0207658_10203293
567 Ga0207658_10337818
568 Ga0207677_10051727
569 Ga0207677_10885650
570 Ga0207703_10130728
571 Ga0207703_10701910
572 Ga0207639_10005815
573 Ga0207639_12195410
574 Ga0207678_10377254
575 Ga0207641_10107687
576 Ga0207641_12530329
577 Ga0207648_10112550
578 Ga0207648_10306938
579 Ga0207676_10041969
580 Ga0207676_10100893
581 Ga0207674_10095428
582 Ga0207675_101261917
583 Ga0207683_10151683
584 Ga0207683_10564693
585 Ga0207683_10914892
586 Ga0207698_10686070
587 Ga0207698_10984127
588 Ga0209974_10148298
589 Ga0207428_10377396
590 Ga0268265_10037227
591 Ga0268265_10784363
592 Ga0268265_11059250
593 Ga0268264_10023783
594 Ga0268264_10909941
595 Ga0268264_11030166
596 Ga0268264_11747932
597 Ga0265336_10104992
598 Ga0307408_100062020
599 Ga0307408_100083808
600 Ga0307408_100277210
601 Ga0307408_100313658
602 Ga0307408_100610687
603 Ga0307405_10068905
604 Ga0307405_10101916
605 Ga0307405_10219433
606 Ga0307405_11137482
607 Ga0307413_10004625
608 Ga0307413_10015890
609 Ga0307413_10028181
610 Ga0307413_10079153
611 Ga0307410_10003713
612 Ga0307410_10003862
613 Ga0307410_10011896
614 Ga0307410_10040173
615 Ga0307410_10167181
616 Ga0307410_10223596
617 Ga0307410_10351655
618 Ga0307410_10458548
619 Ga0307406_10008415
620 Ga0307406_10075785
621 Ga0307406_10100866
622 Ga0307406_10146172
623 Ga0307406_10395780
624 Ga0307407_10084239
625 Ga0307407_10119086
626 Ga0307407_10137176
627 Ga0307407_10147319
628 Ga0307407_10151533
629 Ga0307407_11009763
630 Ga0307412_10021792
631 Ga0307412_10161827
632 Ga0307409_100016440
633 Ga0307409_100020036
634 Ga0307409_100022996
635 Ga0307409_100050242
636 Ga0307409_100401331
637 Ga0307409_100483908
638 Ga0307416_100011923
639 Ga0307416_100256601
640 Ga0307416_100288474
641 Ga0307416_100300972
642 Ga0307416_100654736
643 Ga0307414_10035221
644 Ga0307414_10046945
645 Ga0307414_10176544
646 Ga0307414_11280194
647 Ga0307414_12174825
648 Ga0307411_10001470
649 Ga0307411_10006416
650 Ga0307411_10083590
651 Ga0307411_10174845
652 Ga0307411_11435578
653 Ga0307411_11553591
654 Ga0307415_100006754
655 Ga0307415_100008783
656 Ga0307415_100069751
657 Ga0307415_100159101
658 Ga0307415_100630662
659 Ga0436362_1285648
660 Ga0451789_0603677
661 Ga0451791_1406720
662 Ga0451791_1531823
663 Ga0451807_1151657
664 Ga0451837_0063136
665 Ga0466961_0031519
666 Ga0451576_1676365
667 Ga0495672_0191506
668 Ga0496104_0844500
669 Ga0496105_0472228
670 Ga0496109_0340484
671 Ga0496111_0624403
672 Ga0496112_1356817
673 Ga0496114_0385970
674 Ga0501292_014022
675 Ga0501072_0002774
676 Ga0501216_004602
677 Ga0501217_030293
678 Ga0501233_253684
679 Ga0501235_025127
680 Ga0501242_016230
681 Ga0501242_032322
682 Ga0501247_008872
683 Ga0501249_078880
684 Ga0501257_033197
685 Ga0501257_065392
686 Ga0501258_011939
687 Ga0501221_013208
688 Ga0501263_011189
689 Ga0501268_001076
690 Ga0501270_012726
691 Ga0501272_005218
692 Ga0501273_013161
693 nmdc:mga08y16_60998_c1
694 Ga0590071_170189

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map