F417134

General Info

Members Datasets Scaffolds Average Seq Length
347 218 694 186

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10394403|Ga0105249_103944032
Length 203
Sequence LPFVDRVTPVVQLASEAVAQTRSARLIILDRDGVINHDSDQFIKSPDEWRPIPGSLEAIARLSHAGYRVAVCTNQSGIGRGLFDMATLNAIHNKMHRALSLVGGRVDAVFFCPHTGDAKCECRKPQPAMMLEAGRRFGADLTTVPCVGDGLRDLQAADTAGAQPILVLTGKGEKTLRDGGFPPSTVIFPDLAFAASALLAGEA

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
203 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 4.03
Rhizosphere 93.66
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10394403 3300009553 Bacteria 1413
2 Ga0070658_10062663 3300005327 Bacteria 3030
3 Ga0070683_100141001 3300005329 Bacteria 2284
4 Ga0070683_100498450 3300005329 Unclassified 1163
5 Ga0070670_100024540 3300005331 Bacteria 5184
6 Ga0070677_10042605 3300005333 Bacteria 1799
7 Ga0070680_100182053 3300005336 Bacteria 1770
8 Ga0070680_100189996 3300005336 Bacteria 1730
9 Ga0068868_100011122 3300005338 Bacteria 6549
10 Ga0068868_100146651 3300005338 Bacteria 1941
11 Ga0070660_100474930 3300005339 Bacteria 1039
12 Ga0070689_100556304 3300005340 Bacteria 989
13 Ga0070661_100112104 3300005344 Bacteria 2038
14 Ga0070661_100401393 3300005344 Bacteria 1084
15 Ga0070668_100084002 3300005347 Bacteria 2500
16 Ga0070668_100258693 3300005347 Bacteria 1447
17 Ga0070669_100089295 3300005353 Bacteria 2308
18 Ga0070675_100011661 3300005354 Bacteria 6887
19 Ga0070671_100002688 3300005355 Bacteria 13785
20 Ga0070671_100006008 3300005355 Bacteria 9676
21 Ga0070671_100067739 3300005355 Bacteria 2976
22 Ga0070671_100201157 3300005355 Bacteria 1689
23 Ga0070671_100217813 3300005355 Bacteria 1620
24 Ga0070674_100023647 3300005356 Bacteria 3980
25 Ga0070673_100022157 3300005364 Bacteria 4619
26 Ga0070688_100395176 3300005365 Bacteria 1022
27 Ga0070667_100046709 3300005367 Bacteria 3643
28 Ga0070667_100168383 3300005367 Bacteria 1933
29 Ga0070667_100607087 3300005367 Bacteria 1008
30 Ga0070709_10108887 3300005434 Bacteria 1859
31 Ga0070714_100578468 3300005435 Bacteria 1077
32 Ga0070711_100760011 3300005439 Bacteria 820
33 Ga0070705_100099698 3300005440 Bacteria 1831
34 Ga0070694_100660438 3300005444 Bacteria 847
35 Ga0070708_100211934 3300005445 Bacteria 1815
36 Ga0070663_100202608 3300005455 Bacteria 1549
37 Ga0070678_100037134 3300005456 Bacteria 3417
38 Ga0070678_100232106 3300005456 Bacteria 1539
39 Ga0070678_100533551 3300005456 Unclassified 1040
40 Ga0070678_100579865 3300005456 Bacteria 999
41 Ga0070681_10004785 3300005458 Bacteria 12971
42 Ga0068867_100020734 3300005459 Bacteria 4685
43 Ga0068867_100098643 3300005459 Bacteria 2228
44 Ga0068867_100125356 3300005459 Bacteria 1989
45 Ga0070685_10634997 3300005466 Bacteria 772
46 Ga0070706_100451594 3300005467 Bacteria 1196
47 Ga0070707_100753701 3300005468 Bacteria 937
48 Ga0070699_100141648 3300005518 Bacteria 2124
49 Ga0070679_100015755 3300005530 Bacteria 7272
50 Ga0070684_100133989 3300005535 Bacteria 2236
51 Ga0068853_100003272 3300005539 Bacteria 12389
52 Ga0068853_100820141 3300005539 Unclassified 891
53 Ga0070672_100001767 3300005543 Bacteria 13509
54 Ga0070672_100104186 3300005543 Bacteria 2305
55 Ga0070693_100107366 3300005547 Bacteria 1711
56 Ga0070665_100002349 3300005548 Bacteria 20939
57 Ga0070665_100050194 3300005548 Bacteria 4186
58 Ga0070704_100023038 3300005549 Bacteria 4060
59 Ga0070704_100837162 3300005549 Bacteria 824
60 Ga0070664_100089165 3300005564 Bacteria 2668
61 Ga0070664_100724155 3300005564 Bacteria 928
62 Ga0070664_100880082 3300005564 Bacteria 839
63 Ga0068857_100018749 3300005577 Bacteria 6073
64 Ga0068857_100066783 3300005577 Bacteria 3201
65 Ga0068857_101371772 3300005577 Bacteria 687
66 Ga0068854_100363668 3300005578 Bacteria 1188
67 Ga0068856_100019692 3300005614 Bacteria 6548
68 Ga0068856_100206317 3300005614 Bacteria 1980
69 Ga0068856_100450193 3300005614 Unclassified 1308
70 Ga0070702_100084117 3300005615 Bacteria 1913
71 Ga0070702_100175037 3300005615 Bacteria 1399
72 Ga0068852_100001889 3300005616 Bacteria 14267
73 Ga0068852_100227222 3300005616 Bacteria 1778
74 Ga0068859_100384173 3300005617 Bacteria 1500
75 Ga0068864_100029029 3300005618 Bacteria 4680
76 Ga0068861_100699066 3300005719 Bacteria 942
77 Ga0068870_10203525 3300005840 Bacteria 1202
78 Ga0068863_100119784 3300005841 Bacteria 2509
79 Ga0068858_100080382 3300005842 Bacteria 3029
80 Ga0068860_100096245 3300005843 Bacteria 2822
81 Ga0068860_100314865 3300005843 Bacteria 1535
82 Ga0068860_100505731 3300005843 Bacteria 1207
83 Ga0068862_100499210 3300005844 Bacteria 1155
84 Ga0081539_10176333 3300005985 Bacteria 1006
85 Ga0075362_10195697 3300006177 Unclassified 983
86 Ga0075366_10146536 3300006195 Bacteria 1429
87 Ga0075366_10237043 3300006195 Bacteria 1112
88 Ga0097621_100015421 3300006237 Bacteria 5748
89 Ga0097621_100093595 3300006237 Bacteria 2519
90 Ga0068871_100080676 3300006358 Bacteria 2694
91 Ga0068871_100297661 3300006358 Bacteria 1415
92 Ga0068871_100456797 3300006358 Bacteria 1146
93 Ga0075428_100712522 3300006844 Bacteria 1069
94 Ga0075434_100238443 3300006871 Bacteria 1839
95 Ga0068865_100452361 3300006881 Bacteria 1062
96 Ga0068865_100827216 3300006881 Bacteria 801
97 Ga0097620_100384177 3300006931 Bacteria 1500
98 Ga0075435_100081227 3300007076 Bacteria 2663
99 Ga0111539_10340361 3300009094 Bacteria 1746
100 Ga0114129_10445152 3300009147 Bacteria 1700
101 Ga0105242_10010188 3300009176 Bacteria 7202
102 Ga0105242_11717916 3300009176 Bacteria 664
103 Ga0105248_10032084 3300009177 Bacteria 5870
104 Ga0105248_10549095 3300009177 Bacteria 1303
105 Ga0105246_10285629 3300011119 Bacteria 1326
106 Ga0157326_1028743 3300012513 Bacteria 726
107 Ga0157373_10009248 3300013100 Bacteria 7285
108 Ga0157370_10054181 3300013104 Bacteria 3823
109 Ga0157369_10345761 3300013105 Bacteria 1545
110 Ga0157374_10041214 3300013296 Bacteria 4254
111 Ga0157378_10224977 3300013297 Bacteria 1785
112 Ga0157378_10400842 3300013297 Bacteria 1352
113 Ga0163162_10118847 3300013306 Bacteria 2745
114 Ga0163162_10663743 3300013306 Bacteria 1166
115 Ga0157372_10026105 3300013307 Bacteria 6356
116 Ga0157375_10010449 3300013308 Bacteria 8168
117 Ga0163163_10484166 3300014325 Bacteria 1298
118 Ga0163163_11186942 3300014325 Bacteria 826
119 Ga0157380_10083331 3300014326 Bacteria 2619
120 Ga0157380_10352011 3300014326 Bacteria 1378
121 Ga0157377_10021382 3300014745 Bacteria 3403
122 Ga0157379_10046217 3300014968 Bacteria 3885
123 Ga0157379_10070794 3300014968 Bacteria 3121
124 Ga0157376_10078417 3300014969 Bacteria 2828
125 Ga0157376_10080692 3300014969 Bacteria 2791
126 Ga0163161_10041891 3300017792 Bacteria 3292
127 Ga0163161_10073596 3300017792 Unclassified 2504
128 Ga0207697_10206996 3300025315 Bacteria 864
129 Ga0207656_10052962 3300025321 Bacteria 1759
130 Ga0207656_10305268 3300025321 Unclassified 788
131 Ga0207682_10045600 3300025893 Bacteria 1799
132 Ga0207682_10175187 3300025893 Bacteria 977
133 Ga0207642_10074096 3300025899 Bacteria 1630
134 Ga0207642_10260506 3300025899 Bacteria 988
135 Ga0207688_10084031 3300025901 Bacteria 1822
136 Ga0207645_10092262 3300025907 Bacteria 1948
137 Ga0207643_10085581 3300025908 Bacteria 1831
138 Ga0207705_10060066 3300025909 Bacteria 2745
139 Ga0207705_10411634 3300025909 Bacteria 1046
140 Ga0207707_10028114 3300025912 Bacteria 4916
141 Ga0207660_10692744 3300025917 Bacteria 831
142 Ga0207657_10212863 3300025919 Bacteria 1550
143 Ga0207657_10459427 3300025919 Bacteria 999
144 Ga0207657_10684295 3300025919 Bacteria 797
145 Ga0207649_10013019 3300025920 Bacteria 4637
146 Ga0207649_10155243 3300025920 Bacteria 1580
147 Ga0207649_10279359 3300025920 Bacteria 1213
148 Ga0207652_10047312 3300025921 Bacteria 3674
149 Ga0207650_10023704 3300025925 Bacteria 4357
150 Ga0207650_10034237 3300025925 Bacteria 3683
151 Ga0207644_10004889 3300025931 Bacteria 8731
152 Ga0207644_10009891 3300025931 Bacteria 6274
153 Ga0207706_10317491 3300025933 Bacteria 1356
154 Ga0207686_10012855 3300025934 Bacteria 4614
155 Ga0207669_10040321 3300025937 Bacteria 2708
156 Ga0207669_10252391 3300025937 Bacteria 1314
157 Ga0207704_10055713 3300025938 Bacteria 2418
158 Ga0207704_10116527 3300025938 Bacteria 1818
159 Ga0207704_10421564 3300025938 Bacteria 1058
160 Ga0207691_10001095 3300025940 Bacteria 26926
161 Ga0207691_10023823 3300025940 Bacteria 5762
162 Ga0207691_10074294 3300025940 Bacteria 3066
163 Ga0207691_10113737 3300025940 Bacteria 2405
164 Ga0207711_10017838 3300025941 Bacteria 5897
165 Ga0207689_10384350 3300025942 Bacteria 1169
166 Ga0207689_10875561 3300025942 Bacteria 758
167 Ga0207661_10052769 3300025944 Bacteria 3250
168 Ga0207679_10065197 3300025945 Bacteria 2725
169 Ga0207651_10002747 3300025960 Bacteria 8455
170 Ga0207651_10028834 3300025960 Bacteria 3508
171 Ga0207712_10167716 3300025961 Bacteria 1713
172 Ga0207668_10028954 3300025972 Bacteria 3627
173 Ga0207668_10179542 3300025972 Bacteria 1668
174 Ga0207668_10223997 3300025972 Bacteria 1512
175 Ga0207640_10048694 3300025981 Bacteria 2741
176 Ga0207658_10010655 3300025986 Bacteria 6249
177 Ga0207658_10136590 3300025986 Bacteria 1978
178 Ga0207658_10177903 3300025986 Bacteria 1758
179 Ga0207677_10013037 3300026023 Bacteria 4802
180 Ga0207677_10053604 3300026023 Bacteria 2746
181 Ga0207639_10107181 3300026041 Bacteria 2269
182 Ga0207639_10600897 3300026041 Bacteria 1014
183 Ga0207678_10149641 3300026067 Bacteria 1993
184 Ga0207678_10472351 3300026067 Bacteria 1092
185 Ga0207708_10546080 3300026075 Bacteria 977
186 Ga0207702_10015081 3300026078 Bacteria 6407
187 Ga0207702_10372879 3300026078 Bacteria 1371
188 Ga0207641_10708723 3300026088 Bacteria 991
189 Ga0207648_10007358 3300026089 Bacteria 10839
190 Ga0207648_10199974 3300026089 Bacteria 1772
191 Ga0207648_10218602 3300026089 Bacteria 1693
192 Ga0207648_10369920 3300026089 Bacteria 1294
193 Ga0207676_10030395 3300026095 Bacteria 4055
194 Ga0207674_10023879 3300026116 Bacteria 6540
195 Ga0207674_11212901 3300026116 Bacteria 724
196 Ga0207675_100015484 3300026118 Bacteria 7112
197 Ga0207683_10000746 3300026121 Bacteria 29503
198 Ga0207683_10031304 3300026121 Bacteria 4617
199 Ga0207698_10023421 3300026142 Bacteria 4313
200 Ga0207698_10249953 3300026142 Bacteria 1622
201 Ga0209969_1008445 3300027360 Bacteria 1461
202 Ga0209967_1001042 3300027364 Bacteria 3544
203 Ga0209981_1013057 3300027378 Bacteria 1154
204 Ga0209984_1004282 3300027424 Bacteria 1675
205 Ga0210000_1002891 3300027462 Bacteria 2451
206 Ga0209995_1023619 3300027471 Bacteria 1023
207 Ga0209999_1006377 3300027543 Bacteria 2121
208 Ga0209982_1011559 3300027552 Bacteria 1320
209 Ga0209971_1033097 3300027682 Bacteria 1242
210 Ga0209974_10007359 3300027876 Bacteria 3792
211 Ga0209974_10018072 3300027876 Bacteria 2338
212 Ga0268266_10145809 3300028379 Bacteria 2128
213 Ga0268266_10215684 3300028379 Bacteria 1762
214 Ga0268265_10340102 3300028380 Bacteria 1366
215 Ga0268264_10044006 3300028381 Bacteria 3702
216 Ga0268264_10046325 3300028381 Bacteria 3612
217 Ga0268264_10236958 3300028381 Bacteria 1688
218 Ga0265324_10000471 3300029957 Bacteria 28353
219 Ga0265324_10003800 3300029957 Bacteria 7054
220 Ga0265328_10002997 3300031239 Bacteria 7535
221 Ga0265328_10043315 3300031239 Bacteria 1656
222 Ga0265328_10189402 3300031239 Bacteria 779
223 Ga0265325_10022691 3300031241 Bacteria 3434
224 Ga0265325_10025901 3300031241 Bacteria 3181
225 Ga0265331_10000024 3300031250 Bacteria 235118
226 Ga0265331_10013903 3300031250 Bacteria 4305
227 Ga0265327_10000079 3300031251 Bacteria 206892
228 Ga0265327_10000103 3300031251 Bacteria 185405
229 Ga0265327_10001782 3300031251 Bacteria 25376
230 Ga0265327_10002731 3300031251 Bacteria 17995
231 Ga0265327_10004908 3300031251 Bacteria 11544
232 Ga0265316_10036915 3300031344 Bacteria 3950
233 Ga0307509_10000009 3300031507 Bacteria 350890
234 Ga0307408_100072598 3300031548 Bacteria 2548
235 Ga0307408_100129476 3300031548 Bacteria 1967
236 Ga0307408_101303433 3300031548 Bacteria 681
237 Ga0265314_10001405 3300031711 Bacteria 26998
238 Ga0265314_10067207 3300031711 Bacteria 2415
239 Ga0307405_10021014 3300031731 Bacteria 3661
240 Ga0307405_10024890 3300031731 Bacteria 3428
241 Ga0307405_10749436 3300031731 Bacteria 813
242 Ga0307413_10001357 3300031824 Bacteria 9171
243 Ga0307410_10021282 3300031852 Bacteria 3985
244 Ga0307410_10294608 3300031852 Bacteria 1278
245 Ga0307410_11583556 3300031852 Bacteria 579
246 Ga0307406_10011837 3300031901 Bacteria 4957
247 Ga0307412_10005858 3300031911 Bacteria 6918
248 Ga0307412_10223015 3300031911 Bacteria 1446
249 Ga0307409_100023649 3300031995 Bacteria 4264
250 Ga0307416_100000562 3300032002 Bacteria 18936
251 Ga0307416_100818717 3300032002 Bacteria 1028
252 Ga0307416_101343731 3300032002 Bacteria 820
253 Ga0307414_10008973 3300032004 Bacteria 5716
254 Ga0307411_10015067 3300032005 Bacteria 4327
255 Ga0307415_100045009 3300032126 Bacteria 2956
256 Ga0307415_100582994 3300032126 Bacteria 992
257 Ga0373929_0073445 3300035085 Bacteria 822
258 Ga0373923_0191427 3300035111 Bacteria 943
259 Ga0373955_0079419 3300035172 Bacteria 1851
260 Ga0373924_0001885 3300035410 Bacteria 6953
261 Ga0373935_0490680 3300035692 Bacteria 891
262 Ga0373935_0732278 3300035692 Bacteria 728
263 Ga0373933_0071284 3300035724 Bacteria 2115
264 Ga0373933_0195238 3300035724 Bacteria 1294
265 Ga0373937_0033799 3300036401 Bacteria 4648
266 Ga0373937_0177526 3300036401 Bacteria 1999
267 Ga0373937_0214558 3300036401 Bacteria 1811
268 Ga0316584_0095304 3300036712 Bacteria 2228
269 Ga0451807_0112031 3300041486 Bacteria 2152
270 Ga0451849_0148120 3300041505 Bacteria 741
271 Ga0450889_021956 3300042144 Bacteria 713
272 Ga0439435_0008672 3300042436 Bacteria 2363
273 Ga0439435_0069375 3300042436 Bacteria 1041
274 Ga0451577_0024403 3300042876 Bacteria 5501
275 Ga0451577_0633212 3300042876 Bacteria 970
276 Ga0451577_0874031 3300042876 Bacteria 810
277 Ga0453684_0168324 3300044712 Bacteria 2585
278 Ga0451576_0008394 3300045051 Bacteria 12128
279 Ga0451576_0096516 3300045051 Bacteria 3075
280 Ga0495621_0222269 3300046539 Bacteria 765
281 Ga0495645_0388306 3300046543 Bacteria 892
282 Ga0495658_0260024 3300046683 Bacteria 1093
283 Ga0496100_0450057 3300048903 Unclassified 987
284 Ga0496100_0496837 3300048903 Bacteria 940
285 Ga0496106_0140977 3300048909 Bacteria 1896
286 Ga0496106_0384791 3300048909 Bacteria 1127
287 Ga0496108_0019852 3300048911 Bacteria 5520
288 Ga0496108_0804139 3300048911 Bacteria 811
289 Ga0496109_0744385 3300048912 Bacteria 918
290 Ga0496110_0024966 3300048913 Bacteria 5101
291 Ga0496110_0628976 3300048913 Bacteria 972
292 Ga0496111_0020869 3300048914 Bacteria 4567
293 Ga0496113_0902740 3300048916 Bacteria 699
294 Ga0496114_0046545 3300048917 Bacteria 3605
295 Ga0496114_0611887 3300048917 Bacteria 960
296 Ga0501033_0127703 3300049570 Bacteria 1843
297 Ga0501034_0090042 3300049571 Bacteria 3066
298 Ga0501034_0275310 3300049571 Bacteria 1623
299 Ga0501036_0146299 3300049572 Bacteria 1993
300 Ga0501036_0457065 3300049572 Bacteria 1064
301 Ga0501038_0071966 3300049574 Bacteria 2931
302 Ga0501039_0008287 3300049575 Bacteria 7921
303 Ga0501039_0336189 3300049575 Bacteria 1187
304 Ga0501040_0005948 3300049576 Bacteria 7893
305 Ga0501040_0015557 3300049576 Bacteria 5027
306 Ga0501040_0081325 3300049576 Bacteria 2245
307 Ga0501041_0000876 3300049577 Bacteria 16249
308 Ga0501042_0016892 3300049578 Bacteria 5021
309 Ga0501042_0261406 3300049578 Unclassified 1249
310 Ga0501043_0044350 3300049579 Bacteria 3497
311 Ga0501047_1086930 3300049581 Bacteria 613
312 Ga0501067_0031735 3300049583 Bacteria 2931
313 Ga0501068_0017057 3300049584 Bacteria 4197
314 Ga0501070_0015401 3300049586 Bacteria 6432
315 Ga0501071_0038917 3300049587 Bacteria 3400
316 Ga0501072_0006062 3300049588 Bacteria 9228
317 Ga0501072_0052126 3300049588 Bacteria 3221
318 Ga0501073_0004305 3300049589 Bacteria 10678
319 Ga0501074_0031656 3300049590 Bacteria 3832
320 Ga0501075_0009622 3300049591 Bacteria 6767
321 Ga0501076_0002228 3300049592 Bacteria 13285
322 Ga0501076_0287900 3300049592 Bacteria 1346
323 Ga0501079_0002048 3300049741 Bacteria 14439
324 Ga0501079_0196219 3300049741 Bacteria 1576
325 Ga0501080_0018321 3300049742 Bacteria 6480
326 Ga0501080_0063306 3300049742 Bacteria 3443
327 Ga0501080_0549160 3300049742 Bacteria 1029
328 Ga0501081_0001109 3300049743 Bacteria 16174
329 Ga0501083_0037283 3300049744 Bacteria 3312
330 Ga0501083_0037655 3300049744 Bacteria 3293
331 Ga0501035_1026770 3300049822 Bacteria 647
332 Ga0501044_0335839 3300049823 Bacteria 1433
333 Ga0501045_0031531 3300049824 Bacteria 3839
334 nmdc:mga05p37_526866_c1 3300050507 Bacteria 1350
335 nmdc:mga08y16_451276_c1 3300050511 Bacteria 1311
336 nmdc:mga0n895_877889_c1 3300050512 Bacteria 883
337 nmdc:mga0rr50_165373_c1 3300050513 Bacteria 1798
338 Ga0500636_0005880 3300053177 Bacteria 7030
339 Ga0500637_0043186 3300053178 Bacteria 2550
340 Ga0500625_087807 3300053729 Bacteria 1339
341 Ga0501084_0013654 3300054114 Bacteria 6722
342 Ga0501084_0253720 3300054114 Bacteria 1485
343 Ga0590075_024841 3300059424 Bacteria 1505
344 Ga0501082_0001892 3300060353 Bacteria 18404
345 Ga0501082_0038004 3300060353 Bacteria 4152
346 Ga0501082_0554442 3300060353 Bacteria 1005
347 Ga0501082_1214560 3300060353 Bacteria 659
348 Ga0105249_10394403
349 Ga0070658_10062663
350 Ga0070683_100141001
351 Ga0070683_100498450
352 Ga0070670_100024540
353 Ga0070677_10042605
354 Ga0070680_100182053
355 Ga0070680_100189996
356 Ga0068868_100011122
357 Ga0068868_100146651
358 Ga0070660_100474930
359 Ga0070689_100556304
360 Ga0070661_100112104
361 Ga0070661_100401393
362 Ga0070668_100084002
363 Ga0070668_100258693
364 Ga0070669_100089295
365 Ga0070675_100011661
366 Ga0070671_100002688
367 Ga0070671_100006008
368 Ga0070671_100067739
369 Ga0070671_100201157
370 Ga0070671_100217813
371 Ga0070674_100023647
372 Ga0070673_100022157
373 Ga0070688_100395176
374 Ga0070667_100046709
375 Ga0070667_100168383
376 Ga0070667_100607087
377 Ga0070709_10108887
378 Ga0070714_100578468
379 Ga0070711_100760011
380 Ga0070705_100099698
381 Ga0070694_100660438
382 Ga0070708_100211934
383 Ga0070663_100202608
384 Ga0070678_100037134
385 Ga0070678_100232106
386 Ga0070678_100533551
387 Ga0070678_100579865
388 Ga0070681_10004785
389 Ga0068867_100020734
390 Ga0068867_100098643
391 Ga0068867_100125356
392 Ga0070685_10634997
393 Ga0070706_100451594
394 Ga0070707_100753701
395 Ga0070699_100141648
396 Ga0070679_100015755
397 Ga0070684_100133989
398 Ga0068853_100003272
399 Ga0068853_100820141
400 Ga0070672_100001767
401 Ga0070672_100104186
402 Ga0070693_100107366
403 Ga0070665_100002349
404 Ga0070665_100050194
405 Ga0070704_100023038
406 Ga0070704_100837162
407 Ga0070664_100089165
408 Ga0070664_100724155
409 Ga0070664_100880082
410 Ga0068857_100018749
411 Ga0068857_100066783
412 Ga0068857_101371772
413 Ga0068854_100363668
414 Ga0068856_100019692
415 Ga0068856_100206317
416 Ga0068856_100450193
417 Ga0070702_100084117
418 Ga0070702_100175037
419 Ga0068852_100001889
420 Ga0068852_100227222
421 Ga0068859_100384173
422 Ga0068864_100029029
423 Ga0068861_100699066
424 Ga0068870_10203525
425 Ga0068863_100119784
426 Ga0068858_100080382
427 Ga0068860_100096245
428 Ga0068860_100314865
429 Ga0068860_100505731
430 Ga0068862_100499210
431 Ga0081539_10176333
432 Ga0075362_10195697
433 Ga0075366_10146536
434 Ga0075366_10237043
435 Ga0097621_100015421
436 Ga0097621_100093595
437 Ga0068871_100080676
438 Ga0068871_100297661
439 Ga0068871_100456797
440 Ga0075428_100712522
441 Ga0075434_100238443
442 Ga0068865_100452361
443 Ga0068865_100827216
444 Ga0097620_100384177
445 Ga0075435_100081227
446 Ga0111539_10340361
447 Ga0114129_10445152
448 Ga0105242_10010188
449 Ga0105242_11717916
450 Ga0105248_10032084
451 Ga0105248_10549095
452 Ga0105246_10285629
453 Ga0157326_1028743
454 Ga0157373_10009248
455 Ga0157370_10054181
456 Ga0157369_10345761
457 Ga0157374_10041214
458 Ga0157378_10224977
459 Ga0157378_10400842
460 Ga0163162_10118847
461 Ga0163162_10663743
462 Ga0157372_10026105
463 Ga0157375_10010449
464 Ga0163163_10484166
465 Ga0163163_11186942
466 Ga0157380_10083331
467 Ga0157380_10352011
468 Ga0157377_10021382
469 Ga0157379_10046217
470 Ga0157379_10070794
471 Ga0157376_10078417
472 Ga0157376_10080692
473 Ga0163161_10041891
474 Ga0163161_10073596
475 Ga0207697_10206996
476 Ga0207656_10052962
477 Ga0207656_10305268
478 Ga0207682_10045600
479 Ga0207682_10175187
480 Ga0207642_10074096
481 Ga0207642_10260506
482 Ga0207688_10084031
483 Ga0207645_10092262
484 Ga0207643_10085581
485 Ga0207705_10060066
486 Ga0207705_10411634
487 Ga0207707_10028114
488 Ga0207660_10692744
489 Ga0207657_10212863
490 Ga0207657_10459427
491 Ga0207657_10684295
492 Ga0207649_10013019
493 Ga0207649_10155243
494 Ga0207649_10279359
495 Ga0207652_10047312
496 Ga0207650_10023704
497 Ga0207650_10034237
498 Ga0207644_10004889
499 Ga0207644_10009891
500 Ga0207706_10317491
501 Ga0207686_10012855
502 Ga0207669_10040321
503 Ga0207669_10252391
504 Ga0207704_10055713
505 Ga0207704_10116527
506 Ga0207704_10421564
507 Ga0207691_10001095
508 Ga0207691_10023823
509 Ga0207691_10074294
510 Ga0207691_10113737
511 Ga0207711_10017838
512 Ga0207689_10384350
513 Ga0207689_10875561
514 Ga0207661_10052769
515 Ga0207679_10065197
516 Ga0207651_10002747
517 Ga0207651_10028834
518 Ga0207712_10167716
519 Ga0207668_10028954
520 Ga0207668_10179542
521 Ga0207668_10223997
522 Ga0207640_10048694
523 Ga0207658_10010655
524 Ga0207658_10136590
525 Ga0207658_10177903
526 Ga0207677_10013037
527 Ga0207677_10053604
528 Ga0207639_10107181
529 Ga0207639_10600897
530 Ga0207678_10149641
531 Ga0207678_10472351
532 Ga0207708_10546080
533 Ga0207702_10015081
534 Ga0207702_10372879
535 Ga0207641_10708723
536 Ga0207648_10007358
537 Ga0207648_10199974
538 Ga0207648_10218602
539 Ga0207648_10369920
540 Ga0207676_10030395
541 Ga0207674_10023879
542 Ga0207674_11212901
543 Ga0207675_100015484
544 Ga0207683_10000746
545 Ga0207683_10031304
546 Ga0207698_10023421
547 Ga0207698_10249953
548 Ga0209969_1008445
549 Ga0209967_1001042
550 Ga0209981_1013057
551 Ga0209984_1004282
552 Ga0210000_1002891
553 Ga0209995_1023619
554 Ga0209999_1006377
555 Ga0209982_1011559
556 Ga0209971_1033097
557 Ga0209974_10007359
558 Ga0209974_10018072
559 Ga0268266_10145809
560 Ga0268266_10215684
561 Ga0268265_10340102
562 Ga0268264_10044006
563 Ga0268264_10046325
564 Ga0268264_10236958
565 Ga0265324_10000471
566 Ga0265324_10003800
567 Ga0265328_10002997
568 Ga0265328_10043315
569 Ga0265328_10189402
570 Ga0265325_10022691
571 Ga0265325_10025901
572 Ga0265331_10000024
573 Ga0265331_10013903
574 Ga0265327_10000079
575 Ga0265327_10000103
576 Ga0265327_10001782
577 Ga0265327_10002731
578 Ga0265327_10004908
579 Ga0265316_10036915
580 Ga0307509_10000009
581 Ga0307408_100072598
582 Ga0307408_100129476
583 Ga0307408_101303433
584 Ga0265314_10001405
585 Ga0265314_10067207
586 Ga0307405_10021014
587 Ga0307405_10024890
588 Ga0307405_10749436
589 Ga0307413_10001357
590 Ga0307410_10021282
591 Ga0307410_10294608
592 Ga0307410_11583556
593 Ga0307406_10011837
594 Ga0307412_10005858
595 Ga0307412_10223015
596 Ga0307409_100023649
597 Ga0307416_100000562
598 Ga0307416_100818717
599 Ga0307416_101343731
600 Ga0307414_10008973
601 Ga0307411_10015067
602 Ga0307415_100045009
603 Ga0307415_100582994
604 Ga0373929_0073445
605 Ga0373923_0191427
606 Ga0373955_0079419
607 Ga0373924_0001885
608 Ga0373935_0490680
609 Ga0373935_0732278
610 Ga0373933_0071284
611 Ga0373933_0195238
612 Ga0373937_0033799
613 Ga0373937_0177526
614 Ga0373937_0214558
615 Ga0316584_0095304
616 Ga0451807_0112031
617 Ga0451849_0148120
618 Ga0450889_021956
619 Ga0439435_0008672
620 Ga0439435_0069375
621 Ga0451577_0024403
622 Ga0451577_0633212
623 Ga0451577_0874031
624 Ga0453684_0168324
625 Ga0451576_0008394
626 Ga0451576_0096516
627 Ga0495621_0222269
628 Ga0495645_0388306
629 Ga0495658_0260024
630 Ga0496100_0450057
631 Ga0496100_0496837
632 Ga0496106_0140977
633 Ga0496106_0384791
634 Ga0496108_0019852
635 Ga0496108_0804139
636 Ga0496109_0744385
637 Ga0496110_0024966
638 Ga0496110_0628976
639 Ga0496111_0020869
640 Ga0496113_0902740
641 Ga0496114_0046545
642 Ga0496114_0611887
643 Ga0501033_0127703
644 Ga0501034_0090042
645 Ga0501034_0275310
646 Ga0501036_0146299
647 Ga0501036_0457065
648 Ga0501038_0071966
649 Ga0501039_0008287
650 Ga0501039_0336189
651 Ga0501040_0005948
652 Ga0501040_0015557
653 Ga0501040_0081325
654 Ga0501041_0000876
655 Ga0501042_0016892
656 Ga0501042_0261406
657 Ga0501043_0044350
658 Ga0501047_1086930
659 Ga0501067_0031735
660 Ga0501068_0017057
661 Ga0501070_0015401
662 Ga0501071_0038917
663 Ga0501072_0006062
664 Ga0501072_0052126
665 Ga0501073_0004305
666 Ga0501074_0031656
667 Ga0501075_0009622
668 Ga0501076_0002228
669 Ga0501076_0287900
670 Ga0501079_0002048
671 Ga0501079_0196219
672 Ga0501080_0018321
673 Ga0501080_0063306
674 Ga0501080_0549160
675 Ga0501081_0001109
676 Ga0501083_0037283
677 Ga0501083_0037655
678 Ga0501035_1026770
679 Ga0501044_0335839
680 Ga0501045_0031531
681 nmdc:mga05p37_526866_c1
682 nmdc:mga08y16_451276_c1
683 nmdc:mga0n895_877889_c1
684 nmdc:mga0rr50_165373_c1
685 Ga0500636_0005880
686 Ga0500637_0043186
687 Ga0500625_087807
688 Ga0501084_0013654
689 Ga0501084_0253720
690 Ga0590075_024841
691 Ga0501082_0001892
692 Ga0501082_0038004
693 Ga0501082_0554442
694 Ga0501082_1214560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

109

167

0.91

PF13242

Hydrolase_like

HAD-hyrolase-like

121

194

0.88

PF08645

PNK3P

Polynucleotide kinase 3 phosphatase

25

160

0.81

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

12

161

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9917 1 175
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.9751 1 175
4pnh-assembly1.cif.gz_A crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis 0.932 1 175
4pnh-assembly1.cif.gz_A crystal structure of d,d-heptose 1,7-bisphosphate phosphatase from burkholderia thailandensis 0.909 1 175
2fpx-assembly1.cif.gz_A crystal structure of the n-terminal domain of e.coli hisb- sulfate complex. 0.8752 2 139
ID Description Score Start End Superfamily
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9897 2 175 3.40.50.1000
3l8hD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9616 2 175 3.40.50.1000
4jyrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.924 1 175 3.40.50.1000
4jyrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9019 1 175 3.40.50.1000
af_P9WMV3_2_164_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8916 2 164 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A455XDV3-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.999 1 175 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A3E1DHW3-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase (EC 3.1.3.-) 0.9988 1 175 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A7J6YR70-F1-model_v4 deleted 0.9983 3 155
AF-A0A3D1J0Y8-F1-model_v4 D,D-heptose 1,7-bisphosphate phosphatase 0.9982 1 162 GO:0005737
GO:0005975
GO:0016791
GO:0046872
AF-A0A4Q3INA0-F1-model_v4 deleted 0.9976 60 175

Map