F417181

General Info

Members Datasets Scaffolds Average Seq Length
347 152 347 279

Family's Representative Sequence

Representative Sequence 3300026078|Ga0207702_10235464|Ga0207702_102354642
Length 325
Sequence MTQAPQLPAPTWFVGCGNMGRAILDGWRGAGISLEPIVVVDPAKPAIDGVKRAATPAEAGPAPKLVILGVKPQMIDEVAGQLKTWLTSKTVVVSLLVGVEAASLRQRLPKAGPIVRALPNLPVAVRRGVVALFSDEADEAVRQQLANLFAPLGFAPWMADEAKLAAVGSVAGAGPAYVARFIAALAKAGEKRGLSEEIASTVALETVLGTAWLAAAKGEDHVVAIRKLDYGRGLTHNVKFYPNMAAWNVEERQLRSLGADDYLTRDVYQRMHFPPTGVDQLLARLEAEAKSTSKLKDVLKRVKAVAYPHIAKAFDLLHKKESVAA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.32
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 0.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000281 3300001990 Bacteria 16865
2 JGI24744J21845_10003311 3300002077 Bacteria 3308
3 rootH2_10093800 3300003320 Unclassified 1237
4 Ga0070658_10126872 3300005327 Bacteria 2124
5 Ga0070658_10403723 3300005327 Bacteria 1174
6 Ga0070658_10618193 3300005327 Unclassified 939
7 Ga0070676_10003383 3300005328 Bacteria 8303
8 Ga0070690_100064884 3300005330 Bacteria 2360
9 Ga0070670_100053046 3300005331 Bacteria 3482
10 Ga0070670_100100941 3300005331 Bacteria 2484
11 Ga0068869_100000385 3300005334 Bacteria 23972
12 Ga0068868_100001184 3300005338 Bacteria 17874
13 Ga0068868_100006311 3300005338 Bacteria 8380
14 Ga0068868_100034935 3300005338 Bacteria 3883
15 Ga0070660_100011437 3300005339 Bacteria 6305
16 Ga0070660_100052226 3300005339 Bacteria 3151
17 Ga0070660_100078132 3300005339 Bacteria 2595
18 Ga0070689_100099774 3300005340 Bacteria 2297
19 Ga0070661_100009694 3300005344 Bacteria 6680
20 Ga0070661_100188452 3300005344 Bacteria 1572
21 Ga0070661_100288297 3300005344 Bacteria 1275
22 Ga0070661_100382504 3300005344 Bacteria 1110
23 Ga0070692_10026792 3300005345 Bacteria 2852
24 Ga0070692_10031615 3300005345 Bacteria 2654
25 Ga0070669_100000643 3300005353 Bacteria 25821
26 Ga0070675_100056674 3300005354 Bacteria 3230
27 Ga0070671_100000784 3300005355 Bacteria 22894
28 Ga0070671_100012172 3300005355 Bacteria 6923
29 Ga0070671_100017658 3300005355 Bacteria 5781
30 Ga0070671_100117846 3300005355 Bacteria 2233
31 Ga0070674_100007764 3300005356 Bacteria 6340
32 Ga0070674_100026500 3300005356 Bacteria 3788
33 Ga0070673_100000663 3300005364 Bacteria 18945
34 Ga0070673_100012465 3300005364 Bacteria 5838
35 Ga0070673_100080383 3300005364 Bacteria 2641
36 Ga0070673_100340937 3300005364 Bacteria 1328
37 Ga0070659_100000382 3300005366 Bacteria 33581
38 Ga0070659_100007320 3300005366 Bacteria 8018
39 Ga0070659_100023443 3300005366 Bacteria 4722
40 Ga0070659_100076285 3300005366 Bacteria 2673
41 Ga0070659_100625964 3300005366 Unclassified 926
42 Ga0070667_100000520 3300005367 Bacteria 38650
43 Ga0070667_100001684 3300005367 Bacteria 19770
44 Ga0070667_100021677 3300005367 Bacteria 5332
45 Ga0070714_100046739 3300005435 Bacteria 3673
46 Ga0070713_100121090 3300005436 Bacteria 2295
47 Ga0070663_100009586 3300005455 Bacteria 6002
48 Ga0070663_100171476 3300005455 Bacteria 1677
49 Ga0070663_100253462 3300005455 Bacteria 1394
50 Ga0070678_100045766 3300005456 Bacteria 3132
51 Ga0070678_100101928 3300005456 Bacteria 2226
52 Ga0070662_100000975 3300005457 Bacteria 17516
53 Ga0070662_100119834 3300005457 Bacteria 2016
54 Ga0070662_100194338 3300005457 Bacteria 1607
55 Ga0070662_100478886 3300005457 Bacteria 1036
56 Ga0070681_10083231 3300005458 Bacteria 3153
57 Ga0070681_10254279 3300005458 Bacteria 1669
58 Ga0068867_100001073 3300005459 Bacteria 18682
59 Ga0068867_100003113 3300005459 Bacteria 11699
60 Ga0068867_100200753 3300005459 Bacteria 1596
61 Ga0068867_100215668 3300005459 Bacteria 1544
62 Ga0070679_100060450 3300005530 Bacteria 3776
63 Ga0070679_100297633 3300005530 Bacteria 1564
64 Ga0068853_100002970 3300005539 Bacteria 12921
65 Ga0068853_100159576 3300005539 Bacteria 2034
66 Ga0068853_100522991 3300005539 Bacteria 1122
67 Ga0068853_100524662 3300005539 Bacteria 1120
68 Ga0070672_100000342 3300005543 Bacteria 26866
69 Ga0070672_100009142 3300005543 Bacteria 6817
70 Ga0070672_100104878 3300005543 Bacteria 2297
71 Ga0070696_100093521 3300005546 Bacteria 2144
72 Ga0070696_100311333 3300005546 Bacteria 1209
73 Ga0070665_100735655 3300005548 Bacteria 999
74 Ga0068855_100147109 3300005563 Bacteria 2681
75 Ga0068855_100160912 3300005563 Bacteria 2548
76 Ga0070664_100003562 3300005564 Bacteria 12573
77 Ga0070664_100003589 3300005564 Bacteria 12514
78 Ga0070664_100025245 3300005564 Bacteria 4923
79 Ga0070664_100063791 3300005564 Bacteria 3141
80 Ga0070664_100206938 3300005564 Bacteria 1753
81 Ga0070664_100388530 3300005564 Bacteria 1275
82 Ga0068857_100003686 3300005577 Bacteria 12845
83 Ga0068857_100013620 3300005577 Bacteria 7085
84 Ga0068857_100057141 3300005577 Bacteria 3463
85 Ga0068857_100222495 3300005577 Bacteria 1724
86 Ga0068854_100000376 3300005578 Bacteria 28529
87 Ga0068854_100037487 3300005578 Bacteria 3404
88 Ga0068854_100041469 3300005578 Bacteria 3252
89 Ga0068856_100060780 3300005614 Bacteria 3732
90 Ga0068856_100222800 3300005614 Bacteria 1901
91 Ga0068856_100554766 3300005614 Bacteria 1170
92 Ga0068852_100001271 3300005616 Bacteria 16839
93 Ga0068852_100035005 3300005616 Bacteria 4184
94 Ga0068852_100085184 3300005616 Bacteria 2815
95 Ga0068852_100213373 3300005616 Bacteria 1832
96 Ga0068852_100233571 3300005616 Bacteria 1754
97 Ga0068859_100000982 3300005617 Bacteria 29213
98 Ga0068859_100061841 3300005617 Bacteria 3774
99 Ga0068859_100835255 3300005617 Bacteria 1008
100 Ga0068864_100000982 3300005618 Bacteria 23872
101 Ga0068864_100090916 3300005618 Bacteria 2691
102 Ga0068866_10021291 3300005718 Bacteria 2986
103 Ga0068851_10019419 3300005834 Bacteria 3284
104 Ga0068851_10020215 3300005834 Bacteria 3221
105 Ga0068851_10039368 3300005834 Bacteria 2373
106 Ga0068851_10040198 3300005834 Bacteria 2350
107 Ga0068863_100000871 3300005841 Bacteria 30229
108 Ga0068863_100050676 3300005841 Bacteria 3935
109 Ga0068858_100006590 3300005842 Bacteria 11297
110 Ga0068858_100014737 3300005842 Bacteria 7358
111 Ga0068858_100074533 3300005842 Bacteria 3151
112 Ga0068858_100467926 3300005842 Bacteria 1216
113 Ga0068860_100001576 3300005843 Bacteria 24578
114 Ga0068860_100029748 3300005843 Bacteria 5255
115 Ga0068860_100396052 3300005843 Bacteria 1365
116 Ga0068860_100523611 3300005843 Bacteria 1186
117 Ga0070712_100022733 3300006175 Bacteria 4134
118 Ga0068871_100033491 3300006358 Bacteria 4069
119 Ga0068865_100062669 3300006881 Bacteria 2611
120 Ga0097620_100000982 3300006931 Bacteria 29213
121 Ga0097620_100061841 3300006931 Bacteria 3774
122 Ga0097620_100835195 3300006931 Bacteria 1008
123 Ga0105240_10386554 3300009093 Bacteria 1579
124 Ga0105245_10000657 3300009098 Bacteria 31348
125 Ga0105243_10408716 3300009148 Bacteria 1263
126 Ga0105243_10595597 3300009148 Bacteria 1063
127 Ga0105242_10242812 3300009176 Bacteria 1620
128 Ga0105248_10000394 3300009177 Bacteria 50466
129 Ga0105248_10099823 3300009177 Bacteria 3271
130 Ga0105248_10147111 3300009177 Bacteria 2659
131 Ga0105248_10215831 3300009177 Bacteria 2161
132 Ga0105238_10056084 3300009551 Bacteria 3953
133 Ga0105239_10355211 3300010375 Bacteria 1655
134 Ga0157373_10019651 3300013100 Bacteria 4914
135 Ga0157371_10432766 3300013102 Bacteria 965
136 Ga0157370_10037567 3300013104 Bacteria 4694
137 Ga0157369_10069784 3300013105 Bacteria 3775
138 Ga0157369_10106226 3300013105 Bacteria 2988
139 Ga0157369_10765102 3300013105 Bacteria 993
140 Ga0157374_10009602 3300013296 Bacteria 8311
141 Ga0157374_10251873 3300013296 Bacteria 1738
142 Ga0157374_10820869 3300013296 Unclassified 946
143 Ga0157378_10078427 3300013297 Bacteria 2979
144 Ga0163162_10057255 3300013306 Bacteria 3926
145 Ga0163162_10129828 3300013306 Bacteria 2628
146 Ga0163162_10164961 3300013306 Bacteria 2339
147 Ga0157375_10040319 3300013308 Bacteria 4501
148 Ga0157375_10065348 3300013308 Bacteria 3626
149 Ga0157375_10124911 3300013308 Bacteria 2687
150 Ga0157375_10191301 3300013308 Bacteria 2201
151 Ga0163163_10604240 3300014325 Bacteria 1160
152 Ga0157379_10464509 3300014968 Bacteria 1170
153 Ga0157379_10606740 3300014968 Bacteria 1022
154 Ga0213875_10011631 3300021388 Bacteria 4374
155 Ga0207697_10090484 3300025315 Bacteria 1297
156 Ga0207656_10070720 3300025321 Bacteria 1550
157 Ga0207642_10019942 3300025899 Bacteria 2607
158 Ga0207688_10014674 3300025901 Bacteria 4255
159 Ga0207680_10002980 3300025903 Bacteria 7937
160 Ga0207680_10004835 3300025903 Bacteria 6409
161 Ga0207699_10039494 3300025906 Bacteria 2712
162 Ga0207645_10063666 3300025907 Bacteria 2357
163 Ga0207645_10063753 3300025907 Bacteria 2355
164 Ga0207645_10066096 3300025907 Bacteria 2312
165 Ga0207645_10090333 3300025907 Bacteria 1969
166 Ga0207645_10146768 3300025907 Bacteria 1538
167 Ga0207705_10004032 3300025909 Bacteria 11168
168 Ga0207705_10022260 3300025909 Bacteria 4521
169 Ga0207705_10028904 3300025909 Bacteria 3952
170 Ga0207705_10107412 3300025909 Bacteria 2059
171 Ga0207705_10164639 3300025909 Bacteria 1667
172 Ga0207705_10424595 3300025909 Bacteria 1029
173 Ga0207707_10271882 3300025912 Bacteria 1468
174 Ga0207707_10364136 3300025912 Bacteria 1244
175 Ga0207671_10454050 3300025914 Bacteria 1021
176 Ga0207693_10062291 3300025915 Bacteria 2922
177 Ga0207660_10023500 3300025917 Bacteria 4164
178 Ga0207662_10010077 3300025918 Bacteria 5209
179 Ga0207657_10016327 3300025919 Bacteria 7163
180 Ga0207657_10031009 3300025919 Bacteria 4847
181 Ga0207657_10048010 3300025919 Bacteria 3729
182 Ga0207657_10056867 3300025919 Bacteria 3373
183 Ga0207657_10077247 3300025919 Bacteria 2807
184 Ga0207657_10084926 3300025919 Bacteria 2652
185 Ga0207657_10104257 3300025919 Bacteria 2349
186 Ga0207657_10166725 3300025919 Bacteria 1786
187 Ga0207649_10144580 3300025920 Bacteria 1631
188 Ga0207649_10247291 3300025920 Bacteria 1283
189 Ga0207649_10305866 3300025920 Bacteria 1164
190 Ga0207694_10311514 3300025924 Bacteria 1298
191 Ga0207694_10475791 3300025924 Bacteria 1044
192 Ga0207650_10040992 3300025925 Bacteria 3391
193 Ga0207650_10075006 3300025925 Bacteria 2551
194 Ga0207650_10253918 3300025925 Bacteria 1424
195 Ga0207700_10167755 3300025928 Bacteria 1828
196 Ga0207664_10030600 3300025929 Bacteria 4112
197 Ga0207644_10000308 3300025931 Bacteria 31770
198 Ga0207644_10015287 3300025931 Bacteria 5148
199 Ga0207644_10025487 3300025931 Bacteria 4066
200 Ga0207644_10063447 3300025931 Bacteria 2682
201 Ga0207644_10138348 3300025931 Bacteria 1872
202 Ga0207690_10030227 3300025932 Bacteria 3453
203 Ga0207690_10308195 3300025932 Bacteria 1241
204 Ga0207690_10343621 3300025932 Bacteria 1178
205 Ga0207706_10016404 3300025933 Bacteria 6688
206 Ga0207706_10057579 3300025933 Bacteria 3423
207 Ga0207706_10092958 3300025933 Bacteria 2652
208 Ga0207706_10238888 3300025933 Bacteria 1588
209 Ga0207706_10277142 3300025933 Bacteria 1463
210 Ga0207686_10061994 3300025934 Bacteria 2373
211 Ga0207669_10012810 3300025937 Bacteria 4138
212 Ga0207691_10019225 3300025940 Bacteria 6466
213 Ga0207691_10122564 3300025940 Bacteria 2302
214 Ga0207711_10000876 3300025941 Bacteria 29060
215 Ga0207711_10002871 3300025941 Bacteria 15108
216 Ga0207711_10008432 3300025941 Bacteria 8618
217 Ga0207711_10016978 3300025941 Bacteria 6046
218 Ga0207689_10570101 3300025942 Bacteria 951
219 Ga0207661_10053484 3300025944 Bacteria 3231
220 Ga0207679_10010110 3300025945 Bacteria 6066
221 Ga0207679_10014881 3300025945 Bacteria 5125
222 Ga0207679_10384365 3300025945 Bacteria 1231
223 Ga0207667_10680564 3300025949 Unclassified 1032
224 Ga0207651_10029147 3300025960 Bacteria 3493
225 Ga0207651_10052281 3300025960 Bacteria 2785
226 Ga0207651_10069082 3300025960 Bacteria 2493
227 Ga0207651_10175120 3300025960 Bacteria 1696
228 Ga0207640_10030994 3300025981 Bacteria 3300
229 Ga0207640_10032443 3300025981 Bacteria 3238
230 Ga0207640_10049140 3300025981 Bacteria 2730
231 Ga0207640_10088028 3300025981 Bacteria 2143
232 Ga0207658_10004322 3300025986 Bacteria 9890
233 Ga0207658_10013965 3300025986 Bacteria 5496
234 Ga0207677_10020023 3300026023 Bacteria 4054
235 Ga0207677_10020076 3300026023 Bacteria 4049
236 Ga0207703_10037721 3300026035 Bacteria 3851
237 Ga0207703_10083875 3300026035 Bacteria 2663
238 Ga0207703_10254235 3300026035 Bacteria 1585
239 Ga0207639_10073181 3300026041 Bacteria 2686
240 Ga0207678_10006202 3300026067 Bacteria 10620
241 Ga0207678_10050163 3300026067 Bacteria 3606
242 Ga0207678_10052858 3300026067 Bacteria 3502
243 Ga0207678_10079163 3300026067 Bacteria 2814
244 Ga0207678_10117363 3300026067 Bacteria 2271
245 Ga0207678_10300762 3300026067 Bacteria 1379
246 Ga0207702_10170067 3300026078 Bacteria 1997
247 Ga0207702_10188972 3300026078 Bacteria 1902
248 Ga0207702_10235464 3300026078 Bacteria 1713
249 Ga0207702_10268216 3300026078 Bacteria 1609
250 Ga0207641_10003577 3300026088 Bacteria 13730
251 Ga0207641_10016769 3300026088 Bacteria 5999
252 Ga0207648_10008103 3300026089 Bacteria 10229
253 Ga0207648_10076062 3300026089 Bacteria 2926
254 Ga0207648_10145917 3300026089 Bacteria 2087
255 Ga0207676_10004467 3300026095 Bacteria 9889
256 Ga0207676_10196208 3300026095 Bacteria 1780
257 Ga0207676_10205132 3300026095 Bacteria 1745
258 Ga0207674_10028200 3300026116 Bacteria 5929
259 Ga0207674_10100329 3300026116 Bacteria 2876
260 Ga0207674_10170631 3300026116 Bacteria 2129
261 Ga0207674_10325831 3300026116 Bacteria 1486
262 Ga0207675_100302121 3300026118 Bacteria 1559
263 Ga0207683_10018862 3300026121 Bacteria 5885
264 Ga0207683_10045410 3300026121 Bacteria 3842
265 Ga0207683_10113079 3300026121 Bacteria 2432
266 Ga0207698_10030156 3300026142 Bacteria 3896
267 Ga0207698_10042660 3300026142 Bacteria 3392
268 Ga0207698_10045484 3300026142 Bacteria 3308
269 Ga0207698_10101596 3300026142 Bacteria 2385
270 Ga0207698_10212326 3300026142 Bacteria 1742
271 Ga0268264_10077805 3300028381 Bacteria 2826
272 Ga0307413_10126378 3300031824 Bacteria 1742
273 Ga0307406_10099856 3300031901 Bacteria 1974
274 Ga0307414_10072574 3300032004 Bacteria 2487
275 Ga0373943_0047077 3300035170 Bacteria 2107
276 Ga0373935_0018835 3300035692 Bacteria 4207
277 Ga0395899_0011295 3300037312 Bacteria 6838
278 Ga0395899_0016960 3300037312 Bacteria 5551
279 Ga0395899_0049835 3300037312 Bacteria 3111
280 Ga0395899_0178711 3300037312 Bacteria 1491
281 Ga0395899_0180224 3300037312 Bacteria 1483
282 Ga0395900_0025735 3300037418 Bacteria 6022
283 Ga0395900_0111229 3300037418 Bacteria 2813
284 Ga0395900_0196600 3300037418 Bacteria 2042
285 Ga0395900_0241092 3300037418 Bacteria 1813
286 Ga0395900_0250690 3300037418 Bacteria 1772
287 Ga0395900_0254838 3300037418 Bacteria 1754
288 Ga0395898_0015905 3300037466 Bacteria 7710
289 Ga0395898_0056492 3300037466 Bacteria 3825
290 Ga0395898_0112289 3300037466 Bacteria 2612
291 Ga0395898_0132918 3300037466 Bacteria 2382
292 Ga0395898_0291923 3300037466 Bacteria 1555
293 Ga0395898_0455196 3300037466 Bacteria 1218
294 Ga0395898_0702732 3300037466 Bacteria 953
295 Ga0395905_0004868 3300037471 Bacteria 13838
296 Ga0395905_0044408 3300037471 Bacteria 4171
297 Ga0395905_0064153 3300037471 Bacteria 3436
298 Ga0395905_0068507 3300037471 Bacteria 3323
299 Ga0395905_0092072 3300037471 Bacteria 2843
300 Ga0395905_0241733 3300037471 Bacteria 1687
301 Ga0436364_0292967 3300037853 Bacteria 4519
302 Ga0395901_0013677 3300038443 Bacteria 8247
303 Ga0395901_0040892 3300038443 Bacteria 4802
304 Ga0395901_0054391 3300038443 Bacteria 4160
305 Ga0395901_0069303 3300038443 Bacteria 3673
306 Ga0395901_0178922 3300038443 Bacteria 2224
307 Ga0395901_0576412 3300038443 Bacteria 1137
308 Ga0450889_001001 3300042144 Bacteria 2980
309 Ga0466969_0028355 3300044656 Bacteria 2862
310 Ga0466972_0017087 3300044658 Bacteria 3628
311 Ga0466966_0031580 3300044684 Bacteria 3434
312 Ga0466966_0086966 3300044684 Bacteria 1943
313 Ga0466961_0067776 3300044693 Bacteria 2267
314 Ga0466961_0072573 3300044693 Bacteria 2183
315 Ga0466963_0145503 3300044694 Bacteria 1644
316 Ga0466964_0046949 3300044706 Bacteria 1761
317 Ga0466971_0028796 3300044719 Bacteria 2484
318 Ga0466968_0001603 3300044735 Bacteria 8166
319 Ga0466970_0034067 3300044765 Bacteria 2694
320 Ga0466957_0022472 3300044842 Bacteria 3721
321 Ga0466957_0271090 3300044842 Bacteria 1133
322 Ga0466960_0015799 3300044901 Bacteria 3262
323 Ga0466959_0053123 3300045049 Bacteria 2963
324 Ga0466959_0200956 3300045049 Bacteria 1388
325 Ga0466959_0257002 3300045049 Bacteria 1203
326 Ga0466958_0041994 3300045836 Bacteria 2752
327 Ga0466958_0203111 3300045836 Bacteria 1261
328 Ga0466967_0126562 3300045976 Bacteria 2367
329 Ga0495669_0007836 3300046684 Bacteria 4482
330 Ga0495669_0064903 3300046684 Bacteria 1657
331 Ga0495669_0161606 3300046684 Bacteria 1063
332 Ga0496100_0035809 3300048903 Bacteria 3125
333 Ga0496100_0415225 3300048903 Bacteria 1027
334 Ga0496101_0018477 3300048904 Bacteria 4741
335 Ga0496103_0067309 3300048906 Bacteria 2237
336 Ga0496103_0189639 3300048906 Bacteria 1322
337 Ga0496106_0458820 3300048909 Bacteria 1024
338 Ga0496107_0011093 3300048910 Bacteria 6269
339 Ga0496107_0248552 3300048910 Bacteria 1323
340 Ga0496108_0036883 3300048911 Bacteria 4069
341 Ga0496109_0026249 3300048912 Bacteria 5194
342 Ga0496109_0239128 3300048912 Bacteria 1709
343 Ga0496110_0111234 3300048913 Bacteria 2462
344 Ga0496112_0205008 3300048915 Bacteria 1930
345 Ga0496114_0000023 3300048917 Bacteria 219092
346 Ga0496115_0068137 3300048918 Bacteria 2880
347 Ga0466962_0082405 3300061719 Bacteria 1538

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100093521 Ga0070696_1000935212 249
2 3300009177 Ga0105248_10215831 Ga0105248_102158313 249
3 3300013102 Ga0157371_10432766 Ga0157371_104327661 249
4 3300013296 Ga0157374_10820869 Ga0157374_108208692 249
5 3300037466 Ga0395898_0702732 Ga0395898_0702732_135_920 249
6 3300037471 Ga0395905_0241733 Ga0395905_0241733_682_1476 249
7 3300038443 Ga0395901_0576412 Ga0395901_0576412_294_1088 249
8 3300044684 Ga0466966_0086966 Ga0466966_0086966_128_916 249
9 3300044719 Ga0466971_0028796 Ga0466971_0028796_225_1019 249
10 3300045049 Ga0466959_0200956 Ga0466959_0200956_127_921 249
11 3300048903 Ga0496100_0415225 Ga0496100_0415225_74_868 249
12 3300048910 Ga0496107_0248552 Ga0496107_0248552_361_1155 249
13 3300048911 Ga0496108_0036883 Ga0496108_0036883_1900_2694 249
14 3300048912 Ga0496109_0026249 Ga0496109_0026249_3653_4447 249
15 3300048913 Ga0496110_0111234 Ga0496110_0111234_139_933 249
16 3300048915 Ga0496112_0205008 Ga0496112_0205008_529_1323 249
17 3300048918 Ga0496115_0068137 Ga0496115_0068137_1110_1904 249
18 3300009093 Ga0105240_10386554 Ga0105240_103865542 255
19 3300013105 Ga0157369_10765102 Ga0157369_107651021 255
20 3300025914 Ga0207671_10454050 Ga0207671_104540501 255
21 3300025924 Ga0207694_10311514 Ga0207694_103115142 255
22 3300025929 Ga0207664_10030600 Ga0207664_100306002 255
23 3300026142 Ga0207698_10042660 Ga0207698_100426602 255
24 3300037466 Ga0395898_0455196 Ga0395898_0455196_255_1103 255
25 3300005577 Ga0068857_100013620 Ga0068857_1000136205 263
26 3300026116 Ga0207674_10028200 Ga0207674_100282006 263
27 3300037471 Ga0395905_0092072 Ga0395905_0092072_1393_2229 263
28 3300037466 Ga0395898_0112289 Ga0395898_0112289_1595_2431 264
29 3300037471 Ga0395905_0044408 Ga0395905_0044408_1878_2714 264
30 3300038443 Ga0395901_0040892 Ga0395901_0040892_2396_3232 264
31 3300005366 Ga0070659_100076285 Ga0070659_1000762852 265
32 3300042144 Ga0450889_001001 Ga0450889_001001_1690_2523 265
33 3300005327 Ga0070658_10403723 Ga0070658_104037232 266
34 3300005614 Ga0068856_100222800 Ga0068856_1002228003 266
35 3300013105 Ga0157369_10069784 Ga0157369_100697844 266
36 3300026078 Ga0207702_10188972 Ga0207702_101889722 266
37 3300002077 JGI24744J21845_10003311 JGI24744J21845_100033113 267
38 3300003320 rootH2_10093800 rootH2_100938001 267
39 3300005327 Ga0070658_10126872 Ga0070658_101268722 267
40 3300005327 Ga0070658_10618193 Ga0070658_106181931 267
41 3300005331 Ga0070670_100053046 Ga0070670_1000530464 267
42 3300005331 Ga0070670_100100941 Ga0070670_1001009411 267
43 3300005338 Ga0068868_100006311 Ga0068868_1000063116 267
44 3300005338 Ga0068868_100034935 Ga0068868_1000349353 267
45 3300005339 Ga0070660_100011437 Ga0070660_1000114373 267
46 3300005339 Ga0070660_100078132 Ga0070660_1000781321 267
47 3300005344 Ga0070661_100009694 Ga0070661_1000096949 267
48 3300005344 Ga0070661_100188452 Ga0070661_1001884523 267
49 3300005344 Ga0070661_100288297 Ga0070661_1002882972 267
50 3300005345 Ga0070692_10026792 Ga0070692_100267922 267
51 3300005345 Ga0070692_10031615 Ga0070692_100316153 267
52 3300005355 Ga0070671_100000784 Ga0070671_10000078427 267
53 3300005355 Ga0070671_100012172 Ga0070671_1000121729 267
54 3300005355 Ga0070671_100117846 Ga0070671_1001178462 267
55 3300005356 Ga0070674_100007764 Ga0070674_1000077647 267
56 3300005356 Ga0070674_100026500 Ga0070674_1000265005 267
57 3300005364 Ga0070673_100012465 Ga0070673_1000124651 267
58 3300005364 Ga0070673_100080383 Ga0070673_1000803831 267
59 3300005364 Ga0070673_100340937 Ga0070673_1003409372 267
60 3300005366 Ga0070659_100007320 Ga0070659_1000073206 267
61 3300005366 Ga0070659_100023443 Ga0070659_1000234434 267
62 3300005366 Ga0070659_100625964 Ga0070659_1006259641 267
63 3300005367 Ga0070667_100001684 Ga0070667_10000168419 267
64 3300005367 Ga0070667_100021677 Ga0070667_1000216776 267
65 3300005435 Ga0070714_100046739 Ga0070714_1000467396 267
66 3300005436 Ga0070713_100121090 Ga0070713_1001210904 267
67 3300005455 Ga0070663_100009586 Ga0070663_1000095865 267
68 3300005455 Ga0070663_100171476 Ga0070663_1001714762 267
69 3300005455 Ga0070663_100253462 Ga0070663_1002534622 267
70 3300005456 Ga0070678_100045766 Ga0070678_1000457665 267
71 3300005456 Ga0070678_100101928 Ga0070678_1001019283 267
72 3300005457 Ga0070662_100119834 Ga0070662_1001198342 267
73 3300005457 Ga0070662_100194338 Ga0070662_1001943382 267
74 3300005457 Ga0070662_100478886 Ga0070662_1004788861 267
75 3300005458 Ga0070681_10083231 Ga0070681_100832315 267
76 3300005458 Ga0070681_10254279 Ga0070681_102542791 267
77 3300005459 Ga0068867_100003113 Ga0068867_1000031131 267
78 3300005459 Ga0068867_100200753 Ga0068867_1002007531 267
79 3300005459 Ga0068867_100215668 Ga0068867_1002156683 267
80 3300005530 Ga0070679_100060450 Ga0070679_1000604503 267
81 3300005530 Ga0070679_100297633 Ga0070679_1002976332 267
82 3300005539 Ga0068853_100159576 Ga0068853_1001595761 267
83 3300005539 Ga0068853_100522991 Ga0068853_1005229911 267
84 3300005539 Ga0068853_100524662 Ga0068853_1005246622 267
85 3300005543 Ga0070672_100009142 Ga0070672_1000091426 267
86 3300005543 Ga0070672_100104878 Ga0070672_1001048782 267
87 3300005546 Ga0070696_100311333 Ga0070696_1003113332 267
88 3300005563 Ga0068855_100160912 Ga0068855_1001609121 267
89 3300005564 Ga0070664_100003562 Ga0070664_1000035625 267
90 3300005564 Ga0070664_100003589 Ga0070664_1000035899 267
91 3300005564 Ga0070664_100025245 Ga0070664_1000252453 267
92 3300005564 Ga0070664_100063791 Ga0070664_1000637913 267
93 3300005564 Ga0070664_100206938 Ga0070664_1002069382 267
94 3300005577 Ga0068857_100057141 Ga0068857_1000571414 267
95 3300005577 Ga0068857_100222495 Ga0068857_1002224952 267
96 3300005578 Ga0068854_100037487 Ga0068854_1000374873 267
97 3300005578 Ga0068854_100041469 Ga0068854_1000414692 267
98 3300005614 Ga0068856_100060780 Ga0068856_1000607802 267
99 3300005616 Ga0068852_100035005 Ga0068852_1000350055 267
100 3300005616 Ga0068852_100085184 Ga0068852_1000851842 267
101 3300005616 Ga0068852_100213373 Ga0068852_1002133732 267
102 3300005616 Ga0068852_100233571 Ga0068852_1002335712 267
103 3300005617 Ga0068859_100061841 Ga0068859_1000618415 267
104 3300005617 Ga0068859_100835255 Ga0068859_1008352552 267
105 3300005618 Ga0068864_100000982 Ga0068864_1000009829 267
106 3300005618 Ga0068864_100090916 Ga0068864_1000909162 267
107 3300005718 Ga0068866_10021291 Ga0068866_100212912 267
108 3300005834 Ga0068851_10019419 Ga0068851_100194195 267
109 3300005834 Ga0068851_10020215 Ga0068851_100202152 267
110 3300005834 Ga0068851_10040198 Ga0068851_100401982 267
111 3300005841 Ga0068863_100050676 Ga0068863_1000506764 267
112 3300005842 Ga0068858_100006590 Ga0068858_1000065907 267
113 3300005842 Ga0068858_100074533 Ga0068858_1000745335 267
114 3300005842 Ga0068858_100467926 Ga0068858_1004679262 267
115 3300005843 Ga0068860_100029748 Ga0068860_1000297486 267
116 3300005843 Ga0068860_100396052 Ga0068860_1003960522 267
117 3300005843 Ga0068860_100523611 Ga0068860_1005236112 267
118 3300006175 Ga0070712_100022733 Ga0070712_1000227338 267
119 3300006931 Ga0097620_100061841 Ga0097620_1000618415 267
120 3300006931 Ga0097620_100835195 Ga0097620_1008351951 267
121 3300009148 Ga0105243_10408716 Ga0105243_104087162 267
122 3300009148 Ga0105243_10595597 Ga0105243_105955971 267
123 3300009176 Ga0105242_10242812 Ga0105242_102428122 267
124 3300009177 Ga0105248_10099823 Ga0105248_100998233 267
125 3300009177 Ga0105248_10147111 Ga0105248_101471115 267
126 3300009551 Ga0105238_10056084 Ga0105238_100560843 267
127 3300010375 Ga0105239_10355211 Ga0105239_103552113 267
128 3300013104 Ga0157370_10037567 Ga0157370_100375676 267
129 3300013105 Ga0157369_10106226 Ga0157369_101062262 267
130 3300013296 Ga0157374_10009602 Ga0157374_100096025 267
131 3300013296 Ga0157374_10251873 Ga0157374_102518732 267
132 3300013297 Ga0157378_10078427 Ga0157378_100784272 267
133 3300013306 Ga0163162_10129828 Ga0163162_101298281 267
134 3300013306 Ga0163162_10164961 Ga0163162_101649611 267
135 3300013308 Ga0157375_10040319 Ga0157375_100403196 267
136 3300013308 Ga0157375_10065348 Ga0157375_100653482 267
137 3300013308 Ga0157375_10124911 Ga0157375_101249113 267
138 3300014325 Ga0163163_10604240 Ga0163163_106042402 267
139 3300014968 Ga0157379_10464509 Ga0157379_104645092 267
140 3300014968 Ga0157379_10606740 Ga0157379_106067402 267
141 3300021388 Ga0213875_10011631 Ga0213875_100116316 267
142 3300025315 Ga0207697_10090484 Ga0207697_100904841 267
143 3300025321 Ga0207656_10070720 Ga0207656_100707202 267
144 3300025899 Ga0207642_10019942 Ga0207642_100199424 267
145 3300025901 Ga0207688_10014674 Ga0207688_100146742 267
146 3300025903 Ga0207680_10002980 Ga0207680_100029808 267
147 3300025903 Ga0207680_10004835 Ga0207680_100048352 267
148 3300025906 Ga0207699_10039494 Ga0207699_100394942 267
149 3300025907 Ga0207645_10063666 Ga0207645_100636662 267
150 3300025907 Ga0207645_10063753 Ga0207645_100637533 267
151 3300025907 Ga0207645_10066096 Ga0207645_100660962 267
152 3300025907 Ga0207645_10090333 Ga0207645_100903332 267
153 3300025907 Ga0207645_10146768 Ga0207645_101467682 267
154 3300025909 Ga0207705_10004032 Ga0207705_100040328 267
155 3300025909 Ga0207705_10022260 Ga0207705_100222606 267
156 3300025909 Ga0207705_10028904 Ga0207705_100289045 267
157 3300025909 Ga0207705_10107412 Ga0207705_101074122 267
158 3300025909 Ga0207705_10164639 Ga0207705_101646392 267
159 3300025909 Ga0207705_10424595 Ga0207705_104245952 267
160 3300025912 Ga0207707_10271882 Ga0207707_102718822 267
161 3300025912 Ga0207707_10364136 Ga0207707_103641362 267
162 3300025915 Ga0207693_10062291 Ga0207693_100622914 267
163 3300025917 Ga0207660_10023500 Ga0207660_100235003 267
164 3300025918 Ga0207662_10010077 Ga0207662_100100772 267
165 3300025919 Ga0207657_10016327 Ga0207657_100163276 267
166 3300025919 Ga0207657_10031009 Ga0207657_100310095 267
167 3300025919 Ga0207657_10048010 Ga0207657_100480105 267
168 3300025919 Ga0207657_10056867 Ga0207657_100568672 267
169 3300025919 Ga0207657_10077247 Ga0207657_100772473 267
170 3300025919 Ga0207657_10084926 Ga0207657_100849263 267
171 3300025919 Ga0207657_10104257 Ga0207657_101042574 267
172 3300025919 Ga0207657_10166725 Ga0207657_101667252 267
173 3300025920 Ga0207649_10144580 Ga0207649_101445801 267
174 3300025920 Ga0207649_10247291 Ga0207649_102472912 267
175 3300025924 Ga0207694_10475791 Ga0207694_104757911 267
176 3300025925 Ga0207650_10040992 Ga0207650_100409924 267
177 3300025925 Ga0207650_10075006 Ga0207650_100750062 267
178 3300025925 Ga0207650_10253918 Ga0207650_102539182 267
179 3300025928 Ga0207700_10167755 Ga0207700_101677552 267
180 3300025931 Ga0207644_10000308 Ga0207644_1000030817 267
181 3300025931 Ga0207644_10015287 Ga0207644_100152873 267
182 3300025931 Ga0207644_10025487 Ga0207644_100254875 267
183 3300025931 Ga0207644_10063447 Ga0207644_100634472 267
184 3300025931 Ga0207644_10138348 Ga0207644_101383482 267
185 3300025932 Ga0207690_10030227 Ga0207690_100302273 267
186 3300025932 Ga0207690_10308195 Ga0207690_103081951 267
187 3300025932 Ga0207690_10343621 Ga0207690_103436212 267
188 3300025933 Ga0207706_10016404 Ga0207706_100164046 267
189 3300025933 Ga0207706_10057579 Ga0207706_100575793 267
190 3300025933 Ga0207706_10092958 Ga0207706_100929585 267
191 3300025933 Ga0207706_10238888 Ga0207706_102388882 267
192 3300025933 Ga0207706_10277142 Ga0207706_102771422 267
193 3300025934 Ga0207686_10061994 Ga0207686_100619943 267
194 3300025937 Ga0207669_10012810 Ga0207669_100128104 267
195 3300025940 Ga0207691_10019225 Ga0207691_100192255 267
196 3300025940 Ga0207691_10122564 Ga0207691_101225642 267
197 3300025941 Ga0207711_10000876 Ga0207711_1000087617 267
198 3300025941 Ga0207711_10002871 Ga0207711_1000287122 267
199 3300025941 Ga0207711_10008432 Ga0207711_100084326 267
200 3300025941 Ga0207711_10016978 Ga0207711_100169786 267
201 3300025942 Ga0207689_10570101 Ga0207689_105701011 267
202 3300025944 Ga0207661_10053484 Ga0207661_100534842 267
203 3300025945 Ga0207679_10010110 Ga0207679_100101107 267
204 3300025945 Ga0207679_10014881 Ga0207679_100148816 267
205 3300025945 Ga0207679_10384365 Ga0207679_103843652 267
206 3300025949 Ga0207667_10680564 Ga0207667_106805642 267
207 3300025960 Ga0207651_10029147 Ga0207651_100291474 267
208 3300025960 Ga0207651_10052281 Ga0207651_100522812 267
209 3300025960 Ga0207651_10069082 Ga0207651_100690821 267
210 3300025960 Ga0207651_10175120 Ga0207651_101751202 267
211 3300025981 Ga0207640_10030994 Ga0207640_100309943 267
212 3300025981 Ga0207640_10032443 Ga0207640_100324432 267
213 3300025981 Ga0207640_10049140 Ga0207640_100491402 267
214 3300025981 Ga0207640_10088028 Ga0207640_100880282 267
215 3300025986 Ga0207658_10004322 Ga0207658_100043222 267
216 3300025986 Ga0207658_10013965 Ga0207658_100139652 267
217 3300026023 Ga0207677_10020023 Ga0207677_100200233 267
218 3300026023 Ga0207677_10020076 Ga0207677_100200763 267
219 3300026035 Ga0207703_10037721 Ga0207703_100377213 267
220 3300026035 Ga0207703_10083875 Ga0207703_100838752 267
221 3300026035 Ga0207703_10254235 Ga0207703_102542352 267
222 3300026041 Ga0207639_10073181 Ga0207639_100731812 267
223 3300026067 Ga0207678_10006202 Ga0207678_100062024 267
224 3300026067 Ga0207678_10050163 Ga0207678_100501636 267
225 3300026067 Ga0207678_10052858 Ga0207678_100528584 267
226 3300026067 Ga0207678_10079163 Ga0207678_100791634 267
227 3300026067 Ga0207678_10117363 Ga0207678_101173632 267
228 3300026067 Ga0207678_10300762 Ga0207678_103007621 267
229 3300026078 Ga0207702_10170067 Ga0207702_101700672 267
230 3300026078 Ga0207702_10268216 Ga0207702_102682161 267
231 3300026088 Ga0207641_10003577 Ga0207641_100035774 267
232 3300026088 Ga0207641_10016769 Ga0207641_100167694 267
233 3300026089 Ga0207648_10008103 Ga0207648_100081036 267
234 3300026089 Ga0207648_10076062 Ga0207648_100760625 267
235 3300026089 Ga0207648_10145917 Ga0207648_101459171 267
236 3300026095 Ga0207676_10004467 Ga0207676_100044675 267
237 3300026095 Ga0207676_10196208 Ga0207676_101962082 267
238 3300026095 Ga0207676_10205132 Ga0207676_102051322 267
239 3300026116 Ga0207674_10100329 Ga0207674_101003293 267
240 3300026116 Ga0207674_10170631 Ga0207674_101706312 267
241 3300026116 Ga0207674_10325831 Ga0207674_103258312 267
242 3300026118 Ga0207675_100302121 Ga0207675_1003021212 267
243 3300026121 Ga0207683_10018862 Ga0207683_100188623 267
244 3300026121 Ga0207683_10045410 Ga0207683_100454103 267
245 3300026121 Ga0207683_10113079 Ga0207683_101130793 267
246 3300026142 Ga0207698_10030156 Ga0207698_100301566 267
247 3300026142 Ga0207698_10045484 Ga0207698_100454846 267
248 3300026142 Ga0207698_10101596 Ga0207698_101015962 267
249 3300026142 Ga0207698_10212326 Ga0207698_102123262 267
250 3300028381 Ga0268264_10077805 Ga0268264_100778054 267
251 3300031824 Ga0307413_10126378 Ga0307413_101263782 267
252 3300031901 Ga0307406_10099856 Ga0307406_100998563 267
253 3300032004 Ga0307414_10072574 Ga0307414_100725742 267
254 3300035170 Ga0373943_0047077 Ga0373943_0047077_336_1187 267
255 3300035692 Ga0373935_0018835 Ga0373935_0018835_919_1770 267
256 3300037312 Ga0395899_0011295 Ga0395899_0011295_5687_6529 267
257 3300037312 Ga0395899_0016960 Ga0395899_0016960_605_1432 267
258 3300037312 Ga0395899_0049835 Ga0395899_0049835_2034_2882 267
259 3300037312 Ga0395899_0178711 Ga0395899_0178711_472_1311 267
260 3300037312 Ga0395899_0180224 Ga0395899_0180224_72_920 267
261 3300037418 Ga0395900_0025735 Ga0395900_0025735_2960_3802 267
262 3300037418 Ga0395900_0111229 Ga0395900_0111229_1925_2773 267
263 3300037418 Ga0395900_0196600 Ga0395900_0196600_862_1710 267
264 3300037418 Ga0395900_0241092 Ga0395900_0241092_870_1718 267
265 3300037418 Ga0395900_0250690 Ga0395900_0250690_485_1327 267
266 3300037418 Ga0395900_0254838 Ga0395900_0254838_347_1195 267
267 3300037466 Ga0395898_0015905 Ga0395898_0015905_5119_5961 267
268 3300037466 Ga0395898_0056492 Ga0395898_0056492_2034_2882 267
269 3300037466 Ga0395898_0132918 Ga0395898_0132918_808_1656 267
270 3300037466 Ga0395898_0291923 Ga0395898_0291923_33_881 267
271 3300037471 Ga0395905_0004868 Ga0395905_0004868_6508_7350 267
272 3300037471 Ga0395905_0064153 Ga0395905_0064153_2034_2882 267
273 3300037471 Ga0395905_0068507 Ga0395905_0068507_1673_2512 267
274 3300037853 Ga0436364_0292967 Ga0436364_0292967_543_1358 267
275 3300038443 Ga0395901_0013677 Ga0395901_0013677_6078_6920 267
276 3300038443 Ga0395901_0054391 Ga0395901_0054391_1925_2773 267
277 3300038443 Ga0395901_0069303 Ga0395901_0069303_1795_2643 267
278 3300038443 Ga0395901_0178922 Ga0395901_0178922_817_1665 267
279 3300044656 Ga0466969_0028355 Ga0466969_0028355_145_993 267
280 3300044658 Ga0466972_0017087 Ga0466972_0017087_90_938 267
281 3300044684 Ga0466966_0031580 Ga0466966_0031580_155_1003 267
282 3300044693 Ga0466961_0067776 Ga0466961_0067776_1026_1874 267
283 3300044693 Ga0466961_0072573 Ga0466961_0072573_187_1035 267
284 3300044694 Ga0466963_0145503 Ga0466963_0145503_610_1458 267
285 3300044706 Ga0466964_0046949 Ga0466964_0046949_752_1600 267
286 3300044735 Ga0466968_0001603 Ga0466968_0001603_4072_4920 267
287 3300044765 Ga0466970_0034067 Ga0466970_0034067_1284_2132 267
288 3300044842 Ga0466957_0022472 Ga0466957_0022472_2658_3506 267
289 3300044842 Ga0466957_0271090 Ga0466957_0271090_132_980 267
290 3300044901 Ga0466960_0015799 Ga0466960_0015799_79_930 267
291 3300045049 Ga0466959_0053123 Ga0466959_0053123_2001_2849 267
292 3300045049 Ga0466959_0257002 Ga0466959_0257002_251_1099 267
293 3300045836 Ga0466958_0041994 Ga0466958_0041994_1712_2560 267
294 3300045836 Ga0466958_0203111 Ga0466958_0203111_228_1076 267
295 3300045976 Ga0466967_0126562 Ga0466967_0126562_151_999 267
296 3300046684 Ga0495669_0007836 Ga0495669_0007836_813_1661 267
297 3300046684 Ga0495669_0064903 Ga0495669_0064903_23_871 267
298 3300046684 Ga0495669_0161606 Ga0495669_0161606_76_924 267
299 3300048903 Ga0496100_0035809 Ga0496100_0035809_1768_2616 267
300 3300048904 Ga0496101_0018477 Ga0496101_0018477_3824_4672 267
301 3300048906 Ga0496103_0067309 Ga0496103_0067309_70_918 267
302 3300048906 Ga0496103_0189639 Ga0496103_0189639_82_933 267
303 3300048909 Ga0496106_0458820 Ga0496106_0458820_14_862 267
304 3300048910 Ga0496107_0011093 Ga0496107_0011093_2181_3029 267
305 3300048912 Ga0496109_0239128 Ga0496109_0239128_576_1433 267
306 3300048917 Ga0496114_0000023 Ga0496114_0000023_143777_144625 267
307 3300061719 Ga0466962_0082405 Ga0466962_0082405_660_1508 267
308 3300025920 Ga0207649_10305866 Ga0207649_103058662 268
309 3300026078 Ga0207702_10235464 Ga0207702_102354642 269
310 3300001990 JGI24737J22298_10000281 JGI24737J22298_1000028123 273
311 3300005328 Ga0070676_10003383 Ga0070676_100033832 273
312 3300005330 Ga0070690_100064884 Ga0070690_1000648843 273
313 3300005334 Ga0068869_100000385 Ga0068869_10000038521 273
314 3300005338 Ga0068868_100001184 Ga0068868_1000011847 273
315 3300005339 Ga0070660_100052226 Ga0070660_1000522265 273
316 3300005340 Ga0070689_100099774 Ga0070689_1000997744 273
317 3300005344 Ga0070661_100382504 Ga0070661_1003825042 273
318 3300005353 Ga0070669_100000643 Ga0070669_1000006437 273
319 3300005354 Ga0070675_100056674 Ga0070675_1000566745 273
320 3300005355 Ga0070671_100017658 Ga0070671_1000176587 273
321 3300005364 Ga0070673_100000663 Ga0070673_10000066310 273
322 3300005366 Ga0070659_100000382 Ga0070659_10000038220 273
323 3300005367 Ga0070667_100000520 Ga0070667_10000052023 273
324 3300005457 Ga0070662_100000975 Ga0070662_10000097521 273
325 3300005459 Ga0068867_100001073 Ga0068867_1000010737 273
326 3300005539 Ga0068853_100002970 Ga0068853_10000297011 273
327 3300005543 Ga0070672_100000342 Ga0070672_10000034222 273
328 3300005548 Ga0070665_100735655 Ga0070665_1007356551 273
329 3300005563 Ga0068855_100147109 Ga0068855_1001471092 273
330 3300005564 Ga0070664_100388530 Ga0070664_1003885302 273
331 3300005577 Ga0068857_100003686 Ga0068857_1000036861 273
332 3300005578 Ga0068854_100000376 Ga0068854_10000037636 273
333 3300005614 Ga0068856_100554766 Ga0068856_1005547662 273
334 3300005616 Ga0068852_100001271 Ga0068852_10000127112 273
335 3300005617 Ga0068859_100000982 Ga0068859_10000098220 273
336 3300005834 Ga0068851_10039368 Ga0068851_100393682 273
337 3300005841 Ga0068863_100000871 Ga0068863_10000087128 273
338 3300005842 Ga0068858_100014737 Ga0068858_1000147378 273
339 3300005843 Ga0068860_100001576 Ga0068860_10000157623 273
340 3300006358 Ga0068871_100033491 Ga0068871_1000334913 273
341 3300006881 Ga0068865_100062669 Ga0068865_1000626692 273
342 3300006931 Ga0097620_100000982 Ga0097620_10000098212 273
343 3300009098 Ga0105245_10000657 Ga0105245_1000065723 273
344 3300009177 Ga0105248_10000394 Ga0105248_1000039415 273
345 3300013100 Ga0157373_10019651 Ga0157373_100196513 273
346 3300013306 Ga0163162_10057255 Ga0163162_100572554 273
347 3300013308 Ga0157375_10191301 Ga0157375_101913012 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14748

P5CR_dimer

Pyrroline-5-carboxylate reductase dimerisation

161

237

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

12

98

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rcy-assembly1.cif.gz_A crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8956 4 265
6lhm-assembly2.cif.gz_B structure of human pycr2 0.8953 12 266
2rcy-assembly1.cif.gz_D-2 crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8951 11 265
2rcy-assembly1.cif.gz_E-2 crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8912 12 265
2rcy-assembly1.cif.gz_A crystal structure of plasmodium falciparum pyrroline carboxylate reductase (mal13p1.284) with nadp bound 0.8892 4 265
ID Description Score Start End Superfamily
af_Q4DH60_1_162_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9106 11 161 3.40.50.720
af_Q21544_1_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9058 11 162 3.40.50.720
af_P0A9L8_1_164_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8967 7 161 3.40.50.720
af_Q5SPD7_3_179_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8957 9 161 3.40.50.720
af_Q9VEJ3_1_166_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.888 9 162 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7G9SGC3-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.9504 5 269 GO:0004735
GO:0005737
GO:0055129
AF-A0A520IB92-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9462 8 225 GO:0004735
GO:0055129
AF-A0A6G7ZNW8-F1-model_v4 Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR) (EC 1.5.1.2) (PCA reductase) 0.9446 6 270 GO:0004735
GO:0005737
GO:0055129
AF-A0A3D4CI51-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9364 99 244 GO:0004735
GO:0055129
AF-A0A536BZ74-F1-model_v4 Pyrroline-5-carboxylate reductase 0.9362 97 234 GO:0004735
GO:0055129

Feature Viewer

pLDDT pTM Quality
84.7 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map