F417181
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 347 | 152 | 347 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300026078|Ga0207702_10235464|Ga0207702_102354642 |
| Length | 325 |
| Sequence | MTQAPQLPAPTWFVGCGNMGRAILDGWRGAGISLEPIVVVDPAKPAIDGVKRAATPAEAGPAPKLVILGVKPQMIDEVAGQLKTWLTSKTVVVSLLVGVEAASLRQRLPKAGPIVRALPNLPVAVRRGVVALFSDEADEAVRQQLANLFAPLGFAPWMADEAKLAAVGSVAGAGPAYVARFIAALAKAGEKRGLSEEIASTVALETVLGTAWLAAAKGEDHVVAIRKLDYGRGLTHNVKFYPNMAAWNVEERQLRSLGADDYLTRDVYQRMHFPPTGVDQLLARLEAEAKSTSKLKDVLKRVKAVAYPHIAKAFDLLHKKESVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 117 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 126 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 129 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 130 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 131 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 132 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 133 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 134 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 135 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 136 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 137 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 138 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 139 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 140 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 144 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 145 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 146 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 150 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 151 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 152 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.32 |
| Rhizosphere | 94.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10000281 | 3300001990 | Bacteria | 16865 |
| 2 | JGI24744J21845_10003311 | 3300002077 | Bacteria | 3308 |
| 3 | rootH2_10093800 | 3300003320 | Unclassified | 1237 |
| 4 | Ga0070658_10126872 | 3300005327 | Bacteria | 2124 |
| 5 | Ga0070658_10403723 | 3300005327 | Bacteria | 1174 |
| 6 | Ga0070658_10618193 | 3300005327 | Unclassified | 939 |
| 7 | Ga0070676_10003383 | 3300005328 | Bacteria | 8303 |
| 8 | Ga0070690_100064884 | 3300005330 | Bacteria | 2360 |
| 9 | Ga0070670_100053046 | 3300005331 | Bacteria | 3482 |
| 10 | Ga0070670_100100941 | 3300005331 | Bacteria | 2484 |
| 11 | Ga0068869_100000385 | 3300005334 | Bacteria | 23972 |
| 12 | Ga0068868_100001184 | 3300005338 | Bacteria | 17874 |
| 13 | Ga0068868_100006311 | 3300005338 | Bacteria | 8380 |
| 14 | Ga0068868_100034935 | 3300005338 | Bacteria | 3883 |
| 15 | Ga0070660_100011437 | 3300005339 | Bacteria | 6305 |
| 16 | Ga0070660_100052226 | 3300005339 | Bacteria | 3151 |
| 17 | Ga0070660_100078132 | 3300005339 | Bacteria | 2595 |
| 18 | Ga0070689_100099774 | 3300005340 | Bacteria | 2297 |
| 19 | Ga0070661_100009694 | 3300005344 | Bacteria | 6680 |
| 20 | Ga0070661_100188452 | 3300005344 | Bacteria | 1572 |
| 21 | Ga0070661_100288297 | 3300005344 | Bacteria | 1275 |
| 22 | Ga0070661_100382504 | 3300005344 | Bacteria | 1110 |
| 23 | Ga0070692_10026792 | 3300005345 | Bacteria | 2852 |
| 24 | Ga0070692_10031615 | 3300005345 | Bacteria | 2654 |
| 25 | Ga0070669_100000643 | 3300005353 | Bacteria | 25821 |
| 26 | Ga0070675_100056674 | 3300005354 | Bacteria | 3230 |
| 27 | Ga0070671_100000784 | 3300005355 | Bacteria | 22894 |
| 28 | Ga0070671_100012172 | 3300005355 | Bacteria | 6923 |
| 29 | Ga0070671_100017658 | 3300005355 | Bacteria | 5781 |
| 30 | Ga0070671_100117846 | 3300005355 | Bacteria | 2233 |
| 31 | Ga0070674_100007764 | 3300005356 | Bacteria | 6340 |
| 32 | Ga0070674_100026500 | 3300005356 | Bacteria | 3788 |
| 33 | Ga0070673_100000663 | 3300005364 | Bacteria | 18945 |
| 34 | Ga0070673_100012465 | 3300005364 | Bacteria | 5838 |
| 35 | Ga0070673_100080383 | 3300005364 | Bacteria | 2641 |
| 36 | Ga0070673_100340937 | 3300005364 | Bacteria | 1328 |
| 37 | Ga0070659_100000382 | 3300005366 | Bacteria | 33581 |
| 38 | Ga0070659_100007320 | 3300005366 | Bacteria | 8018 |
| 39 | Ga0070659_100023443 | 3300005366 | Bacteria | 4722 |
| 40 | Ga0070659_100076285 | 3300005366 | Bacteria | 2673 |
| 41 | Ga0070659_100625964 | 3300005366 | Unclassified | 926 |
| 42 | Ga0070667_100000520 | 3300005367 | Bacteria | 38650 |
| 43 | Ga0070667_100001684 | 3300005367 | Bacteria | 19770 |
| 44 | Ga0070667_100021677 | 3300005367 | Bacteria | 5332 |
| 45 | Ga0070714_100046739 | 3300005435 | Bacteria | 3673 |
| 46 | Ga0070713_100121090 | 3300005436 | Bacteria | 2295 |
| 47 | Ga0070663_100009586 | 3300005455 | Bacteria | 6002 |
| 48 | Ga0070663_100171476 | 3300005455 | Bacteria | 1677 |
| 49 | Ga0070663_100253462 | 3300005455 | Bacteria | 1394 |
| 50 | Ga0070678_100045766 | 3300005456 | Bacteria | 3132 |
| 51 | Ga0070678_100101928 | 3300005456 | Bacteria | 2226 |
| 52 | Ga0070662_100000975 | 3300005457 | Bacteria | 17516 |
| 53 | Ga0070662_100119834 | 3300005457 | Bacteria | 2016 |
| 54 | Ga0070662_100194338 | 3300005457 | Bacteria | 1607 |
| 55 | Ga0070662_100478886 | 3300005457 | Bacteria | 1036 |
| 56 | Ga0070681_10083231 | 3300005458 | Bacteria | 3153 |
| 57 | Ga0070681_10254279 | 3300005458 | Bacteria | 1669 |
| 58 | Ga0068867_100001073 | 3300005459 | Bacteria | 18682 |
| 59 | Ga0068867_100003113 | 3300005459 | Bacteria | 11699 |
| 60 | Ga0068867_100200753 | 3300005459 | Bacteria | 1596 |
| 61 | Ga0068867_100215668 | 3300005459 | Bacteria | 1544 |
| 62 | Ga0070679_100060450 | 3300005530 | Bacteria | 3776 |
| 63 | Ga0070679_100297633 | 3300005530 | Bacteria | 1564 |
| 64 | Ga0068853_100002970 | 3300005539 | Bacteria | 12921 |
| 65 | Ga0068853_100159576 | 3300005539 | Bacteria | 2034 |
| 66 | Ga0068853_100522991 | 3300005539 | Bacteria | 1122 |
| 67 | Ga0068853_100524662 | 3300005539 | Bacteria | 1120 |
| 68 | Ga0070672_100000342 | 3300005543 | Bacteria | 26866 |
| 69 | Ga0070672_100009142 | 3300005543 | Bacteria | 6817 |
| 70 | Ga0070672_100104878 | 3300005543 | Bacteria | 2297 |
| 71 | Ga0070696_100093521 | 3300005546 | Bacteria | 2144 |
| 72 | Ga0070696_100311333 | 3300005546 | Bacteria | 1209 |
| 73 | Ga0070665_100735655 | 3300005548 | Bacteria | 999 |
| 74 | Ga0068855_100147109 | 3300005563 | Bacteria | 2681 |
| 75 | Ga0068855_100160912 | 3300005563 | Bacteria | 2548 |
| 76 | Ga0070664_100003562 | 3300005564 | Bacteria | 12573 |
| 77 | Ga0070664_100003589 | 3300005564 | Bacteria | 12514 |
| 78 | Ga0070664_100025245 | 3300005564 | Bacteria | 4923 |
| 79 | Ga0070664_100063791 | 3300005564 | Bacteria | 3141 |
| 80 | Ga0070664_100206938 | 3300005564 | Bacteria | 1753 |
| 81 | Ga0070664_100388530 | 3300005564 | Bacteria | 1275 |
| 82 | Ga0068857_100003686 | 3300005577 | Bacteria | 12845 |
| 83 | Ga0068857_100013620 | 3300005577 | Bacteria | 7085 |
| 84 | Ga0068857_100057141 | 3300005577 | Bacteria | 3463 |
| 85 | Ga0068857_100222495 | 3300005577 | Bacteria | 1724 |
| 86 | Ga0068854_100000376 | 3300005578 | Bacteria | 28529 |
| 87 | Ga0068854_100037487 | 3300005578 | Bacteria | 3404 |
| 88 | Ga0068854_100041469 | 3300005578 | Bacteria | 3252 |
| 89 | Ga0068856_100060780 | 3300005614 | Bacteria | 3732 |
| 90 | Ga0068856_100222800 | 3300005614 | Bacteria | 1901 |
| 91 | Ga0068856_100554766 | 3300005614 | Bacteria | 1170 |
| 92 | Ga0068852_100001271 | 3300005616 | Bacteria | 16839 |
| 93 | Ga0068852_100035005 | 3300005616 | Bacteria | 4184 |
| 94 | Ga0068852_100085184 | 3300005616 | Bacteria | 2815 |
| 95 | Ga0068852_100213373 | 3300005616 | Bacteria | 1832 |
| 96 | Ga0068852_100233571 | 3300005616 | Bacteria | 1754 |
| 97 | Ga0068859_100000982 | 3300005617 | Bacteria | 29213 |
| 98 | Ga0068859_100061841 | 3300005617 | Bacteria | 3774 |
| 99 | Ga0068859_100835255 | 3300005617 | Bacteria | 1008 |
| 100 | Ga0068864_100000982 | 3300005618 | Bacteria | 23872 |
| 101 | Ga0068864_100090916 | 3300005618 | Bacteria | 2691 |
| 102 | Ga0068866_10021291 | 3300005718 | Bacteria | 2986 |
| 103 | Ga0068851_10019419 | 3300005834 | Bacteria | 3284 |
| 104 | Ga0068851_10020215 | 3300005834 | Bacteria | 3221 |
| 105 | Ga0068851_10039368 | 3300005834 | Bacteria | 2373 |
| 106 | Ga0068851_10040198 | 3300005834 | Bacteria | 2350 |
| 107 | Ga0068863_100000871 | 3300005841 | Bacteria | 30229 |
| 108 | Ga0068863_100050676 | 3300005841 | Bacteria | 3935 |
| 109 | Ga0068858_100006590 | 3300005842 | Bacteria | 11297 |
| 110 | Ga0068858_100014737 | 3300005842 | Bacteria | 7358 |
| 111 | Ga0068858_100074533 | 3300005842 | Bacteria | 3151 |
| 112 | Ga0068858_100467926 | 3300005842 | Bacteria | 1216 |
| 113 | Ga0068860_100001576 | 3300005843 | Bacteria | 24578 |
| 114 | Ga0068860_100029748 | 3300005843 | Bacteria | 5255 |
| 115 | Ga0068860_100396052 | 3300005843 | Bacteria | 1365 |
| 116 | Ga0068860_100523611 | 3300005843 | Bacteria | 1186 |
| 117 | Ga0070712_100022733 | 3300006175 | Bacteria | 4134 |
| 118 | Ga0068871_100033491 | 3300006358 | Bacteria | 4069 |
| 119 | Ga0068865_100062669 | 3300006881 | Bacteria | 2611 |
| 120 | Ga0097620_100000982 | 3300006931 | Bacteria | 29213 |
| 121 | Ga0097620_100061841 | 3300006931 | Bacteria | 3774 |
| 122 | Ga0097620_100835195 | 3300006931 | Bacteria | 1008 |
| 123 | Ga0105240_10386554 | 3300009093 | Bacteria | 1579 |
| 124 | Ga0105245_10000657 | 3300009098 | Bacteria | 31348 |
| 125 | Ga0105243_10408716 | 3300009148 | Bacteria | 1263 |
| 126 | Ga0105243_10595597 | 3300009148 | Bacteria | 1063 |
| 127 | Ga0105242_10242812 | 3300009176 | Bacteria | 1620 |
| 128 | Ga0105248_10000394 | 3300009177 | Bacteria | 50466 |
| 129 | Ga0105248_10099823 | 3300009177 | Bacteria | 3271 |
| 130 | Ga0105248_10147111 | 3300009177 | Bacteria | 2659 |
| 131 | Ga0105248_10215831 | 3300009177 | Bacteria | 2161 |
| 132 | Ga0105238_10056084 | 3300009551 | Bacteria | 3953 |
| 133 | Ga0105239_10355211 | 3300010375 | Bacteria | 1655 |
| 134 | Ga0157373_10019651 | 3300013100 | Bacteria | 4914 |
| 135 | Ga0157371_10432766 | 3300013102 | Bacteria | 965 |
| 136 | Ga0157370_10037567 | 3300013104 | Bacteria | 4694 |
| 137 | Ga0157369_10069784 | 3300013105 | Bacteria | 3775 |
| 138 | Ga0157369_10106226 | 3300013105 | Bacteria | 2988 |
| 139 | Ga0157369_10765102 | 3300013105 | Bacteria | 993 |
| 140 | Ga0157374_10009602 | 3300013296 | Bacteria | 8311 |
| 141 | Ga0157374_10251873 | 3300013296 | Bacteria | 1738 |
| 142 | Ga0157374_10820869 | 3300013296 | Unclassified | 946 |
| 143 | Ga0157378_10078427 | 3300013297 | Bacteria | 2979 |
| 144 | Ga0163162_10057255 | 3300013306 | Bacteria | 3926 |
| 145 | Ga0163162_10129828 | 3300013306 | Bacteria | 2628 |
| 146 | Ga0163162_10164961 | 3300013306 | Bacteria | 2339 |
| 147 | Ga0157375_10040319 | 3300013308 | Bacteria | 4501 |
| 148 | Ga0157375_10065348 | 3300013308 | Bacteria | 3626 |
| 149 | Ga0157375_10124911 | 3300013308 | Bacteria | 2687 |
| 150 | Ga0157375_10191301 | 3300013308 | Bacteria | 2201 |
| 151 | Ga0163163_10604240 | 3300014325 | Bacteria | 1160 |
| 152 | Ga0157379_10464509 | 3300014968 | Bacteria | 1170 |
| 153 | Ga0157379_10606740 | 3300014968 | Bacteria | 1022 |
| 154 | Ga0213875_10011631 | 3300021388 | Bacteria | 4374 |
| 155 | Ga0207697_10090484 | 3300025315 | Bacteria | 1297 |
| 156 | Ga0207656_10070720 | 3300025321 | Bacteria | 1550 |
| 157 | Ga0207642_10019942 | 3300025899 | Bacteria | 2607 |
| 158 | Ga0207688_10014674 | 3300025901 | Bacteria | 4255 |
| 159 | Ga0207680_10002980 | 3300025903 | Bacteria | 7937 |
| 160 | Ga0207680_10004835 | 3300025903 | Bacteria | 6409 |
| 161 | Ga0207699_10039494 | 3300025906 | Bacteria | 2712 |
| 162 | Ga0207645_10063666 | 3300025907 | Bacteria | 2357 |
| 163 | Ga0207645_10063753 | 3300025907 | Bacteria | 2355 |
| 164 | Ga0207645_10066096 | 3300025907 | Bacteria | 2312 |
| 165 | Ga0207645_10090333 | 3300025907 | Bacteria | 1969 |
| 166 | Ga0207645_10146768 | 3300025907 | Bacteria | 1538 |
| 167 | Ga0207705_10004032 | 3300025909 | Bacteria | 11168 |
| 168 | Ga0207705_10022260 | 3300025909 | Bacteria | 4521 |
| 169 | Ga0207705_10028904 | 3300025909 | Bacteria | 3952 |
| 170 | Ga0207705_10107412 | 3300025909 | Bacteria | 2059 |
| 171 | Ga0207705_10164639 | 3300025909 | Bacteria | 1667 |
| 172 | Ga0207705_10424595 | 3300025909 | Bacteria | 1029 |
| 173 | Ga0207707_10271882 | 3300025912 | Bacteria | 1468 |
| 174 | Ga0207707_10364136 | 3300025912 | Bacteria | 1244 |
| 175 | Ga0207671_10454050 | 3300025914 | Bacteria | 1021 |
| 176 | Ga0207693_10062291 | 3300025915 | Bacteria | 2922 |
| 177 | Ga0207660_10023500 | 3300025917 | Bacteria | 4164 |
| 178 | Ga0207662_10010077 | 3300025918 | Bacteria | 5209 |
| 179 | Ga0207657_10016327 | 3300025919 | Bacteria | 7163 |
| 180 | Ga0207657_10031009 | 3300025919 | Bacteria | 4847 |
| 181 | Ga0207657_10048010 | 3300025919 | Bacteria | 3729 |
| 182 | Ga0207657_10056867 | 3300025919 | Bacteria | 3373 |
| 183 | Ga0207657_10077247 | 3300025919 | Bacteria | 2807 |
| 184 | Ga0207657_10084926 | 3300025919 | Bacteria | 2652 |
| 185 | Ga0207657_10104257 | 3300025919 | Bacteria | 2349 |
| 186 | Ga0207657_10166725 | 3300025919 | Bacteria | 1786 |
| 187 | Ga0207649_10144580 | 3300025920 | Bacteria | 1631 |
| 188 | Ga0207649_10247291 | 3300025920 | Bacteria | 1283 |
| 189 | Ga0207649_10305866 | 3300025920 | Bacteria | 1164 |
| 190 | Ga0207694_10311514 | 3300025924 | Bacteria | 1298 |
| 191 | Ga0207694_10475791 | 3300025924 | Bacteria | 1044 |
| 192 | Ga0207650_10040992 | 3300025925 | Bacteria | 3391 |
| 193 | Ga0207650_10075006 | 3300025925 | Bacteria | 2551 |
| 194 | Ga0207650_10253918 | 3300025925 | Bacteria | 1424 |
| 195 | Ga0207700_10167755 | 3300025928 | Bacteria | 1828 |
| 196 | Ga0207664_10030600 | 3300025929 | Bacteria | 4112 |
| 197 | Ga0207644_10000308 | 3300025931 | Bacteria | 31770 |
| 198 | Ga0207644_10015287 | 3300025931 | Bacteria | 5148 |
| 199 | Ga0207644_10025487 | 3300025931 | Bacteria | 4066 |
| 200 | Ga0207644_10063447 | 3300025931 | Bacteria | 2682 |
| 201 | Ga0207644_10138348 | 3300025931 | Bacteria | 1872 |
| 202 | Ga0207690_10030227 | 3300025932 | Bacteria | 3453 |
| 203 | Ga0207690_10308195 | 3300025932 | Bacteria | 1241 |
| 204 | Ga0207690_10343621 | 3300025932 | Bacteria | 1178 |
| 205 | Ga0207706_10016404 | 3300025933 | Bacteria | 6688 |
| 206 | Ga0207706_10057579 | 3300025933 | Bacteria | 3423 |
| 207 | Ga0207706_10092958 | 3300025933 | Bacteria | 2652 |
| 208 | Ga0207706_10238888 | 3300025933 | Bacteria | 1588 |
| 209 | Ga0207706_10277142 | 3300025933 | Bacteria | 1463 |
| 210 | Ga0207686_10061994 | 3300025934 | Bacteria | 2373 |
| 211 | Ga0207669_10012810 | 3300025937 | Bacteria | 4138 |
| 212 | Ga0207691_10019225 | 3300025940 | Bacteria | 6466 |
| 213 | Ga0207691_10122564 | 3300025940 | Bacteria | 2302 |
| 214 | Ga0207711_10000876 | 3300025941 | Bacteria | 29060 |
| 215 | Ga0207711_10002871 | 3300025941 | Bacteria | 15108 |
| 216 | Ga0207711_10008432 | 3300025941 | Bacteria | 8618 |
| 217 | Ga0207711_10016978 | 3300025941 | Bacteria | 6046 |
| 218 | Ga0207689_10570101 | 3300025942 | Bacteria | 951 |
| 219 | Ga0207661_10053484 | 3300025944 | Bacteria | 3231 |
| 220 | Ga0207679_10010110 | 3300025945 | Bacteria | 6066 |
| 221 | Ga0207679_10014881 | 3300025945 | Bacteria | 5125 |
| 222 | Ga0207679_10384365 | 3300025945 | Bacteria | 1231 |
| 223 | Ga0207667_10680564 | 3300025949 | Unclassified | 1032 |
| 224 | Ga0207651_10029147 | 3300025960 | Bacteria | 3493 |
| 225 | Ga0207651_10052281 | 3300025960 | Bacteria | 2785 |
| 226 | Ga0207651_10069082 | 3300025960 | Bacteria | 2493 |
| 227 | Ga0207651_10175120 | 3300025960 | Bacteria | 1696 |
| 228 | Ga0207640_10030994 | 3300025981 | Bacteria | 3300 |
| 229 | Ga0207640_10032443 | 3300025981 | Bacteria | 3238 |
| 230 | Ga0207640_10049140 | 3300025981 | Bacteria | 2730 |
| 231 | Ga0207640_10088028 | 3300025981 | Bacteria | 2143 |
| 232 | Ga0207658_10004322 | 3300025986 | Bacteria | 9890 |
| 233 | Ga0207658_10013965 | 3300025986 | Bacteria | 5496 |
| 234 | Ga0207677_10020023 | 3300026023 | Bacteria | 4054 |
| 235 | Ga0207677_10020076 | 3300026023 | Bacteria | 4049 |
| 236 | Ga0207703_10037721 | 3300026035 | Bacteria | 3851 |
| 237 | Ga0207703_10083875 | 3300026035 | Bacteria | 2663 |
| 238 | Ga0207703_10254235 | 3300026035 | Bacteria | 1585 |
| 239 | Ga0207639_10073181 | 3300026041 | Bacteria | 2686 |
| 240 | Ga0207678_10006202 | 3300026067 | Bacteria | 10620 |
| 241 | Ga0207678_10050163 | 3300026067 | Bacteria | 3606 |
| 242 | Ga0207678_10052858 | 3300026067 | Bacteria | 3502 |
| 243 | Ga0207678_10079163 | 3300026067 | Bacteria | 2814 |
| 244 | Ga0207678_10117363 | 3300026067 | Bacteria | 2271 |
| 245 | Ga0207678_10300762 | 3300026067 | Bacteria | 1379 |
| 246 | Ga0207702_10170067 | 3300026078 | Bacteria | 1997 |
| 247 | Ga0207702_10188972 | 3300026078 | Bacteria | 1902 |
| 248 | Ga0207702_10235464 | 3300026078 | Bacteria | 1713 |
| 249 | Ga0207702_10268216 | 3300026078 | Bacteria | 1609 |
| 250 | Ga0207641_10003577 | 3300026088 | Bacteria | 13730 |
| 251 | Ga0207641_10016769 | 3300026088 | Bacteria | 5999 |
| 252 | Ga0207648_10008103 | 3300026089 | Bacteria | 10229 |
| 253 | Ga0207648_10076062 | 3300026089 | Bacteria | 2926 |
| 254 | Ga0207648_10145917 | 3300026089 | Bacteria | 2087 |
| 255 | Ga0207676_10004467 | 3300026095 | Bacteria | 9889 |
| 256 | Ga0207676_10196208 | 3300026095 | Bacteria | 1780 |
| 257 | Ga0207676_10205132 | 3300026095 | Bacteria | 1745 |
| 258 | Ga0207674_10028200 | 3300026116 | Bacteria | 5929 |
| 259 | Ga0207674_10100329 | 3300026116 | Bacteria | 2876 |
| 260 | Ga0207674_10170631 | 3300026116 | Bacteria | 2129 |
| 261 | Ga0207674_10325831 | 3300026116 | Bacteria | 1486 |
| 262 | Ga0207675_100302121 | 3300026118 | Bacteria | 1559 |
| 263 | Ga0207683_10018862 | 3300026121 | Bacteria | 5885 |
| 264 | Ga0207683_10045410 | 3300026121 | Bacteria | 3842 |
| 265 | Ga0207683_10113079 | 3300026121 | Bacteria | 2432 |
| 266 | Ga0207698_10030156 | 3300026142 | Bacteria | 3896 |
| 267 | Ga0207698_10042660 | 3300026142 | Bacteria | 3392 |
| 268 | Ga0207698_10045484 | 3300026142 | Bacteria | 3308 |
| 269 | Ga0207698_10101596 | 3300026142 | Bacteria | 2385 |
| 270 | Ga0207698_10212326 | 3300026142 | Bacteria | 1742 |
| 271 | Ga0268264_10077805 | 3300028381 | Bacteria | 2826 |
| 272 | Ga0307413_10126378 | 3300031824 | Bacteria | 1742 |
| 273 | Ga0307406_10099856 | 3300031901 | Bacteria | 1974 |
| 274 | Ga0307414_10072574 | 3300032004 | Bacteria | 2487 |
| 275 | Ga0373943_0047077 | 3300035170 | Bacteria | 2107 |
| 276 | Ga0373935_0018835 | 3300035692 | Bacteria | 4207 |
| 277 | Ga0395899_0011295 | 3300037312 | Bacteria | 6838 |
| 278 | Ga0395899_0016960 | 3300037312 | Bacteria | 5551 |
| 279 | Ga0395899_0049835 | 3300037312 | Bacteria | 3111 |
| 280 | Ga0395899_0178711 | 3300037312 | Bacteria | 1491 |
| 281 | Ga0395899_0180224 | 3300037312 | Bacteria | 1483 |
| 282 | Ga0395900_0025735 | 3300037418 | Bacteria | 6022 |
| 283 | Ga0395900_0111229 | 3300037418 | Bacteria | 2813 |
| 284 | Ga0395900_0196600 | 3300037418 | Bacteria | 2042 |
| 285 | Ga0395900_0241092 | 3300037418 | Bacteria | 1813 |
| 286 | Ga0395900_0250690 | 3300037418 | Bacteria | 1772 |
| 287 | Ga0395900_0254838 | 3300037418 | Bacteria | 1754 |
| 288 | Ga0395898_0015905 | 3300037466 | Bacteria | 7710 |
| 289 | Ga0395898_0056492 | 3300037466 | Bacteria | 3825 |
| 290 | Ga0395898_0112289 | 3300037466 | Bacteria | 2612 |
| 291 | Ga0395898_0132918 | 3300037466 | Bacteria | 2382 |
| 292 | Ga0395898_0291923 | 3300037466 | Bacteria | 1555 |
| 293 | Ga0395898_0455196 | 3300037466 | Bacteria | 1218 |
| 294 | Ga0395898_0702732 | 3300037466 | Bacteria | 953 |
| 295 | Ga0395905_0004868 | 3300037471 | Bacteria | 13838 |
| 296 | Ga0395905_0044408 | 3300037471 | Bacteria | 4171 |
| 297 | Ga0395905_0064153 | 3300037471 | Bacteria | 3436 |
| 298 | Ga0395905_0068507 | 3300037471 | Bacteria | 3323 |
| 299 | Ga0395905_0092072 | 3300037471 | Bacteria | 2843 |
| 300 | Ga0395905_0241733 | 3300037471 | Bacteria | 1687 |
| 301 | Ga0436364_0292967 | 3300037853 | Bacteria | 4519 |
| 302 | Ga0395901_0013677 | 3300038443 | Bacteria | 8247 |
| 303 | Ga0395901_0040892 | 3300038443 | Bacteria | 4802 |
| 304 | Ga0395901_0054391 | 3300038443 | Bacteria | 4160 |
| 305 | Ga0395901_0069303 | 3300038443 | Bacteria | 3673 |
| 306 | Ga0395901_0178922 | 3300038443 | Bacteria | 2224 |
| 307 | Ga0395901_0576412 | 3300038443 | Bacteria | 1137 |
| 308 | Ga0450889_001001 | 3300042144 | Bacteria | 2980 |
| 309 | Ga0466969_0028355 | 3300044656 | Bacteria | 2862 |
| 310 | Ga0466972_0017087 | 3300044658 | Bacteria | 3628 |
| 311 | Ga0466966_0031580 | 3300044684 | Bacteria | 3434 |
| 312 | Ga0466966_0086966 | 3300044684 | Bacteria | 1943 |
| 313 | Ga0466961_0067776 | 3300044693 | Bacteria | 2267 |
| 314 | Ga0466961_0072573 | 3300044693 | Bacteria | 2183 |
| 315 | Ga0466963_0145503 | 3300044694 | Bacteria | 1644 |
| 316 | Ga0466964_0046949 | 3300044706 | Bacteria | 1761 |
| 317 | Ga0466971_0028796 | 3300044719 | Bacteria | 2484 |
| 318 | Ga0466968_0001603 | 3300044735 | Bacteria | 8166 |
| 319 | Ga0466970_0034067 | 3300044765 | Bacteria | 2694 |
| 320 | Ga0466957_0022472 | 3300044842 | Bacteria | 3721 |
| 321 | Ga0466957_0271090 | 3300044842 | Bacteria | 1133 |
| 322 | Ga0466960_0015799 | 3300044901 | Bacteria | 3262 |
| 323 | Ga0466959_0053123 | 3300045049 | Bacteria | 2963 |
| 324 | Ga0466959_0200956 | 3300045049 | Bacteria | 1388 |
| 325 | Ga0466959_0257002 | 3300045049 | Bacteria | 1203 |
| 326 | Ga0466958_0041994 | 3300045836 | Bacteria | 2752 |
| 327 | Ga0466958_0203111 | 3300045836 | Bacteria | 1261 |
| 328 | Ga0466967_0126562 | 3300045976 | Bacteria | 2367 |
| 329 | Ga0495669_0007836 | 3300046684 | Bacteria | 4482 |
| 330 | Ga0495669_0064903 | 3300046684 | Bacteria | 1657 |
| 331 | Ga0495669_0161606 | 3300046684 | Bacteria | 1063 |
| 332 | Ga0496100_0035809 | 3300048903 | Bacteria | 3125 |
| 333 | Ga0496100_0415225 | 3300048903 | Bacteria | 1027 |
| 334 | Ga0496101_0018477 | 3300048904 | Bacteria | 4741 |
| 335 | Ga0496103_0067309 | 3300048906 | Bacteria | 2237 |
| 336 | Ga0496103_0189639 | 3300048906 | Bacteria | 1322 |
| 337 | Ga0496106_0458820 | 3300048909 | Bacteria | 1024 |
| 338 | Ga0496107_0011093 | 3300048910 | Bacteria | 6269 |
| 339 | Ga0496107_0248552 | 3300048910 | Bacteria | 1323 |
| 340 | Ga0496108_0036883 | 3300048911 | Bacteria | 4069 |
| 341 | Ga0496109_0026249 | 3300048912 | Bacteria | 5194 |
| 342 | Ga0496109_0239128 | 3300048912 | Bacteria | 1709 |
| 343 | Ga0496110_0111234 | 3300048913 | Bacteria | 2462 |
| 344 | Ga0496112_0205008 | 3300048915 | Bacteria | 1930 |
| 345 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 346 | Ga0496115_0068137 | 3300048918 | Bacteria | 2880 |
| 347 | Ga0466962_0082405 | 3300061719 | Bacteria | 1538 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005546 | Ga0070696_100093521 | Ga0070696_1000935212 | 249 |
| 2 | 3300009177 | Ga0105248_10215831 | Ga0105248_102158313 | 249 |
| 3 | 3300013102 | Ga0157371_10432766 | Ga0157371_104327661 | 249 |
| 4 | 3300013296 | Ga0157374_10820869 | Ga0157374_108208692 | 249 |
| 5 | 3300037466 | Ga0395898_0702732 | Ga0395898_0702732_135_920 | 249 |
| 6 | 3300037471 | Ga0395905_0241733 | Ga0395905_0241733_682_1476 | 249 |
| 7 | 3300038443 | Ga0395901_0576412 | Ga0395901_0576412_294_1088 | 249 |
| 8 | 3300044684 | Ga0466966_0086966 | Ga0466966_0086966_128_916 | 249 |
| 9 | 3300044719 | Ga0466971_0028796 | Ga0466971_0028796_225_1019 | 249 |
| 10 | 3300045049 | Ga0466959_0200956 | Ga0466959_0200956_127_921 | 249 |
| 11 | 3300048903 | Ga0496100_0415225 | Ga0496100_0415225_74_868 | 249 |
| 12 | 3300048910 | Ga0496107_0248552 | Ga0496107_0248552_361_1155 | 249 |
| 13 | 3300048911 | Ga0496108_0036883 | Ga0496108_0036883_1900_2694 | 249 |
| 14 | 3300048912 | Ga0496109_0026249 | Ga0496109_0026249_3653_4447 | 249 |
| 15 | 3300048913 | Ga0496110_0111234 | Ga0496110_0111234_139_933 | 249 |
| 16 | 3300048915 | Ga0496112_0205008 | Ga0496112_0205008_529_1323 | 249 |
| 17 | 3300048918 | Ga0496115_0068137 | Ga0496115_0068137_1110_1904 | 249 |
| 18 | 3300009093 | Ga0105240_10386554 | Ga0105240_103865542 | 255 |
| 19 | 3300013105 | Ga0157369_10765102 | Ga0157369_107651021 | 255 |
| 20 | 3300025914 | Ga0207671_10454050 | Ga0207671_104540501 | 255 |
| 21 | 3300025924 | Ga0207694_10311514 | Ga0207694_103115142 | 255 |
| 22 | 3300025929 | Ga0207664_10030600 | Ga0207664_100306002 | 255 |
| 23 | 3300026142 | Ga0207698_10042660 | Ga0207698_100426602 | 255 |
| 24 | 3300037466 | Ga0395898_0455196 | Ga0395898_0455196_255_1103 | 255 |
| 25 | 3300005577 | Ga0068857_100013620 | Ga0068857_1000136205 | 263 |
| 26 | 3300026116 | Ga0207674_10028200 | Ga0207674_100282006 | 263 |
| 27 | 3300037471 | Ga0395905_0092072 | Ga0395905_0092072_1393_2229 | 263 |
| 28 | 3300037466 | Ga0395898_0112289 | Ga0395898_0112289_1595_2431 | 264 |
| 29 | 3300037471 | Ga0395905_0044408 | Ga0395905_0044408_1878_2714 | 264 |
| 30 | 3300038443 | Ga0395901_0040892 | Ga0395901_0040892_2396_3232 | 264 |
| 31 | 3300005366 | Ga0070659_100076285 | Ga0070659_1000762852 | 265 |
| 32 | 3300042144 | Ga0450889_001001 | Ga0450889_001001_1690_2523 | 265 |
| 33 | 3300005327 | Ga0070658_10403723 | Ga0070658_104037232 | 266 |
| 34 | 3300005614 | Ga0068856_100222800 | Ga0068856_1002228003 | 266 |
| 35 | 3300013105 | Ga0157369_10069784 | Ga0157369_100697844 | 266 |
| 36 | 3300026078 | Ga0207702_10188972 | Ga0207702_101889722 | 266 |
| 37 | 3300002077 | JGI24744J21845_10003311 | JGI24744J21845_100033113 | 267 |
| 38 | 3300003320 | rootH2_10093800 | rootH2_100938001 | 267 |
| 39 | 3300005327 | Ga0070658_10126872 | Ga0070658_101268722 | 267 |
| 40 | 3300005327 | Ga0070658_10618193 | Ga0070658_106181931 | 267 |
| 41 | 3300005331 | Ga0070670_100053046 | Ga0070670_1000530464 | 267 |
| 42 | 3300005331 | Ga0070670_100100941 | Ga0070670_1001009411 | 267 |
| 43 | 3300005338 | Ga0068868_100006311 | Ga0068868_1000063116 | 267 |
| 44 | 3300005338 | Ga0068868_100034935 | Ga0068868_1000349353 | 267 |
| 45 | 3300005339 | Ga0070660_100011437 | Ga0070660_1000114373 | 267 |
| 46 | 3300005339 | Ga0070660_100078132 | Ga0070660_1000781321 | 267 |
| 47 | 3300005344 | Ga0070661_100009694 | Ga0070661_1000096949 | 267 |
| 48 | 3300005344 | Ga0070661_100188452 | Ga0070661_1001884523 | 267 |
| 49 | 3300005344 | Ga0070661_100288297 | Ga0070661_1002882972 | 267 |
| 50 | 3300005345 | Ga0070692_10026792 | Ga0070692_100267922 | 267 |
| 51 | 3300005345 | Ga0070692_10031615 | Ga0070692_100316153 | 267 |
| 52 | 3300005355 | Ga0070671_100000784 | Ga0070671_10000078427 | 267 |
| 53 | 3300005355 | Ga0070671_100012172 | Ga0070671_1000121729 | 267 |
| 54 | 3300005355 | Ga0070671_100117846 | Ga0070671_1001178462 | 267 |
| 55 | 3300005356 | Ga0070674_100007764 | Ga0070674_1000077647 | 267 |
| 56 | 3300005356 | Ga0070674_100026500 | Ga0070674_1000265005 | 267 |
| 57 | 3300005364 | Ga0070673_100012465 | Ga0070673_1000124651 | 267 |
| 58 | 3300005364 | Ga0070673_100080383 | Ga0070673_1000803831 | 267 |
| 59 | 3300005364 | Ga0070673_100340937 | Ga0070673_1003409372 | 267 |
| 60 | 3300005366 | Ga0070659_100007320 | Ga0070659_1000073206 | 267 |
| 61 | 3300005366 | Ga0070659_100023443 | Ga0070659_1000234434 | 267 |
| 62 | 3300005366 | Ga0070659_100625964 | Ga0070659_1006259641 | 267 |
| 63 | 3300005367 | Ga0070667_100001684 | Ga0070667_10000168419 | 267 |
| 64 | 3300005367 | Ga0070667_100021677 | Ga0070667_1000216776 | 267 |
| 65 | 3300005435 | Ga0070714_100046739 | Ga0070714_1000467396 | 267 |
| 66 | 3300005436 | Ga0070713_100121090 | Ga0070713_1001210904 | 267 |
| 67 | 3300005455 | Ga0070663_100009586 | Ga0070663_1000095865 | 267 |
| 68 | 3300005455 | Ga0070663_100171476 | Ga0070663_1001714762 | 267 |
| 69 | 3300005455 | Ga0070663_100253462 | Ga0070663_1002534622 | 267 |
| 70 | 3300005456 | Ga0070678_100045766 | Ga0070678_1000457665 | 267 |
| 71 | 3300005456 | Ga0070678_100101928 | Ga0070678_1001019283 | 267 |
| 72 | 3300005457 | Ga0070662_100119834 | Ga0070662_1001198342 | 267 |
| 73 | 3300005457 | Ga0070662_100194338 | Ga0070662_1001943382 | 267 |
| 74 | 3300005457 | Ga0070662_100478886 | Ga0070662_1004788861 | 267 |
| 75 | 3300005458 | Ga0070681_10083231 | Ga0070681_100832315 | 267 |
| 76 | 3300005458 | Ga0070681_10254279 | Ga0070681_102542791 | 267 |
| 77 | 3300005459 | Ga0068867_100003113 | Ga0068867_1000031131 | 267 |
| 78 | 3300005459 | Ga0068867_100200753 | Ga0068867_1002007531 | 267 |
| 79 | 3300005459 | Ga0068867_100215668 | Ga0068867_1002156683 | 267 |
| 80 | 3300005530 | Ga0070679_100060450 | Ga0070679_1000604503 | 267 |
| 81 | 3300005530 | Ga0070679_100297633 | Ga0070679_1002976332 | 267 |
| 82 | 3300005539 | Ga0068853_100159576 | Ga0068853_1001595761 | 267 |
| 83 | 3300005539 | Ga0068853_100522991 | Ga0068853_1005229911 | 267 |
| 84 | 3300005539 | Ga0068853_100524662 | Ga0068853_1005246622 | 267 |
| 85 | 3300005543 | Ga0070672_100009142 | Ga0070672_1000091426 | 267 |
| 86 | 3300005543 | Ga0070672_100104878 | Ga0070672_1001048782 | 267 |
| 87 | 3300005546 | Ga0070696_100311333 | Ga0070696_1003113332 | 267 |
| 88 | 3300005563 | Ga0068855_100160912 | Ga0068855_1001609121 | 267 |
| 89 | 3300005564 | Ga0070664_100003562 | Ga0070664_1000035625 | 267 |
| 90 | 3300005564 | Ga0070664_100003589 | Ga0070664_1000035899 | 267 |
| 91 | 3300005564 | Ga0070664_100025245 | Ga0070664_1000252453 | 267 |
| 92 | 3300005564 | Ga0070664_100063791 | Ga0070664_1000637913 | 267 |
| 93 | 3300005564 | Ga0070664_100206938 | Ga0070664_1002069382 | 267 |
| 94 | 3300005577 | Ga0068857_100057141 | Ga0068857_1000571414 | 267 |
| 95 | 3300005577 | Ga0068857_100222495 | Ga0068857_1002224952 | 267 |
| 96 | 3300005578 | Ga0068854_100037487 | Ga0068854_1000374873 | 267 |
| 97 | 3300005578 | Ga0068854_100041469 | Ga0068854_1000414692 | 267 |
| 98 | 3300005614 | Ga0068856_100060780 | Ga0068856_1000607802 | 267 |
| 99 | 3300005616 | Ga0068852_100035005 | Ga0068852_1000350055 | 267 |
| 100 | 3300005616 | Ga0068852_100085184 | Ga0068852_1000851842 | 267 |
| 101 | 3300005616 | Ga0068852_100213373 | Ga0068852_1002133732 | 267 |
| 102 | 3300005616 | Ga0068852_100233571 | Ga0068852_1002335712 | 267 |
| 103 | 3300005617 | Ga0068859_100061841 | Ga0068859_1000618415 | 267 |
| 104 | 3300005617 | Ga0068859_100835255 | Ga0068859_1008352552 | 267 |
| 105 | 3300005618 | Ga0068864_100000982 | Ga0068864_1000009829 | 267 |
| 106 | 3300005618 | Ga0068864_100090916 | Ga0068864_1000909162 | 267 |
| 107 | 3300005718 | Ga0068866_10021291 | Ga0068866_100212912 | 267 |
| 108 | 3300005834 | Ga0068851_10019419 | Ga0068851_100194195 | 267 |
| 109 | 3300005834 | Ga0068851_10020215 | Ga0068851_100202152 | 267 |
| 110 | 3300005834 | Ga0068851_10040198 | Ga0068851_100401982 | 267 |
| 111 | 3300005841 | Ga0068863_100050676 | Ga0068863_1000506764 | 267 |
| 112 | 3300005842 | Ga0068858_100006590 | Ga0068858_1000065907 | 267 |
| 113 | 3300005842 | Ga0068858_100074533 | Ga0068858_1000745335 | 267 |
| 114 | 3300005842 | Ga0068858_100467926 | Ga0068858_1004679262 | 267 |
| 115 | 3300005843 | Ga0068860_100029748 | Ga0068860_1000297486 | 267 |
| 116 | 3300005843 | Ga0068860_100396052 | Ga0068860_1003960522 | 267 |
| 117 | 3300005843 | Ga0068860_100523611 | Ga0068860_1005236112 | 267 |
| 118 | 3300006175 | Ga0070712_100022733 | Ga0070712_1000227338 | 267 |
| 119 | 3300006931 | Ga0097620_100061841 | Ga0097620_1000618415 | 267 |
| 120 | 3300006931 | Ga0097620_100835195 | Ga0097620_1008351951 | 267 |
| 121 | 3300009148 | Ga0105243_10408716 | Ga0105243_104087162 | 267 |
| 122 | 3300009148 | Ga0105243_10595597 | Ga0105243_105955971 | 267 |
| 123 | 3300009176 | Ga0105242_10242812 | Ga0105242_102428122 | 267 |
| 124 | 3300009177 | Ga0105248_10099823 | Ga0105248_100998233 | 267 |
| 125 | 3300009177 | Ga0105248_10147111 | Ga0105248_101471115 | 267 |
| 126 | 3300009551 | Ga0105238_10056084 | Ga0105238_100560843 | 267 |
| 127 | 3300010375 | Ga0105239_10355211 | Ga0105239_103552113 | 267 |
| 128 | 3300013104 | Ga0157370_10037567 | Ga0157370_100375676 | 267 |
| 129 | 3300013105 | Ga0157369_10106226 | Ga0157369_101062262 | 267 |
| 130 | 3300013296 | Ga0157374_10009602 | Ga0157374_100096025 | 267 |
| 131 | 3300013296 | Ga0157374_10251873 | Ga0157374_102518732 | 267 |
| 132 | 3300013297 | Ga0157378_10078427 | Ga0157378_100784272 | 267 |
| 133 | 3300013306 | Ga0163162_10129828 | Ga0163162_101298281 | 267 |
| 134 | 3300013306 | Ga0163162_10164961 | Ga0163162_101649611 | 267 |
| 135 | 3300013308 | Ga0157375_10040319 | Ga0157375_100403196 | 267 |
| 136 | 3300013308 | Ga0157375_10065348 | Ga0157375_100653482 | 267 |
| 137 | 3300013308 | Ga0157375_10124911 | Ga0157375_101249113 | 267 |
| 138 | 3300014325 | Ga0163163_10604240 | Ga0163163_106042402 | 267 |
| 139 | 3300014968 | Ga0157379_10464509 | Ga0157379_104645092 | 267 |
| 140 | 3300014968 | Ga0157379_10606740 | Ga0157379_106067402 | 267 |
| 141 | 3300021388 | Ga0213875_10011631 | Ga0213875_100116316 | 267 |
| 142 | 3300025315 | Ga0207697_10090484 | Ga0207697_100904841 | 267 |
| 143 | 3300025321 | Ga0207656_10070720 | Ga0207656_100707202 | 267 |
| 144 | 3300025899 | Ga0207642_10019942 | Ga0207642_100199424 | 267 |
| 145 | 3300025901 | Ga0207688_10014674 | Ga0207688_100146742 | 267 |
| 146 | 3300025903 | Ga0207680_10002980 | Ga0207680_100029808 | 267 |
| 147 | 3300025903 | Ga0207680_10004835 | Ga0207680_100048352 | 267 |
| 148 | 3300025906 | Ga0207699_10039494 | Ga0207699_100394942 | 267 |
| 149 | 3300025907 | Ga0207645_10063666 | Ga0207645_100636662 | 267 |
| 150 | 3300025907 | Ga0207645_10063753 | Ga0207645_100637533 | 267 |
| 151 | 3300025907 | Ga0207645_10066096 | Ga0207645_100660962 | 267 |
| 152 | 3300025907 | Ga0207645_10090333 | Ga0207645_100903332 | 267 |
| 153 | 3300025907 | Ga0207645_10146768 | Ga0207645_101467682 | 267 |
| 154 | 3300025909 | Ga0207705_10004032 | Ga0207705_100040328 | 267 |
| 155 | 3300025909 | Ga0207705_10022260 | Ga0207705_100222606 | 267 |
| 156 | 3300025909 | Ga0207705_10028904 | Ga0207705_100289045 | 267 |
| 157 | 3300025909 | Ga0207705_10107412 | Ga0207705_101074122 | 267 |
| 158 | 3300025909 | Ga0207705_10164639 | Ga0207705_101646392 | 267 |
| 159 | 3300025909 | Ga0207705_10424595 | Ga0207705_104245952 | 267 |
| 160 | 3300025912 | Ga0207707_10271882 | Ga0207707_102718822 | 267 |
| 161 | 3300025912 | Ga0207707_10364136 | Ga0207707_103641362 | 267 |
| 162 | 3300025915 | Ga0207693_10062291 | Ga0207693_100622914 | 267 |
| 163 | 3300025917 | Ga0207660_10023500 | Ga0207660_100235003 | 267 |
| 164 | 3300025918 | Ga0207662_10010077 | Ga0207662_100100772 | 267 |
| 165 | 3300025919 | Ga0207657_10016327 | Ga0207657_100163276 | 267 |
| 166 | 3300025919 | Ga0207657_10031009 | Ga0207657_100310095 | 267 |
| 167 | 3300025919 | Ga0207657_10048010 | Ga0207657_100480105 | 267 |
| 168 | 3300025919 | Ga0207657_10056867 | Ga0207657_100568672 | 267 |
| 169 | 3300025919 | Ga0207657_10077247 | Ga0207657_100772473 | 267 |
| 170 | 3300025919 | Ga0207657_10084926 | Ga0207657_100849263 | 267 |
| 171 | 3300025919 | Ga0207657_10104257 | Ga0207657_101042574 | 267 |
| 172 | 3300025919 | Ga0207657_10166725 | Ga0207657_101667252 | 267 |
| 173 | 3300025920 | Ga0207649_10144580 | Ga0207649_101445801 | 267 |
| 174 | 3300025920 | Ga0207649_10247291 | Ga0207649_102472912 | 267 |
| 175 | 3300025924 | Ga0207694_10475791 | Ga0207694_104757911 | 267 |
| 176 | 3300025925 | Ga0207650_10040992 | Ga0207650_100409924 | 267 |
| 177 | 3300025925 | Ga0207650_10075006 | Ga0207650_100750062 | 267 |
| 178 | 3300025925 | Ga0207650_10253918 | Ga0207650_102539182 | 267 |
| 179 | 3300025928 | Ga0207700_10167755 | Ga0207700_101677552 | 267 |
| 180 | 3300025931 | Ga0207644_10000308 | Ga0207644_1000030817 | 267 |
| 181 | 3300025931 | Ga0207644_10015287 | Ga0207644_100152873 | 267 |
| 182 | 3300025931 | Ga0207644_10025487 | Ga0207644_100254875 | 267 |
| 183 | 3300025931 | Ga0207644_10063447 | Ga0207644_100634472 | 267 |
| 184 | 3300025931 | Ga0207644_10138348 | Ga0207644_101383482 | 267 |
| 185 | 3300025932 | Ga0207690_10030227 | Ga0207690_100302273 | 267 |
| 186 | 3300025932 | Ga0207690_10308195 | Ga0207690_103081951 | 267 |
| 187 | 3300025932 | Ga0207690_10343621 | Ga0207690_103436212 | 267 |
| 188 | 3300025933 | Ga0207706_10016404 | Ga0207706_100164046 | 267 |
| 189 | 3300025933 | Ga0207706_10057579 | Ga0207706_100575793 | 267 |
| 190 | 3300025933 | Ga0207706_10092958 | Ga0207706_100929585 | 267 |
| 191 | 3300025933 | Ga0207706_10238888 | Ga0207706_102388882 | 267 |
| 192 | 3300025933 | Ga0207706_10277142 | Ga0207706_102771422 | 267 |
| 193 | 3300025934 | Ga0207686_10061994 | Ga0207686_100619943 | 267 |
| 194 | 3300025937 | Ga0207669_10012810 | Ga0207669_100128104 | 267 |
| 195 | 3300025940 | Ga0207691_10019225 | Ga0207691_100192255 | 267 |
| 196 | 3300025940 | Ga0207691_10122564 | Ga0207691_101225642 | 267 |
| 197 | 3300025941 | Ga0207711_10000876 | Ga0207711_1000087617 | 267 |
| 198 | 3300025941 | Ga0207711_10002871 | Ga0207711_1000287122 | 267 |
| 199 | 3300025941 | Ga0207711_10008432 | Ga0207711_100084326 | 267 |
| 200 | 3300025941 | Ga0207711_10016978 | Ga0207711_100169786 | 267 |
| 201 | 3300025942 | Ga0207689_10570101 | Ga0207689_105701011 | 267 |
| 202 | 3300025944 | Ga0207661_10053484 | Ga0207661_100534842 | 267 |
| 203 | 3300025945 | Ga0207679_10010110 | Ga0207679_100101107 | 267 |
| 204 | 3300025945 | Ga0207679_10014881 | Ga0207679_100148816 | 267 |
| 205 | 3300025945 | Ga0207679_10384365 | Ga0207679_103843652 | 267 |
| 206 | 3300025949 | Ga0207667_10680564 | Ga0207667_106805642 | 267 |
| 207 | 3300025960 | Ga0207651_10029147 | Ga0207651_100291474 | 267 |
| 208 | 3300025960 | Ga0207651_10052281 | Ga0207651_100522812 | 267 |
| 209 | 3300025960 | Ga0207651_10069082 | Ga0207651_100690821 | 267 |
| 210 | 3300025960 | Ga0207651_10175120 | Ga0207651_101751202 | 267 |
| 211 | 3300025981 | Ga0207640_10030994 | Ga0207640_100309943 | 267 |
| 212 | 3300025981 | Ga0207640_10032443 | Ga0207640_100324432 | 267 |
| 213 | 3300025981 | Ga0207640_10049140 | Ga0207640_100491402 | 267 |
| 214 | 3300025981 | Ga0207640_10088028 | Ga0207640_100880282 | 267 |
| 215 | 3300025986 | Ga0207658_10004322 | Ga0207658_100043222 | 267 |
| 216 | 3300025986 | Ga0207658_10013965 | Ga0207658_100139652 | 267 |
| 217 | 3300026023 | Ga0207677_10020023 | Ga0207677_100200233 | 267 |
| 218 | 3300026023 | Ga0207677_10020076 | Ga0207677_100200763 | 267 |
| 219 | 3300026035 | Ga0207703_10037721 | Ga0207703_100377213 | 267 |
| 220 | 3300026035 | Ga0207703_10083875 | Ga0207703_100838752 | 267 |
| 221 | 3300026035 | Ga0207703_10254235 | Ga0207703_102542352 | 267 |
| 222 | 3300026041 | Ga0207639_10073181 | Ga0207639_100731812 | 267 |
| 223 | 3300026067 | Ga0207678_10006202 | Ga0207678_100062024 | 267 |
| 224 | 3300026067 | Ga0207678_10050163 | Ga0207678_100501636 | 267 |
| 225 | 3300026067 | Ga0207678_10052858 | Ga0207678_100528584 | 267 |
| 226 | 3300026067 | Ga0207678_10079163 | Ga0207678_100791634 | 267 |
| 227 | 3300026067 | Ga0207678_10117363 | Ga0207678_101173632 | 267 |
| 228 | 3300026067 | Ga0207678_10300762 | Ga0207678_103007621 | 267 |
| 229 | 3300026078 | Ga0207702_10170067 | Ga0207702_101700672 | 267 |
| 230 | 3300026078 | Ga0207702_10268216 | Ga0207702_102682161 | 267 |
| 231 | 3300026088 | Ga0207641_10003577 | Ga0207641_100035774 | 267 |
| 232 | 3300026088 | Ga0207641_10016769 | Ga0207641_100167694 | 267 |
| 233 | 3300026089 | Ga0207648_10008103 | Ga0207648_100081036 | 267 |
| 234 | 3300026089 | Ga0207648_10076062 | Ga0207648_100760625 | 267 |
| 235 | 3300026089 | Ga0207648_10145917 | Ga0207648_101459171 | 267 |
| 236 | 3300026095 | Ga0207676_10004467 | Ga0207676_100044675 | 267 |
| 237 | 3300026095 | Ga0207676_10196208 | Ga0207676_101962082 | 267 |
| 238 | 3300026095 | Ga0207676_10205132 | Ga0207676_102051322 | 267 |
| 239 | 3300026116 | Ga0207674_10100329 | Ga0207674_101003293 | 267 |
| 240 | 3300026116 | Ga0207674_10170631 | Ga0207674_101706312 | 267 |
| 241 | 3300026116 | Ga0207674_10325831 | Ga0207674_103258312 | 267 |
| 242 | 3300026118 | Ga0207675_100302121 | Ga0207675_1003021212 | 267 |
| 243 | 3300026121 | Ga0207683_10018862 | Ga0207683_100188623 | 267 |
| 244 | 3300026121 | Ga0207683_10045410 | Ga0207683_100454103 | 267 |
| 245 | 3300026121 | Ga0207683_10113079 | Ga0207683_101130793 | 267 |
| 246 | 3300026142 | Ga0207698_10030156 | Ga0207698_100301566 | 267 |
| 247 | 3300026142 | Ga0207698_10045484 | Ga0207698_100454846 | 267 |
| 248 | 3300026142 | Ga0207698_10101596 | Ga0207698_101015962 | 267 |
| 249 | 3300026142 | Ga0207698_10212326 | Ga0207698_102123262 | 267 |
| 250 | 3300028381 | Ga0268264_10077805 | Ga0268264_100778054 | 267 |
| 251 | 3300031824 | Ga0307413_10126378 | Ga0307413_101263782 | 267 |
| 252 | 3300031901 | Ga0307406_10099856 | Ga0307406_100998563 | 267 |
| 253 | 3300032004 | Ga0307414_10072574 | Ga0307414_100725742 | 267 |
| 254 | 3300035170 | Ga0373943_0047077 | Ga0373943_0047077_336_1187 | 267 |
| 255 | 3300035692 | Ga0373935_0018835 | Ga0373935_0018835_919_1770 | 267 |
| 256 | 3300037312 | Ga0395899_0011295 | Ga0395899_0011295_5687_6529 | 267 |
| 257 | 3300037312 | Ga0395899_0016960 | Ga0395899_0016960_605_1432 | 267 |
| 258 | 3300037312 | Ga0395899_0049835 | Ga0395899_0049835_2034_2882 | 267 |
| 259 | 3300037312 | Ga0395899_0178711 | Ga0395899_0178711_472_1311 | 267 |
| 260 | 3300037312 | Ga0395899_0180224 | Ga0395899_0180224_72_920 | 267 |
| 261 | 3300037418 | Ga0395900_0025735 | Ga0395900_0025735_2960_3802 | 267 |
| 262 | 3300037418 | Ga0395900_0111229 | Ga0395900_0111229_1925_2773 | 267 |
| 263 | 3300037418 | Ga0395900_0196600 | Ga0395900_0196600_862_1710 | 267 |
| 264 | 3300037418 | Ga0395900_0241092 | Ga0395900_0241092_870_1718 | 267 |
| 265 | 3300037418 | Ga0395900_0250690 | Ga0395900_0250690_485_1327 | 267 |
| 266 | 3300037418 | Ga0395900_0254838 | Ga0395900_0254838_347_1195 | 267 |
| 267 | 3300037466 | Ga0395898_0015905 | Ga0395898_0015905_5119_5961 | 267 |
| 268 | 3300037466 | Ga0395898_0056492 | Ga0395898_0056492_2034_2882 | 267 |
| 269 | 3300037466 | Ga0395898_0132918 | Ga0395898_0132918_808_1656 | 267 |
| 270 | 3300037466 | Ga0395898_0291923 | Ga0395898_0291923_33_881 | 267 |
| 271 | 3300037471 | Ga0395905_0004868 | Ga0395905_0004868_6508_7350 | 267 |
| 272 | 3300037471 | Ga0395905_0064153 | Ga0395905_0064153_2034_2882 | 267 |
| 273 | 3300037471 | Ga0395905_0068507 | Ga0395905_0068507_1673_2512 | 267 |
| 274 | 3300037853 | Ga0436364_0292967 | Ga0436364_0292967_543_1358 | 267 |
| 275 | 3300038443 | Ga0395901_0013677 | Ga0395901_0013677_6078_6920 | 267 |
| 276 | 3300038443 | Ga0395901_0054391 | Ga0395901_0054391_1925_2773 | 267 |
| 277 | 3300038443 | Ga0395901_0069303 | Ga0395901_0069303_1795_2643 | 267 |
| 278 | 3300038443 | Ga0395901_0178922 | Ga0395901_0178922_817_1665 | 267 |
| 279 | 3300044656 | Ga0466969_0028355 | Ga0466969_0028355_145_993 | 267 |
| 280 | 3300044658 | Ga0466972_0017087 | Ga0466972_0017087_90_938 | 267 |
| 281 | 3300044684 | Ga0466966_0031580 | Ga0466966_0031580_155_1003 | 267 |
| 282 | 3300044693 | Ga0466961_0067776 | Ga0466961_0067776_1026_1874 | 267 |
| 283 | 3300044693 | Ga0466961_0072573 | Ga0466961_0072573_187_1035 | 267 |
| 284 | 3300044694 | Ga0466963_0145503 | Ga0466963_0145503_610_1458 | 267 |
| 285 | 3300044706 | Ga0466964_0046949 | Ga0466964_0046949_752_1600 | 267 |
| 286 | 3300044735 | Ga0466968_0001603 | Ga0466968_0001603_4072_4920 | 267 |
| 287 | 3300044765 | Ga0466970_0034067 | Ga0466970_0034067_1284_2132 | 267 |
| 288 | 3300044842 | Ga0466957_0022472 | Ga0466957_0022472_2658_3506 | 267 |
| 289 | 3300044842 | Ga0466957_0271090 | Ga0466957_0271090_132_980 | 267 |
| 290 | 3300044901 | Ga0466960_0015799 | Ga0466960_0015799_79_930 | 267 |
| 291 | 3300045049 | Ga0466959_0053123 | Ga0466959_0053123_2001_2849 | 267 |
| 292 | 3300045049 | Ga0466959_0257002 | Ga0466959_0257002_251_1099 | 267 |
| 293 | 3300045836 | Ga0466958_0041994 | Ga0466958_0041994_1712_2560 | 267 |
| 294 | 3300045836 | Ga0466958_0203111 | Ga0466958_0203111_228_1076 | 267 |
| 295 | 3300045976 | Ga0466967_0126562 | Ga0466967_0126562_151_999 | 267 |
| 296 | 3300046684 | Ga0495669_0007836 | Ga0495669_0007836_813_1661 | 267 |
| 297 | 3300046684 | Ga0495669_0064903 | Ga0495669_0064903_23_871 | 267 |
| 298 | 3300046684 | Ga0495669_0161606 | Ga0495669_0161606_76_924 | 267 |
| 299 | 3300048903 | Ga0496100_0035809 | Ga0496100_0035809_1768_2616 | 267 |
| 300 | 3300048904 | Ga0496101_0018477 | Ga0496101_0018477_3824_4672 | 267 |
| 301 | 3300048906 | Ga0496103_0067309 | Ga0496103_0067309_70_918 | 267 |
| 302 | 3300048906 | Ga0496103_0189639 | Ga0496103_0189639_82_933 | 267 |
| 303 | 3300048909 | Ga0496106_0458820 | Ga0496106_0458820_14_862 | 267 |
| 304 | 3300048910 | Ga0496107_0011093 | Ga0496107_0011093_2181_3029 | 267 |
| 305 | 3300048912 | Ga0496109_0239128 | Ga0496109_0239128_576_1433 | 267 |
| 306 | 3300048917 | Ga0496114_0000023 | Ga0496114_0000023_143777_144625 | 267 |
| 307 | 3300061719 | Ga0466962_0082405 | Ga0466962_0082405_660_1508 | 267 |
| 308 | 3300025920 | Ga0207649_10305866 | Ga0207649_103058662 | 268 |
| 309 | 3300026078 | Ga0207702_10235464 | Ga0207702_102354642 | 269 |
| 310 | 3300001990 | JGI24737J22298_10000281 | JGI24737J22298_1000028123 | 273 |
| 311 | 3300005328 | Ga0070676_10003383 | Ga0070676_100033832 | 273 |
| 312 | 3300005330 | Ga0070690_100064884 | Ga0070690_1000648843 | 273 |
| 313 | 3300005334 | Ga0068869_100000385 | Ga0068869_10000038521 | 273 |
| 314 | 3300005338 | Ga0068868_100001184 | Ga0068868_1000011847 | 273 |
| 315 | 3300005339 | Ga0070660_100052226 | Ga0070660_1000522265 | 273 |
| 316 | 3300005340 | Ga0070689_100099774 | Ga0070689_1000997744 | 273 |
| 317 | 3300005344 | Ga0070661_100382504 | Ga0070661_1003825042 | 273 |
| 318 | 3300005353 | Ga0070669_100000643 | Ga0070669_1000006437 | 273 |
| 319 | 3300005354 | Ga0070675_100056674 | Ga0070675_1000566745 | 273 |
| 320 | 3300005355 | Ga0070671_100017658 | Ga0070671_1000176587 | 273 |
| 321 | 3300005364 | Ga0070673_100000663 | Ga0070673_10000066310 | 273 |
| 322 | 3300005366 | Ga0070659_100000382 | Ga0070659_10000038220 | 273 |
| 323 | 3300005367 | Ga0070667_100000520 | Ga0070667_10000052023 | 273 |
| 324 | 3300005457 | Ga0070662_100000975 | Ga0070662_10000097521 | 273 |
| 325 | 3300005459 | Ga0068867_100001073 | Ga0068867_1000010737 | 273 |
| 326 | 3300005539 | Ga0068853_100002970 | Ga0068853_10000297011 | 273 |
| 327 | 3300005543 | Ga0070672_100000342 | Ga0070672_10000034222 | 273 |
| 328 | 3300005548 | Ga0070665_100735655 | Ga0070665_1007356551 | 273 |
| 329 | 3300005563 | Ga0068855_100147109 | Ga0068855_1001471092 | 273 |
| 330 | 3300005564 | Ga0070664_100388530 | Ga0070664_1003885302 | 273 |
| 331 | 3300005577 | Ga0068857_100003686 | Ga0068857_1000036861 | 273 |
| 332 | 3300005578 | Ga0068854_100000376 | Ga0068854_10000037636 | 273 |
| 333 | 3300005614 | Ga0068856_100554766 | Ga0068856_1005547662 | 273 |
| 334 | 3300005616 | Ga0068852_100001271 | Ga0068852_10000127112 | 273 |
| 335 | 3300005617 | Ga0068859_100000982 | Ga0068859_10000098220 | 273 |
| 336 | 3300005834 | Ga0068851_10039368 | Ga0068851_100393682 | 273 |
| 337 | 3300005841 | Ga0068863_100000871 | Ga0068863_10000087128 | 273 |
| 338 | 3300005842 | Ga0068858_100014737 | Ga0068858_1000147378 | 273 |
| 339 | 3300005843 | Ga0068860_100001576 | Ga0068860_10000157623 | 273 |
| 340 | 3300006358 | Ga0068871_100033491 | Ga0068871_1000334913 | 273 |
| 341 | 3300006881 | Ga0068865_100062669 | Ga0068865_1000626692 | 273 |
| 342 | 3300006931 | Ga0097620_100000982 | Ga0097620_10000098212 | 273 |
| 343 | 3300009098 | Ga0105245_10000657 | Ga0105245_1000065723 | 273 |
| 344 | 3300009177 | Ga0105248_10000394 | Ga0105248_1000039415 | 273 |
| 345 | 3300013100 | Ga0157373_10019651 | Ga0157373_100196513 | 273 |
| 346 | 3300013306 | Ga0163162_10057255 | Ga0163162_100572554 | 273 |
| 347 | 3300013308 | Ga0157375_10191301 | Ga0157375_101913012 | 273 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rcy-assembly1.cif.gz_A | crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound | 0.8956 | 4 | 265 |
| 6lhm-assembly2.cif.gz_B | structure of human pycr2 | 0.8953 | 12 | 266 |
| 2rcy-assembly1.cif.gz_D-2 | crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound | 0.8951 | 11 | 265 |
| 2rcy-assembly1.cif.gz_E-2 | crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound | 0.8912 | 12 | 265 |
| 2rcy-assembly1.cif.gz_A | crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound | 0.8892 | 4 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DH60_1_162_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9106 | 11 | 161 | 3.40.50.720 |
| af_Q21544_1_164_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9058 | 11 | 162 | 3.40.50.720 |
| af_P0A9L8_1_164_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8967 | 7 | 161 | 3.40.50.720 |
| af_Q5SPD7_3_179_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8957 | 9 | 161 | 3.40.50.720 |
| af_Q9VEJ3_1_166_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.888 | 9 | 162 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G9SGC3-F1-model_v4 | Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) | 0.9504 | 5 | 269 |
GO:0004735
GO:0005737 GO:0055129 |
| AF-A0A520IB92-F1-model_v4 | Pyrroline-5-carboxylate reductase | 0.9462 | 8 | 225 |
GO:0004735
GO:0055129 |
| AF-A0A6G7ZNW8-F1-model_v4 | Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) | 0.9446 | 6 | 270 |
GO:0004735
GO:0005737 GO:0055129 |
| AF-A0A3D4CI51-F1-model_v4 | Pyrroline-5-carboxylate reductase | 0.9364 | 99 | 244 |
GO:0004735
GO:0055129 |
| AF-A0A536BZ74-F1-model_v4 | Pyrroline-5-carboxylate reductase | 0.9362 | 97 | 234 |
GO:0004735
GO:0055129 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar