F416999

General Info

Members Datasets Scaffolds Average Seq Length
347 248 309 520

Family's Representative Sequence

Representative Sequence 3300003773|Ga0055537_1001708|Ga0055537_10017085
Length 570
Sequence MTPVDIAPGLSLSDGKNAEVREEYPMVDINRRGALGSLLTGAAVAAVPAASPQVAGAAQMGTLPAAPAAGEGPTWAKGIEGQRKADLGNGTFLNPILAGDHPDPSILKDGDDYYMTHSSFDAYPGLLIWRSKDLVNWSPVGPALKTNVGSIWAPELCKHKGRYYIYLPAKFPDNNTSYVIWADKIEGPWSEPVDLKLPRYIDPGHVVDEKGVRWLFLSGGDRIQLAPDGLSTVGXPQHVYNPWRXPDDWDVEGFSPEGPKVMKKGDYYYLVTAVGGTAGPPTGHMVIVARAKSLAGPWEDDPRNPVVRTTNNSETWWSRGHATLVEGPGGDWWTVYHGYENGFYTLGRQTLLAPVTWTKDGWFEVGGGDLSKPLAKPRGGKPGPHGMALSDDFSTDKYGVQWSFFDPKPGERDRIKRENGVLTLKGSGEAPSSGAPLIFVNGDQAYEIECEIEIDPDTRAGLILFYDRQLYCGLGFDAKNFVTHQYGIERGRPSNPHGSKMLMRLRNDRHIVAFHTSGDGGKTWKRFDRGMEVSGYHHNVRGGFLMLKPGLYAAGKGSARFRNFKYRALA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
4 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
5 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
8 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
9 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
10 2643221583 Caulobacter sp. Root655 Isolate Unclassified
11 2643221584 Caulobacter sp. Root656 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221640 Caulobacter sp. Root342 Isolate Unclassified
15 2643221642 Caulobacter sp. Root343 Isolate Unclassified
16 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
19 2738541337 Pelomonas sp. BT06 Isolate Unclassified
20 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
21 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
22 2818991435 Caulobacter henricii 536 Isolate Unclassified
23 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
24 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
25 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
26 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
27 2849560528 Caulobacter zeae 410 Isolate Unclassified
28 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
29 2851153111 Caulobacter radicis 736 Isolate Unclassified
30 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
31 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
32 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
33 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
34 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
35 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
36 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
37 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
42 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
46 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
47 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
48 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
160 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
161 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
167 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
180 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
181 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
193 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
201 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
202 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
212 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
222 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
228 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
229 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
230 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
231 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
232 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
233 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
239 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
243 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.05
Metatranscriptomes 0
Isolates 10.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.36
Nodule 0
Rhizoplane 1.44
Rhizosphere 62.25
Stem 0
Stem Tuber 0
Unclassified 10.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000484 3300002774 Bacteria 16815
2 JGI25153J46596_10000147 3300003215 Bacteria 71745
3 rootH1_10014566 3300003323 Bacteria 9021
4 Ga0055538_1001228 3300003751 Bacteria 5325
5 Ga0055527_1000004 3300003760 Bacteria 570634
6 Ga0055542_1000055 3300003762 Bacteria 171477
7 Ga0055529_1000066 3300003763 Bacteria 170902
8 Ga0055537_1001708 3300003773 Bacteria 8119
9 Ga0055537_1009423 3300003773 Bacteria 2157
10 Ga0055536_1001906 3300003781 Bacteria 12089
11 Ga0055536_1002035 3300003781 Bacteria 11584
12 Ga0055530_10002421 3300003791 Bacteria 12077
13 Ga0055530_10003821 3300003791 Bacteria 8271
14 Ga0055530_10011106 3300003791 Bacteria 3263
15 Ga0055540_1001881 3300003792 Bacteria 11781
16 Ga0055531_10001455 3300003794 Bacteria 17445
17 Ga0055531_10003045 3300003794 Bacteria 10862
18 Ga0055531_10005942 3300003794 Bacteria 7017
19 Ga0065165_1000523 3300005262 Bacteria 58644
20 Ga0065165_1000985 3300005262 Bacteria 35299
21 Ga0070690_100044164 3300005330 Bacteria 2828
22 Ga0070670_100077463 3300005331 Bacteria 2857
23 Ga0070680_100003779 3300005336 Bacteria 11318
24 Ga0070660_100003521 3300005339 Bacteria 10794
25 Ga0070687_100025286 3300005343 Bacteria 2847
26 Ga0070661_100000011 3300005344 Bacteria 175355
27 Ga0070714_100001239 3300005435 Bacteria 18409
28 Ga0070714_100156264 3300005435 Unclassified 2059
29 Ga0070713_100000730 3300005436 Bacteria 21143
30 Ga0070711_100068620 3300005439 Bacteria 2492
31 Ga0070678_100000141 3300005456 Bacteria 29532
32 Ga0070678_100014496 3300005456 Bacteria 4976
33 Ga0070681_10005046 3300005458 Bacteria 12729
34 Ga0070679_100000008 3300005530 Bacteria 194672
35 Ga0070679_100000226 3300005530 Bacteria 46282
36 Ga0070684_100001892 3300005535 Bacteria 15344
37 Ga0070684_100003972 3300005535 Bacteria 11206
38 Ga0070672_100010881 3300005543 Bacteria 6326
39 Ga0070672_100022284 3300005543 Bacteria 4650
40 Ga0070665_100000924 3300005548 Bacteria 37601
41 Ga0068855_100067260 3300005563 Bacteria 4175
42 Ga0068855_100206210 3300005563 Bacteria 2211
43 Ga0068857_100131242 3300005577 Bacteria 2260
44 Ga0068856_100073981 3300005614 Unclassified 3373
45 Ga0068852_100006906 3300005616 Bacteria 8255
46 Ga0068858_100000665 3300005842 Bacteria 35973
47 Ga0070717_10040111 3300006028 Bacteria 3813
48 Ga0070712_100003532 3300006175 Bacteria 9625
49 Ga0075366_10034937 3300006195 Bacteria 2963
50 Ga0097621_100069551 3300006237 Bacteria 2907
51 Ga0075370_10013761 3300006353 Bacteria 4305
52 Ga0068865_100109777 3300006881 Bacteria 2033
53 Ga0105240_10054290 3300009093 Bacteria 5022
54 Ga0105240_10323353 3300009093 Bacteria 1757
55 Ga0111539_10000841 3300009094 Bacteria 39945
56 Ga0105243_10002788 3300009148 Bacteria 14516
57 Ga0105243_10079167 3300009148 Bacteria 2678
58 Ga0105238_10011253 3300009551 Bacteria 9005
59 Ga0105238_10016825 3300009551 Bacteria 7415
60 Ga0105246_10099224 3300011119 Bacteria 2117
61 Ga0157370_10013874 3300013104 Bacteria 8274
62 Ga0157370_10111382 3300013104 Bacteria 2559
63 Ga0157374_10064844 3300013296 Bacteria 3429
64 Ga0157372_10004034 3300013307 Bacteria 15745
65 Ga0157372_10230935 3300013307 Unclassified 2145
66 Ga0157375_10025520 3300013308 Bacteria 5493
67 Ga0163163_10094551 3300014325 Bacteria 3007
68 Ga0209784_100140 3300025224 Bacteria 67518
69 Ga0209672_100011 3300025228 Bacteria 856297
70 Ga0209147_100388 3300025229 Bacteria 30382
71 Ga0207425_1000019 3300025245 Bacteria 399942
72 Ga0209026_1000803 3300025250 Bacteria 17062
73 Ga0209148_1000132 3300025254 Bacteria 171529
74 Ga0209129_1001790 3300025258 Bacteria 11454
75 Ga0209565_1000062 3300025263 Bacteria 184007
76 Ga0209565_1000140 3300025263 Bacteria 101561
77 Ga0209455_1000122 3300025272 Bacteria 170954
78 Ga0209673_1015718 3300025273 Bacteria 2861
79 Ga0209676_1000043 3300025292 Bacteria 418680
80 Ga0209676_1000712 3300025292 Bacteria 46015
81 Ga0209025_1000829 3300025294 Bacteria 49175
82 Ga0209564_1000361 3300025295 Bacteria 84398
83 Ga0209564_1005273 3300025295 Bacteria 7454
84 Ga0209758_1000019 3300025297 Bacteria 743682
85 Ga0209758_1000933 3300025297 Bacteria 39569
86 Ga0209758_1001445 3300025297 Bacteria 27970
87 Ga0209758_1002748 3300025297 Bacteria 17250
88 Ga0209050_1000001 3300025298 Bacteria 3563507
89 Ga0209050_1000419 3300025298 Bacteria 78444
90 Ga0209050_1000559 3300025298 Bacteria 60902
91 Ga0209050_1001103 3300025298 Bacteria 32702
92 Ga0209050_1005535 3300025298 Bacteria 7892
93 Ga0209050_1012038 3300025298 Bacteria 4021
94 Ga0209256_1004121 3300025299 Bacteria 9403
95 Ga0209256_1006103 3300025299 Bacteria 6540
96 Ga0209051_1000109 3300025303 Bacteria 153862
97 Ga0209257_1000134 3300025304 Bacteria 207628
98 Ga0209257_1000200 3300025304 Bacteria 147538
99 Ga0209257_1000441 3300025304 Bacteria 78385
100 Ga0209257_1002515 3300025304 Bacteria 18019
101 Ga0209257_1006218 3300025304 Bacteria 7832
102 Ga0207647_10006627 3300025904 Bacteria 8413
103 Ga0207645_10015704 3300025907 Bacteria 5022
104 Ga0207705_10009567 3300025909 Bacteria 7051
105 Ga0207707_10007985 3300025912 Bacteria 9193
106 Ga0207707_10157243 3300025912 Unclassified 1988
107 Ga0207695_10031454 3300025913 Bacteria 5820
108 Ga0207693_10015223 3300025915 Bacteria 6173
109 Ga0207663_10055012 3300025916 Bacteria 2495
110 Ga0207660_10000650 3300025917 Bacteria 23416
111 Ga0207660_10111686 3300025917 Bacteria 2057
112 Ga0207649_10000038 3300025920 Bacteria 129260
113 Ga0207652_10000008 3300025921 Bacteria 286698
114 Ga0207652_10002992 3300025921 Bacteria 14111
115 Ga0207694_10011493 3300025924 Bacteria 6682
116 Ga0207687_10000913 3300025927 Bacteria 20112
117 Ga0207706_10013316 3300025933 Bacteria 7483
118 Ga0207709_10000005 3300025935 Bacteria 806813
119 Ga0207669_10000193 3300025937 Bacteria 27676
120 Ga0207691_10078408 3300025940 Bacteria 2974
121 Ga0207661_10049628 3300025944 Bacteria 3341
122 Ga0207661_10075468 3300025944 Bacteria 2766
123 Ga0207667_10000188 3300025949 Bacteria 90598
124 Ga0207667_10086303 3300025949 Bacteria 3248
125 Ga0207667_10118591 3300025949 Bacteria 2727
126 Ga0207651_10098074 3300025960 Bacteria 2166
127 Ga0207703_10001101 3300026035 Bacteria 25659
128 Ga0207702_10040802 3300026078 Bacteria 3891
129 Ga0207674_10051770 3300026116 Bacteria 4190
130 Ga0207683_10003310 3300026121 Bacteria 14047
131 Ga0207683_10022219 3300026121 Bacteria 5444
132 Ga0207698_10050438 3300026142 Unclassified 3175
133 Ga0265318_10004576 3300028577 Bacteria 6679
134 Ga0265323_10030495 3300028653 Bacteria 2008
135 Ga0265336_10010470 3300028666 Bacteria 3175
136 Ga0307517_10024598 3300028786 Bacteria 7408
137 Ga0307517_10061480 3300028786 Bacteria 3552
138 Ga0307515_10027823 3300028794 Bacteria 9640
139 Ga0307515_10035459 3300028794 Bacteria 8115
140 Ga0307515_10081872 3300028794 Bacteria 4185
141 Ga0307515_10085798 3300028794 Bacteria 4023
142 Ga0307515_10186262 3300028794 Bacteria 2004
143 Ga0265338_10004331 3300028800 Bacteria 19251
144 Ga0265338_10063018 3300028800 Bacteria 3236
145 Ga0265330_10002685 3300031235 Bacteria 9610
146 Ga0265328_10005764 3300031239 Bacteria 5286
147 Ga0265320_10054396 3300031240 Bacteria 1931
148 Ga0265325_10000249 3300031241 Bacteria 38332
149 Ga0265340_10000990 3300031247 Bacteria 16230
150 Ga0265339_10003722 3300031249 Bacteria 10637
151 Ga0265339_10013910 3300031249 Bacteria 4868
152 Ga0265316_10001520 3300031344 Bacteria 24843
153 Ga0265316_10002993 3300031344 Bacteria 17278
154 Ga0307408_100000010 3300031548 Bacteria 420048
155 Ga0265313_10002347 3300031595 Bacteria 16523
156 Ga0265313_10011987 3300031595 Bacteria 5343
157 Ga0307508_10034897 3300031616 Bacteria 4533
158 Ga0265314_10000239 3300031711 Bacteria 80839
159 Ga0265314_10023320 3300031711 Unclassified 4720
160 Ga0265342_10001442 3300031712 Bacteria 22142
161 Ga0307414_10003601 3300032004 Bacteria 8289
162 Ga0307411_10005330 3300032005 Bacteria 6299
163 Ga0373951_0006505 3300035091 Bacteria 2672
164 Ga0373939_0000039 3300035114 Bacteria 45915
165 Ga0373960_0001057 3300035121 Bacteria 5942
166 Ga0373931_0000109 3300035691 Bacteria 37373
167 Ga0373937_0026444 3300036401 Bacteria 5245
168 Ga0395899_0084903 3300037312 Bacteria 2301
169 Ga0395905_0000097 3300037471 Bacteria 145600
170 Ga0439436_0025610 3300041404 Bacteria 1732
171 Ga0451841_1250680 3300041498 Bacteria 2039
172 Ga0439449_0000567 3300042007 Bacteria 13842
173 Ga0439449_0013918 3300042007 Bacteria 3026
174 Ga0439462_0000343 3300042015 Bacteria 8780
175 Ga0450888_001177 3300042126 Bacteria 2497
176 Ga0450892_000284 3300042130 Bacteria 5995
177 Ga0466969_0000943 3300044656 Bacteria 15670
178 Ga0466966_0001737 3300044684 Bacteria 14099
179 Ga0466963_0056104 3300044694 Bacteria 2621
180 Ga0466971_0003439 3300044719 Bacteria 6771
181 Ga0466957_0082255 3300044842 Unclassified 2007
182 Ga0495627_000209 3300046453 Bacteria 63424
183 Ga0495629_0089429 3300046459 Bacteria 2148
184 Ga0495638_0000305 3300046460 Bacteria 63286
185 Ga0495638_0000440 3300046460 Bacteria 50160
186 Ga0495638_0002775 3300046460 Bacteria 14072
187 Ga0495638_0004738 3300046460 Bacteria 10265
188 Ga0495650_0000068 3300046471 Bacteria 266671
189 Ga0495650_0000083 3300046471 Bacteria 237725
190 Ga0495584_0030928 3300046491 Bacteria 2710
191 Ga0495585_0000526 3300046492 Bacteria 36147
192 Ga0495596_0000006 3300046500 Bacteria 161501
193 Ga0495583_0000002 3300046506 Bacteria 782521
194 Ga0495583_0000351 3300046506 Bacteria 72601
195 Ga0495583_0000710 3300046506 Bacteria 42765
196 Ga0495606_0000029 3300046507 Bacteria 250473
197 Ga0495606_0031246 3300046507 Bacteria 3705
198 Ga0495606_0038872 3300046507 Bacteria 3214
199 Ga0495610_0000019 3300046512 Bacteria 351524
200 Ga0495610_0000157 3300046512 Bacteria 75701
201 Ga0495610_0000189 3300046512 Bacteria 69205
202 Ga0495616_0000327 3300046513 Bacteria 37930
203 Ga0495628_0072158 3300046516 Unclassified 2691
204 Ga0495631_0001382 3300046518 Bacteria 14767
205 Ga0495632_0002377 3300046519 Bacteria 14391
206 Ga0495632_0002845 3300046519 Bacteria 12790
207 Ga0495637_0003061 3300046520 Bacteria 8935
208 Ga0495637_0033063 3300046520 Bacteria 2274
209 Ga0495643_0000004 3300046522 Bacteria 519944
210 Ga0495643_0000163 3300046522 Bacteria 106228
211 Ga0495643_0001656 3300046522 Bacteria 19540
212 Ga0495643_0042154 3300046522 Bacteria 2487
213 Ga0495643_0043572 3300046522 Bacteria 2441
214 Ga0495648_0000235 3300046524 Bacteria 63436
215 Ga0495648_0003668 3300046524 Bacteria 13424
216 Ga0495654_0000042 3300046530 Bacteria 164346
217 Ga0495587_0111872 3300046536 Unclassified 1568
218 Ga0495609_0003611 3300046538 Bacteria 8786
219 Ga0495633_0000379 3300046558 Bacteria 47064
220 Ga0495633_0022799 3300046558 Bacteria 3109
221 Ga0495668_0000016 3300046616 Bacteria 438197
222 Ga0495668_0000587 3300046616 Bacteria 44244
223 Ga0495668_0031796 3300046616 Bacteria 2973
224 Ga0495668_0036782 3300046616 Bacteria 2742
225 Ga0495668_0045736 3300046616 Bacteria 2433
226 Ga0495625_0000150 3300046660 Bacteria 106314
227 Ga0495625_0000170 3300046660 Bacteria 102224
228 Ga0495625_0002138 3300046660 Bacteria 22004
229 Ga0495625_0002862 3300046660 Bacteria 18106
230 Ga0495625_0007703 3300046660 Bacteria 9319
231 Ga0495625_0020892 3300046660 Bacteria 5047
232 Ga0495625_0069911 3300046660 Bacteria 2466
233 Ga0495625_0076239 3300046660 Bacteria 2344
234 Ga0495661_0065209 3300046665 Bacteria 2146
235 Ga0495669_0000104 3300046684 Bacteria 53714
236 Ga0495671_0000020 3300046692 Bacteria 268306
237 Ga0495649_0000092 3300046694 Bacteria 77734
238 Ga0495649_0054220 3300046694 Bacteria 2168
239 Ga0495600_0000260 3300046809 Bacteria 28816
240 Ga0495674_0172200 3300047319 Unclassified 1806
241 Ga0495683_0000659 3300047323 Bacteria 25543
242 Ga0495687_000098 3300047443 Bacteria 132403
243 Ga0495677_0000882 3300047445 Bacteria 12115
244 Ga0495673_0000108 3300047469 Bacteria 168459
245 Ga0495673_0000316 3300047469 Bacteria 62814
246 Ga0495673_0002168 3300047469 Bacteria 14263
247 Ga0495673_0017813 3300047469 Bacteria 3595
248 Ga0495681_0011023 3300047470 Bacteria 5420
249 Ga0495686_0012549 3300047472 Bacteria 5923
250 Ga0495615_0000125 3300048090 Bacteria 19309
251 Ga0496107_0000042 3300048910 Bacteria 75015
252 Ga0496108_0035658 3300048911 Bacteria 4136
253 Ga0496111_0064875 3300048914 Bacteria 2650
254 Ga0496114_0079167 3300048917 Bacteria 2773
255 Ga0496115_0013437 3300048918 Bacteria 6196
256 Ga0496121_0014309 3300048924 Bacteria 8435
257 Ga0496122_0006579 3300048925 Bacteria 13270
258 Ga0496123_0016324 3300048926 Bacteria 6039
259 Ga0496126_0000817 3300048929 Bacteria 55573
260 Ga0496126_0059685 3300048929 Bacteria 3434
261 Ga0495678_003373 3300049459 Bacteria 9939
262 Ga0501032_0099000 3300049569 Eukaryota 1932
263 Ga0501034_0000596 3300049571 Bacteria 57052
264 Ga0501034_0001598 3300049571 Bacteria 29494
265 Ga0501036_0089688 3300049572 Unclassified 2598
266 Ga0501038_0002797 3300049574 Bacteria 16239
267 Ga0501047_0105063 3300049581 Unclassified 2705
268 Ga0501047_0105730 3300049581 Bacteria 2695
269 Ga0501067_0067725 3300049583 Bacteria 1977
270 Ga0501070_0001082 3300049586 Bacteria 24440
271 Ga0501070_0011747 3300049586 Bacteria 7397
272 Ga0501073_0000040 3300049589 Bacteria 81681
273 Ga0501258_000244 3300049687 Bacteria 3321
274 Ga0501221_000654 3300049704 Bacteria 5570
275 nmdc:mga0k408_23827_c2 3300050493 Bacteria 2838
276 nmdc:mga07m45_6903_c1 3300050496 Bacteria 5775
277 nmdc:mga08y16_4336_c1 3300050511 Bacteria 14820
278 nmdc:mga0sz30_3637_c1 3300050516 Bacteria 4897
279 Ga0500610_0000184 3300053079 Bacteria 18769
280 Ga0500578_0000692 3300053086 Bacteria 40321
281 Ga0500643_000485 3300053087 Bacteria 28889
282 Ga0500643_016603 3300053087 Bacteria 2489
283 Ga0500643_023665 3300053087 Bacteria 1960
284 Ga0500644_0000738 3300053088 Bacteria 11431
285 Ga0500583_0032202 3300053092 Bacteria 2311
286 Ga0500641_0004518 3300053096 Bacteria 4917
287 Ga0500641_0006062 3300053096 Bacteria 4282
288 Ga0500554_005720 3300053102 Bacteria 2736
289 Ga0500556_0000055 3300053104 Bacteria 115798
290 Ga0500556_0001960 3300053104 Bacteria 7268
291 Ga0500594_0008083 3300053118 Bacteria 2391
292 Ga0500595_000595 3300053119 Bacteria 21519
293 Ga0500608_000079 3300053122 Bacteria 41088
294 Ga0500614_003230 3300053123 Bacteria 3530
295 Ga0500618_000059 3300053125 Bacteria 97360
296 Ga0500642_0000008 3300053130 Bacteria 293258
297 Ga0500642_0000507 3300053130 Bacteria 11899
298 Ga0500559_0000412 3300053136 Bacteria 30720
299 Ga0500559_0015938 3300053136 Bacteria 3173
300 Ga0500564_002850 3300053138 Bacteria 6521
301 Ga0500577_0001227 3300053142 Bacteria 6560
302 Ga0500622_0003775 3300053156 Bacteria 9887
303 Ga0500622_0006445 3300053156 Bacteria 6801
304 Ga0500622_0019893 3300053156 Bacteria 3564
305 Ga0500627_0002844 3300053158 Bacteria 5224
306 Ga0500636_0006105 3300053177 Bacteria 6914
307 Ga0500645_000002 3300053730 Bacteria 388892
308 Ga0500645_000682 3300053730 Bacteria 21220
309 Ga0500645_013837 3300053730 Bacteria 2581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_10025520 Ga0157375_100255202 384
2 3300037312 Ga0395899_0084903 Ga0395899_0084903_172_1545 401
3 3300046516 Ga0495628_0072158 Ga0495628_0072158_119_1537 425
4 3300046536 Ga0495587_0111872 Ga0495587_0111872_57_1475 425
5 3300009093 Ga0105240_10323353 Ga0105240_103233531 428
6 3300036401 Ga0373937_0026444 Ga0373937_0026444_3335_4747 428
7 3300009551 Ga0105238_10016825 Ga0105238_100168255 435
8 3300025924 Ga0207694_10011493 Ga0207694_100114933 435
9 3300041498 Ga0451841_1250680 Ga0451841_1250680_278_1747 444
10 3300003751 Ga0055538_1001228 Ga0055538_10012286 445
11 3300025224 Ga0209784_100140 Ga0209784_1001402 445
12 3300041404 Ga0439436_0025610 Ga0439436_0025610_141_1580 447
13 3300042007 Ga0439449_0000567 Ga0439449_0000567_7559_8998 447
14 3300042015 Ga0439462_0000343 Ga0439462_0000343_5140_6579 447
15 3300048911 Ga0496108_0035658 Ga0496108_0035658_1997_3514 449
16 3300049586 Ga0501070_0001082 Ga0501070_0001082_2816_4273 451
17 3300049583 Ga0501067_0067725 Ga0501067_0067725_57_1547 452
18 3300049586 Ga0501070_0011747 Ga0501070_0011747_4522_6012 452
19 3300049589 Ga0501073_0000040 Ga0501073_0000040_10693_12183 452
20 3300053136 Ga0500559_0015938 Ga0500559_0015938_62_1669 453
21 3300044842 Ga0466957_0082255 Ga0466957_0082255_250_1713 454
22 iso_pu_bacteria 2919443155 2919446661 454
23 3300028666 Ga0265336_10010470 Ga0265336_100104703 455
24 3300031249 Ga0265339_10003722 Ga0265339_100037222 455
25 3300031595 Ga0265313_10011987 Ga0265313_100119872 455
26 3300005339 Ga0070660_100003521 Ga0070660_1000035215 457
27 3300005458 Ga0070681_10005046 Ga0070681_1000504612 457
28 3300005530 Ga0070679_100000226 Ga0070679_10000022636 457
29 3300005535 Ga0070684_100001892 Ga0070684_1000018924 457
30 3300005563 Ga0068855_100067260 Ga0068855_1000672602 457
31 3300005577 Ga0068857_100131242 Ga0068857_1001312422 457
32 3300005614 Ga0068856_100073981 Ga0068856_1000739812 457
33 3300005616 Ga0068852_100006906 Ga0068852_1000069063 457
34 3300009093 Ga0105240_10054290 Ga0105240_100542901 457
35 3300009551 Ga0105238_10011253 Ga0105238_100112537 457
36 3300013104 Ga0157370_10013874 Ga0157370_100138745 457
37 3300013307 Ga0157372_10004034 Ga0157372_1000403412 457
38 3300025909 Ga0207705_10009567 Ga0207705_100095674 457
39 3300025912 Ga0207707_10007985 Ga0207707_100079857 457
40 3300025913 Ga0207695_10031454 Ga0207695_100314542 457
41 3300025921 Ga0207652_10002992 Ga0207652_100029925 457
42 3300025944 Ga0207661_10075468 Ga0207661_100754682 457
43 3300025949 Ga0207667_10000188 Ga0207667_1000018857 457
44 3300026078 Ga0207702_10040802 Ga0207702_100408022 457
45 3300026116 Ga0207674_10051770 Ga0207674_100517702 457
46 3300026142 Ga0207698_10050438 Ga0207698_100504382 457
47 3300028577 Ga0265318_10004576 Ga0265318_100045762 457
48 3300028800 Ga0265338_10004331 Ga0265338_100043313 457
49 3300031239 Ga0265328_10005764 Ga0265328_100057646 457
50 3300031240 Ga0265320_10054396 Ga0265320_100543962 457
51 3300031241 Ga0265325_10000249 Ga0265325_1000024910 457
52 3300031247 Ga0265340_10000990 Ga0265340_1000099017 457
53 3300031249 Ga0265339_10013910 Ga0265339_100139102 457
54 3300031344 Ga0265316_10002993 Ga0265316_100029932 457
55 3300031595 Ga0265313_10002347 Ga0265313_1000234717 457
56 3300031711 Ga0265314_10000239 Ga0265314_1000023929 457
57 3300031712 Ga0265342_10001442 Ga0265342_100014423 457
58 iso_pu_bacteria 2808606447 2809226092 457
59 3300028653 Ga0265323_10030495 Ga0265323_100304952 458
60 3300031235 Ga0265330_10002685 Ga0265330_100026852 458
61 3300031344 Ga0265316_10001520 Ga0265316_1000152016 458
62 3300031711 Ga0265314_10023320 Ga0265314_100233204 458
63 3300003760 Ga0055527_1000004 Ga0055527_100000435 459
64 3300003762 Ga0055542_1000055 Ga0055542_100005535 459
65 3300003763 Ga0055529_1000066 Ga0055529_1000066126 459
66 3300005435 Ga0070714_100001239 Ga0070714_10000123914 459
67 3300005436 Ga0070713_100000730 Ga0070713_1000007304 459
68 3300005563 Ga0068855_100206210 Ga0068855_1002062102 459
69 3300006028 Ga0070717_10040111 Ga0070717_100401114 459
70 3300013104 Ga0157370_10111382 Ga0157370_101113823 459
71 3300025228 Ga0209672_100011 Ga0209672_10001135 459
72 3300025229 Ga0209147_100388 Ga0209147_10038815 459
73 3300025254 Ga0209148_1000132 Ga0209148_1000132127 459
74 3300025272 Ga0209455_1000122 Ga0209455_100012235 459
75 3300025912 Ga0207707_10157243 Ga0207707_101572431 459
76 3300025917 Ga0207660_10111686 Ga0207660_101116862 459
77 3300025949 Ga0207667_10086303 Ga0207667_100863032 459
78 3300047319 Ga0495674_0172200 Ga0495674_0172200_245_1783 459
79 3300048917 Ga0496114_0079167 Ga0496114_0079167_601_2115 459
80 3300048929 Ga0496126_0059685 Ga0496126_0059685_1546_3060 459
81 3300049571 Ga0501034_0001598 Ga0501034_0001598_17184_18692 459
82 3300046459 Ga0495629_0089429 Ga0495629_0089429_39_1598 460
83 3300048914 Ga0496111_0064875 Ga0496111_0064875_269_1786 460
84 3300005435 Ga0070714_100156264 Ga0070714_1001562642 462
85 3300013307 Ga0157372_10230935 Ga0157372_102309352 462
86 3300005439 Ga0070711_100068620 Ga0070711_1000686202 464
87 3300006175 Ga0070712_100003532 Ga0070712_1000035329 464
88 3300025915 Ga0207693_10015223 Ga0207693_100152235 464
89 3300025916 Ga0207663_10055012 Ga0207663_100550122 464
90 3300049687 Ga0501258_000244 Ga0501258_000244_303_1919 465
91 3300049704 Ga0501221_000654 Ga0501221_000654_2736_4352 465
92 3300053102 Ga0500554_005720 Ga0500554_005720_442_2076 466
93 3300053123 Ga0500614_003230 Ga0500614_003230_662_2290 466
94 3300053138 Ga0500564_002850 Ga0500564_002850_66_1691 466
95 3300049459 Ga0495678_003373 Ga0495678_003373_8180_9793 468
96 3300053086 Ga0500578_0000692 Ga0500578_0000692_9498_11111 468
97 3300053118 Ga0500594_0008083 Ga0500594_0008083_215_1828 468
98 3300053156 Ga0500622_0003775 Ga0500622_0003775_192_1805 468
99 3300005543 Ga0070672_100010881 Ga0070672_1000108814 469
100 3300006881 Ga0068865_100109777 Ga0068865_1001097772 469
101 3300025299 Ga0209256_1004121 Ga0209256_10041216 469
102 3300047469 Ga0495673_0017813 Ga0495673_0017813_1898_3523 470
103 3300053088 Ga0500644_0000738 Ga0500644_0000738_8244_9869 470
104 3300031548 Ga0307408_100000010 Ga0307408_100000010280 473
105 3300028794 Ga0307515_10081872 Ga0307515_100818724 479
106 3300046460 Ga0495638_0004738 Ga0495638_0004738_8312_9925 479
107 3300049569 Ga0501032_0099000 Ga0501032_0099000_260_1810 479
108 3300049571 Ga0501034_0000596 Ga0501034_0000596_42368_43918 479
109 3300049581 Ga0501047_0105063 Ga0501047_0105063_108_1658 479
110 3300042126 Ga0450888_001177 Ga0450888_001177_705_2309 481
111 3300042130 Ga0450892_000284 Ga0450892_000284_2527_4131 481
112 3300049572 Ga0501036_0089688 Ga0501036_0089688_134_1690 481
113 3300049574 Ga0501038_0002797 Ga0501038_0002797_11488_13044 481
114 3300046616 Ga0495668_0031796 Ga0495668_0031796_845_2458 482
115 3300047469 Ga0495673_0002168 Ga0495673_0002168_6442_8076 482
116 3300005548 Ga0070665_100000924 Ga0070665_10000092418 483
117 3300006195 Ga0075366_10034937 Ga0075366_100349372 483
118 3300046522 Ga0495643_0000163 Ga0495643_0000163_21224_22786 483
119 3300050493 nmdc:mga0k408_23827_c2 nmdc:mga0k408_23827_c2_799_2508 483
120 3300005535 Ga0070684_100003972 Ga0070684_1000039723 484
121 3300046460 Ga0495638_0000440 Ga0495638_0000440_26022_27665 484
122 3300049581 Ga0501047_0105730 Ga0501047_0105730_895_2481 484
123 3300003323 rootH1_10014566 rootH1_100145662 485
124 3300003794 Ga0055531_10001455 Ga0055531_100014551 485
125 3300005456 Ga0070678_100014496 Ga0070678_1000144965 485
126 3300011119 Ga0105246_10099224 Ga0105246_100992242 485
127 3300025297 Ga0209758_1001445 Ga0209758_100144522 485
128 3300025298 Ga0209050_1012038 Ga0209050_10120384 485
129 3300025304 Ga0209257_1000200 Ga0209257_100020066 485
130 3300025949 Ga0207667_10118591 Ga0207667_101185912 485
131 3300026121 Ga0207683_10022219 Ga0207683_100222196 485
132 3300028794 Ga0307515_10035459 Ga0307515_100354596 485
133 3300046471 Ga0495650_0000068 Ga0495650_0000068_1722_3347 485
134 3300047472 Ga0495686_0012549 Ga0495686_0012549_3003_4640 485
135 3300053096 Ga0500641_0004518 Ga0500641_0004518_1447_3066 485
136 3300046513 Ga0495616_0000327 Ga0495616_0000327_3481_5106 486
137 3300046519 Ga0495632_0002845 Ga0495632_0002845_4075_5700 486
138 3300048925 Ga0496122_0006579 Ga0496122_0006579_11607_13256 486
139 3300048926 Ga0496123_0016324 Ga0496123_0016324_1238_2887 486
140 3300053087 Ga0500643_016603 Ga0500643_016603_770_2368 486
141 3300053104 Ga0500556_0000055 Ga0500556_0000055_58943_60541 486
142 3300053130 Ga0500642_0000008 Ga0500642_0000008_151196_152794 486
143 3300053730 Ga0500645_000682 Ga0500645_000682_9889_11487 486
144 iso_pu_bacteria 2830075706 2830076987 486
145 iso_pu_bacteria 2894414249 2894416011 486
146 3300006237 Ga0097621_100069551 Ga0097621_1000695511 487
147 3300042007 Ga0439449_0013918 Ga0439449_0013918_1248_2897 487
148 3300046660 Ga0495625_0002138 Ga0495625_0002138_15317_16942 487
149 3300025250 Ga0209026_1000803 Ga0209026_100080310 488
150 3300028794 Ga0307515_10186262 Ga0307515_101862622 488
151 3300032004 Ga0307414_10003601 Ga0307414_100036015 488
152 3300032005 Ga0307411_10005330 Ga0307411_100053304 488
153 3300046500 Ga0495596_0000006 Ga0495596_0000006_112444_114069 488
154 3300046538 Ga0495609_0003611 Ga0495609_0003611_6222_7847 488
155 3300053730 Ga0500645_013837 Ga0500645_013837_996_2561 488
156 3300003791 Ga0055530_10011106 Ga0055530_100111062 489
157 3300003794 Ga0055531_10005942 Ga0055531_100059427 489
158 3300025297 Ga0209758_1000933 Ga0209758_100093315 489
159 3300025298 Ga0209050_1000419 Ga0209050_100041915 489
160 3300025304 Ga0209257_1000441 Ga0209257_100044115 489
161 3300035091 Ga0373951_0006505 Ga0373951_0006505_429_2033 489
162 3300035114 Ga0373939_0000039 Ga0373939_0000039_11972_13576 489
163 3300035121 Ga0373960_0001057 Ga0373960_0001057_1074_2678 489
164 3300035691 Ga0373931_0000109 Ga0373931_0000109_28509_30113 489
165 3300005262 Ga0065165_1000985 Ga0065165_100098534 490
166 3300025295 Ga0209564_1005273 Ga0209564_10052736 490
167 3300046507 Ga0495606_0031246 Ga0495606_0031246_729_2354 490
168 3300046660 Ga0495625_0007703 Ga0495625_0007703_729_2327 490
169 3300053142 Ga0500577_0001227 Ga0500577_0001227_87_1709 490
170 3300046507 Ga0495606_0000029 Ga0495606_0000029_36893_38455 491
171 3300046520 Ga0495637_0003061 Ga0495637_0003061_6860_8422 491
172 3300046522 Ga0495643_0043572 Ga0495643_0043572_622_2247 491
173 3300046616 Ga0495668_0000016 Ga0495668_0000016_233464_235026 491
174 3300046684 Ga0495669_0000104 Ga0495669_0000104_35628_37190 491
175 3300047323 Ga0495683_0000659 Ga0495683_0000659_10563_12125 491
176 3300047443 Ga0495687_000098 Ga0495687_000098_79884_81446 491
177 3300048090 Ga0495615_0000125 Ga0495615_0000125_16428_18053 491
178 3300053079 Ga0500610_0000184 Ga0500610_0000184_6932_8494 491
179 3300053730 Ga0500645_000002 Ga0500645_000002_80790_82352 491
180 iso_pu_bacteria 2643221544 2643742520 491
181 iso_pu_bacteria 2643221639 2644222209 491
182 iso_pu_bacteria 2643221646 2644258090 491
183 iso_pu_bacteria 2738541337 2739055432 491
184 3300025295 Ga0209564_1000361 Ga0209564_100036144 492
185 3300025298 Ga0209050_1005535 Ga0209050_10055356 492
186 3300044656 Ga0466969_0000943 Ga0466969_0000943_8053_9648 492
187 3300044684 Ga0466966_0001737 Ga0466966_0001737_10680_12275 492
188 3300044694 Ga0466963_0056104 Ga0466963_0056104_618_2213 492
189 3300044719 Ga0466971_0003439 Ga0466971_0003439_4301_5896 492
190 iso_pu_bacteria 2643221585 2643933446 492
191 iso_pu_bacteria 2643221656 2644314695 492
192 iso_pu_bacteria 2818991466 2819713391 492
193 3300003773 Ga0055537_1009423 Ga0055537_10094231 493
194 3300025263 Ga0209565_1000062 Ga0209565_100006223 493
195 3300025273 Ga0209673_1015718 Ga0209673_10157182 493
196 3300046660 Ga0495625_0000150 Ga0495625_0000150_99308_100900 493
197 3300028794 Ga0307515_10027823 Ga0307515_100278235 494
198 3300028800 Ga0265338_10063018 Ga0265338_100630181 494
199 3300028794 Ga0307515_10085798 Ga0307515_100857984 495
200 3300046453 Ga0495627_000209 Ga0495627_000209_61794_63398 495
201 3300046471 Ga0495650_0000083 Ga0495650_0000083_114168_115766 495
202 3300046506 Ga0495583_0000351 Ga0495583_0000351_2495_4093 495
203 3300046665 Ga0495661_0065209 Ga0495661_0065209_42_1640 495
204 3300046809 Ga0495600_0000260 Ga0495600_0000260_17119_18717 495
205 3300053096 Ga0500641_0006062 Ga0500641_0006062_2127_3719 495
206 3300053119 Ga0500595_000595 Ga0500595_000595_14105_15703 495
207 iso_pu_bacteria 2928972540 2928973075 495
208 iso_pu_bacteria 2977240413 2977242853 495
209 3300005262 Ga0065165_1000523 Ga0065165_100052316 496
210 3300009094 Ga0111539_10000841 Ga0111539_1000084119 496
211 3300037471 Ga0395905_0000097 Ga0395905_0000097_523_2133 496
212 3300046522 Ga0495643_0000004 Ga0495643_0000004_343355_344944 496
213 3300046616 Ga0495668_0036782 Ga0495668_0036782_89_1729 496
214 3300046660 Ga0495625_0069911 Ga0495625_0069911_814_2454 496
215 3300046694 Ga0495649_0000092 Ga0495649_0000092_68718_70370 496
216 3300050511 nmdc:mga08y16_4336_c1 nmdc:mga08y16_4336_c1_3896_5497 496
217 3300053092 Ga0500583_0032202 Ga0500583_0032202_576_2195 496
218 3300006353 Ga0075370_10013761 Ga0075370_100137614 497
219 3300046512 Ga0495610_0000189 Ga0495610_0000189_26826_28439 497
220 3300050496 nmdc:mga07m45_6903_c1 nmdc:mga07m45_6903_c1_1528_3138 497
221 iso_pu_bacteria 2582581279 2585147648 497
222 iso_pu_bacteria 2643221552 2643782947 497
223 iso_pu_bacteria 2643221584 2643928257 497
224 3300005330 Ga0070690_100044164 Ga0070690_1000441641 498
225 3300005343 Ga0070687_100025286 Ga0070687_1000252862 498
226 3300005543 Ga0070672_100022284 Ga0070672_1000222842 498
227 3300014325 Ga0163163_10094551 Ga0163163_100945512 498
228 3300025940 Ga0207691_10078408 Ga0207691_100784082 498
229 3300046660 Ga0495625_0002862 Ga0495625_0002862_10467_12068 498
230 iso_pu_bacteria 2510917020 2511121871 498
231 iso_pu_bacteria 2582581280 2585152035 498
232 iso_pu_bacteria 2582581293 2585194479 498
233 iso_pu_bacteria 2585428106 2587917598 498
234 iso_pu_bacteria 2643221545 2643748648 498
235 iso_pu_bacteria 2643221583 2643923872 498
236 iso_pu_bacteria 2643221640 2644226878 498
237 iso_pu_bacteria 2643221642 2644233654 498
238 iso_pu_bacteria 2643221691 2644510322 498
239 iso_pu_bacteria 2818991435 2819539412 498
240 iso_pu_bacteria 2818991454 2819647714 498
241 iso_pu_bacteria 2851153111 2851153256 498
242 iso_pu_bacteria 2857504554 2857507151 498
243 iso_pu_bacteria 2884960567 2884961853 498
244 iso_pu_bacteria 2928531327 2928536038 498
245 3300025304 Ga0209257_1002515 Ga0209257_100251513 499
246 3300028786 Ga0307517_10024598 Ga0307517_100245983 499
247 3300031616 Ga0307508_10034897 Ga0307508_100348973 499
248 3300047469 Ga0495673_0000108 Ga0495673_0000108_132075_133688 499
249 iso_pu_bacteria 2791355048 2792460480 499
250 iso_pu_bacteria 2843744320 2843744574 499
251 iso_pu_bacteria 2849560528 2849565542 499
252 3300003792 Ga0055540_1001881 Ga0055540_10018819 500
253 3300025298 Ga0209050_1000001 Ga0209050_10000011706 500
254 3300025303 Ga0209051_1000109 Ga0209051_100010962 500
255 3300025944 Ga0207661_10049628 Ga0207661_100496282 500
256 3300046492 Ga0495585_0000526 Ga0495585_0000526_2561_4153 500
257 3300046506 Ga0495583_0000002 Ga0495583_0000002_539019_540686 500
258 3300046660 Ga0495625_0000170 Ga0495625_0000170_93792_95411 500
259 3300048910 Ga0496107_0000042 Ga0496107_0000042_8394_10010 500
260 3300048918 Ga0496115_0013437 Ga0496115_0013437_4080_5702 500
261 3300048924 Ga0496121_0014309 Ga0496121_0014309_722_2338 500
262 3300053087 Ga0500643_023665 Ga0500643_023665_37_1665 500
263 iso_pu_bacteria 2849573788 2849575657 500
264 3300003773 Ga0055537_1001708 Ga0055537_10017085 501
265 3300003781 Ga0055536_1001906 Ga0055536_10019063 501
266 3300003781 Ga0055536_1002035 Ga0055536_10020355 501
267 3300003791 Ga0055530_10002421 Ga0055530_100024218 501
268 3300003791 Ga0055530_10003821 Ga0055530_100038212 501
269 3300003794 Ga0055531_10003045 Ga0055531_100030455 501
270 3300005331 Ga0070670_100077463 Ga0070670_1000774632 501
271 3300005456 Ga0070678_100000141 Ga0070678_10000014121 501
272 3300009148 Ga0105243_10002788 Ga0105243_100027882 501
273 3300013296 Ga0157374_10064844 Ga0157374_100648443 501
274 3300025263 Ga0209565_1000140 Ga0209565_100014038 501
275 3300025292 Ga0209676_1000043 Ga0209676_100004328 501
276 3300025292 Ga0209676_1000712 Ga0209676_10007128 501
277 3300025297 Ga0209758_1002748 Ga0209758_10027482 501
278 3300025298 Ga0209050_1000559 Ga0209050_10005598 501
279 3300025298 Ga0209050_1001103 Ga0209050_100110325 501
280 3300025299 Ga0209256_1006103 Ga0209256_10061033 501
281 3300025304 Ga0209257_1000134 Ga0209257_100013490 501
282 3300025304 Ga0209257_1006218 Ga0209257_10062182 501
283 3300025904 Ga0207647_10006627 Ga0207647_100066275 501
284 3300025907 Ga0207645_10015704 Ga0207645_100157042 501
285 3300025933 Ga0207706_10013316 Ga0207706_100133162 501
286 3300025935 Ga0207709_10000005 Ga0207709_10000005276 501
287 3300025937 Ga0207669_10000193 Ga0207669_1000019320 501
288 3300025960 Ga0207651_10098074 Ga0207651_100980742 501
289 3300026121 Ga0207683_10003310 Ga0207683_100033102 501
290 3300046460 Ga0495638_0002775 Ga0495638_0002775_6420_8129 501
291 3300046491 Ga0495584_0030928 Ga0495584_0030928_854_2446 501
292 3300046507 Ga0495606_0038872 Ga0495606_0038872_414_2006 501
293 3300046512 Ga0495610_0000157 Ga0495610_0000157_44087_45712 501
294 3300046518 Ga0495631_0001382 Ga0495631_0001382_257_1849 501
295 3300046522 Ga0495643_0001656 Ga0495643_0001656_14572_16164 501
296 3300046522 Ga0495643_0042154 Ga0495643_0042154_285_1874 501
297 3300046524 Ga0495648_0003668 Ga0495648_0003668_6591_8183 501
298 3300046530 Ga0495654_0000042 Ga0495654_0000042_41521_43161 501
299 3300046558 Ga0495633_0000379 Ga0495633_0000379_34267_35859 501
300 3300046616 Ga0495668_0000587 Ga0495668_0000587_5860_7512 501
301 3300046660 Ga0495625_0020892 Ga0495625_0020892_1163_2872 501
302 3300046660 Ga0495625_0076239 Ga0495625_0076239_243_1835 501
303 3300046694 Ga0495649_0054220 Ga0495649_0054220_531_2123 501
304 3300047445 Ga0495677_0000882 Ga0495677_0000882_855_2447 501
305 3300047470 Ga0495681_0011023 Ga0495681_0011023_3575_5167 501
306 3300048929 Ga0496126_0000817 Ga0496126_0000817_291_1916 501
307 3300050516 nmdc:mga0sz30_3637_c1 nmdc:mga0sz30_3637_c1_3028_4650 501
308 3300053087 Ga0500643_000485 Ga0500643_000485_15948_17537 501
309 3300053122 Ga0500608_000079 Ga0500608_000079_10726_12351 501
310 3300053125 Ga0500618_000059 Ga0500618_000059_18969_20603 501
311 3300053130 Ga0500642_0000507 Ga0500642_0000507_4675_6267 501
312 3300053136 Ga0500559_0000412 Ga0500559_0000412_23743_25362 501
313 3300053156 Ga0500622_0006445 Ga0500622_0006445_4847_6469 501
314 3300053156 Ga0500622_0019893 Ga0500622_0019893_1729_3354 501
315 3300053158 Ga0500627_0002844 Ga0500627_0002844_3356_4996 501
316 iso_pu_bacteria 2898329390 2898331720 501
317 3300028786 Ga0307517_10061480 Ga0307517_100614802 502
318 3300053177 Ga0500636_0006105 Ga0500636_0006105_2131_3729 502
319 3300005336 Ga0070680_100003779 Ga0070680_1000037792 503
320 3300005344 Ga0070661_100000011 Ga0070661_100000011124 503
321 3300005530 Ga0070679_100000008 Ga0070679_10000000874 503
322 3300005842 Ga0068858_100000665 Ga0068858_10000066533 503
323 3300009148 Ga0105243_10079167 Ga0105243_100791673 503
324 3300025917 Ga0207660_10000650 Ga0207660_100006502 503
325 3300025920 Ga0207649_10000038 Ga0207649_1000003851 503
326 3300025921 Ga0207652_10000008 Ga0207652_10000008220 503
327 3300025927 Ga0207687_10000913 Ga0207687_1000091313 503
328 3300026035 Ga0207703_10001101 Ga0207703_1000110118 503
329 3300046520 Ga0495637_0033063 Ga0495637_0033063_243_1874 504
330 3300053104 Ga0500556_0001960 Ga0500556_0001960_4560_6191 504
331 iso_pu_bacteria 2510917021 2511126281 504
332 3300046460 Ga0495638_0000305 Ga0495638_0000305_52657_54279 505
333 3300046506 Ga0495583_0000710 Ga0495583_0000710_28998_30620 505
334 3300046524 Ga0495648_0000235 Ga0495648_0000235_9191_10813 505
335 3300046558 Ga0495633_0022799 Ga0495633_0022799_376_1998 505
336 3300046616 Ga0495668_0045736 Ga0495668_0045736_209_1849 505
337 3300046692 Ga0495671_0000020 Ga0495671_0000020_257267_258889 505
338 3300047469 Ga0495673_0000316 Ga0495673_0000316_9418_11040 505
339 3300046512 Ga0495610_0000019 Ga0495610_0000019_233738_235369 506
340 3300046519 Ga0495632_0002377 Ga0495632_0002377_5709_7349 507
341 iso_pu_bacteria 8054302542 8054306365 507
342 3300002774 JGI25150J39212_1000484 JGI25150J39212_100048414 512
343 3300003215 JGI25153J46596_10000147 JGI25153J46596_1000014730 512
344 3300025245 Ga0207425_1000019 Ga0207425_100001977 512
345 3300025258 Ga0209129_1001790 Ga0209129_100179011 512
346 3300025294 Ga0209025_1000829 Ga0209025_10008297 512
347 3300025297 Ga0209758_1000019 Ga0209758_1000019510 512

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04616

Glyco_hydro_43

Glycosyl hydrolases family 43

92

363

0.97

PF17851

GH43_C2

Beta xylosidase C-terminal Concanavalin A-like domain

390

567

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ms3-assembly1.cif.gz_B crystal structure of the gh43 protein blxynb mutant (k247s) from bacillus licheniformis 0.8643 58 512
6ms2-assembly1.cif.gz_A-2 crystal structure of the gh43 blxynb protein from bacillus licheniformis 0.854 58 512
5zqj-assembly1.cif.gz_B crystal structure of beta-xylosidase from bacillus pumilus 0.8478 58 512
5z5d-assembly1.cif.gz_A crystal structure of a thermostable glycoside hydrolase family 43 {beta}-1,4-xylosidase from geobacillus thermoleovorans it-08 0.8454 58 512
6ife-assembly1.cif.gz_B a glycoside hydrolase family 43 beta-xylosidase 0.845 60 512
ID Description Score Start End Superfamily
5z5iA02 Mainly Beta;Sandwich;Jelly Rolls; 0.8444 332 512 2.60.120.200
2exhA02 Mainly Beta;Sandwich;Jelly Rolls; 0.8353 329 512 2.60.120.200
1yrzB02 Mainly Beta;Sandwich;Jelly Rolls; 0.8346 329 510 2.60.120.200
5jozB02 Mainly Beta;Sandwich;Jelly Rolls; 0.8219 329 512 2.60.120.200
5z5fA01 Mainly Beta;5 Propeller;Tachylectin-2; Chain A;Glycosyl hydrolase domain; family 43 0.8166 58 316 2.115.10.20
ID Description Score Start End GO Terms
AF-A0A350KXZ3-F1-model_v4 deleted 0.9934 336 512
AF-A0A257WWA7-F1-model_v4 Glycosyl hydrolase family 43 0.9776 60 127 GO:0004553
GO:0005975
AF-A0A4Q3G2U6-F1-model_v4 Xylan 1,4-beta-xylosidase 0.9751 396 512
AF-A0A350KXZ3-F1-model_v4 deleted 0.9715 336 512
AF-A0A7X1B3U3-F1-model_v4 Beta-xylosidase C-terminal Concanavalin A-like domain-containing protein 0.9712 344 512

Feature Viewer

pLDDT pTM Quality
83.85 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map