F416941

General Info

Members Datasets Scaffolds Average Seq Length
346 177 692 163

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_312725_c1|nmdc:mga06r32_312725_c1_255_815
Length 186
Sequence MIVSAMAAPGRALARGMLVSNRENMIDPKKRLEEEIRGLDHELKVQLPKEIQRAREYGDLRENAEYKAAKERQTFLQARIGQLHRRLAALSLVNLDKIPRGKVGLGSTVQLKDTTSGDNITYDLVTPEEADPAQGRISPSSPIGKCLLNHEEGDVVEVRVPSGTKEYEILSLVTIHDQVKDSPAEA

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
115 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.38
Nodule 0
Rhizoplane 0
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 7.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_312725_c1 3300050510 Bacteria 1556
2 JGI25406J46586_10013916 3300003203 Bacteria 3435
3 Ga0070676_10060023 3300005328 Bacteria 2257
4 Ga0068869_100020121 3300005334 Bacteria 4571
5 Ga0070666_10263225 3300005335 Bacteria 1223
6 Ga0070682_100597371 3300005337 Bacteria 871
7 Ga0068868_100048110 3300005338 Bacteria 3344
8 Ga0068868_100257697 3300005338 Bacteria 1470
9 Ga0070689_100012400 3300005340 Bacteria 6139
10 Ga0070687_100010255 3300005343 Bacteria 4044
11 Ga0070669_100008964 3300005353 Bacteria 7140
12 Ga0070669_100238816 3300005353 Bacteria 1443
13 Ga0070669_100257624 3300005353 Bacteria 1391
14 Ga0070675_100548038 3300005354 Bacteria 1046
15 Ga0070674_100723185 3300005356 Bacteria 853
16 Ga0070673_100145155 3300005364 Bacteria 2005
17 Ga0070688_100010759 3300005365 Bacteria 5056
18 Ga0070703_10105175 3300005406 Bacteria 1001
19 Ga0070705_100038578 3300005440 Bacteria 2704
20 Ga0070700_100263985 3300005441 Bacteria 1241
21 Ga0070700_100334730 3300005441 Bacteria 1117
22 Ga0070700_100628346 3300005441 Bacteria 845
23 Ga0070694_100074599 3300005444 Bacteria 2345
24 Ga0070694_100412996 3300005444 Bacteria 1059
25 Ga0070694_100703262 3300005444 Bacteria 822
26 Ga0070708_100106523 3300005445 Bacteria 2573
27 Ga0070708_100337769 3300005445 Unclassified 1419
28 Ga0070708_100934777 3300005445 Bacteria 814
29 Ga0070663_100214443 3300005455 Bacteria 1509
30 Ga0070662_100719263 3300005457 Bacteria 845
31 Ga0068867_100005080 3300005459 Bacteria 9295
32 Ga0070706_100003056 3300005467 Bacteria 16577
33 Ga0070706_100054275 3300005467 Bacteria 3699
34 Ga0070706_100215088 3300005467 Bacteria 1794
35 Ga0070706_100723868 3300005467 Bacteria 922
36 Ga0070707_100000023 3300005468 Bacteria 128989
37 Ga0070707_100127853 3300005468 Bacteria 2469
38 Ga0070707_100357802 3300005468 Bacteria 1418
39 Ga0070698_100018328 3300005471 Bacteria 7371
40 Ga0070698_100019130 3300005471 Bacteria 7199
41 Ga0070698_100040331 3300005471 Bacteria 4799
42 Ga0070698_100967734 3300005471 Unclassified 798
43 Ga0070699_100009016 3300005518 Bacteria 8641
44 Ga0070699_100018607 3300005518 Bacteria 5967
45 Ga0070699_100029050 3300005518 Bacteria 4766
46 Ga0070699_100107941 3300005518 Bacteria 2443
47 Ga0070699_100215300 3300005518 Bacteria 1711
48 Ga0070699_100527577 3300005518 Bacteria 1074
49 Ga0070699_100921122 3300005518 Bacteria 801
50 Ga0070697_100030964 3300005536 Bacteria 4300
51 Ga0070697_100234870 3300005536 Bacteria 1565
52 Ga0070672_100093450 3300005543 Bacteria 2429
53 Ga0070672_100514647 3300005543 Bacteria 1036
54 Ga0070686_100030648 3300005544 Bacteria 3282
55 Ga0070695_100066831 3300005545 Bacteria 2344
56 Ga0070695_100072795 3300005545 Bacteria 2254
57 Ga0070695_100162074 3300005545 Bacteria 1571
58 Ga0070695_100288414 3300005545 Bacteria 1209
59 Ga0070695_100351007 3300005545 Bacteria 1105
60 Ga0070695_100692569 3300005545 Bacteria 808
61 Ga0070696_100083022 3300005546 Bacteria 2272
62 Ga0070696_100087353 3300005546 Bacteria 2215
63 Ga0070696_100435845 3300005546 Bacteria 1031
64 Ga0070696_100486089 3300005546 Bacteria 980
65 Ga0070696_100745954 3300005546 Bacteria 802
66 Ga0070665_100250467 3300005548 Bacteria 1772
67 Ga0070704_100053734 3300005549 Bacteria 2848
68 Ga0070704_100054450 3300005549 Bacteria 2831
69 Ga0070704_100160577 3300005549 Bacteria 1777
70 Ga0070704_100941813 3300005549 Bacteria 779
71 Ga0068859_100056555 3300005617 Bacteria 3949
72 Ga0068864_100145574 3300005618 Bacteria 2142
73 Ga0068864_100167940 3300005618 Bacteria 1999
74 Ga0068866_10043063 3300005718 Bacteria 2250
75 Ga0068861_100018569 3300005719 Bacteria 4954
76 Ga0068861_100128746 3300005719 Bacteria 2052
77 Ga0068861_100808160 3300005719 Bacteria 881
78 Ga0068870_10056762 3300005840 Bacteria 2091
79 Ga0068870_10430669 3300005840 Bacteria 865
80 Ga0068870_10568179 3300005840 Bacteria 766
81 Ga0068863_100056427 3300005841 Bacteria 3718
82 Ga0068858_100440477 3300005842 Bacteria 1255
83 Ga0068860_100027545 3300005843 Bacteria 5472
84 Ga0068862_100113271 3300005844 Bacteria 2383
85 Ga0068862_100124501 3300005844 Bacteria 2275
86 Ga0068862_100129546 3300005844 Bacteria 2230
87 Ga0081455_10008956 3300005937 Bacteria 10341
88 Ga0081455_10043022 3300005937 Bacteria 3956
89 Ga0081539_10000929 3300005985 Bacteria 55001
90 Ga0075365_10115769 3300006038 Bacteria 1846
91 Ga0075368_10054618 3300006042 Bacteria 1592
92 Ga0075368_10066021 3300006042 Bacteria 1454
93 Ga0075368_10207950 3300006042 Bacteria 829
94 Ga0075364_10126669 3300006051 Unclassified 1712
95 Ga0075364_10146084 3300006051 Bacteria 1592
96 Ga0075362_10078922 3300006177 Bacteria 1515
97 Ga0075367_10008089 3300006178 Bacteria 5429
98 Ga0075367_10046014 3300006178 Bacteria 2563
99 Ga0075367_10073220 3300006178 Bacteria 2063
100 Ga0075369_10467364 3300006186 Bacteria 598
101 Ga0075366_10008637 3300006195 Bacteria 5672
102 Ga0075366_10275670 3300006195 Bacteria 1028
103 Ga0068871_100363296 3300006358 Bacteria 1283
104 Ga0075428_100007823 3300006844 Bacteria 11847
105 Ga0075428_100021236 3300006844 Bacteria 7189
106 Ga0075428_100155808 3300006844 Bacteria 2482
107 Ga0075428_100275594 3300006844 Bacteria 1810
108 Ga0075428_100505830 3300006844 Bacteria 1292
109 Ga0075430_100007811 3300006846 Bacteria 9038
110 Ga0075430_100981434 3300006846 Bacteria 696
111 Ga0075431_100002742 3300006847 Bacteria 17073
112 Ga0075431_100151113 3300006847 Bacteria 2391
113 Ga0075431_100319866 3300006847 Bacteria 1565
114 Ga0075431_100440582 3300006847 Bacteria 1300
115 Ga0075431_102127350 3300006847 Unclassified 516
116 Ga0075433_10025919 3300006852 Bacteria 4959
117 Ga0075433_10295887 3300006852 Bacteria 1433
118 Ga0075433_10932793 3300006852 Bacteria 757
119 Ga0075433_11185455 3300006852 Bacteria 663
120 Ga0075434_100005480 3300006871 Bacteria 11558
121 Ga0075434_100073436 3300006871 Bacteria 3413
122 Ga0075434_100098112 3300006871 Bacteria 2935
123 Ga0075434_100156646 3300006871 Bacteria 2297
124 Ga0075429_100007814 3300006880 Bacteria 9289
125 Ga0075429_100174730 3300006880 Bacteria 1882
126 Ga0075429_100217331 3300006880 Bacteria 1674
127 Ga0068865_100058173 3300006881 Bacteria 2699
128 Ga0068865_100300298 3300006881 Bacteria 1285
129 Ga0075436_100034192 3300006914 Bacteria 3505
130 Ga0097620_100056557 3300006931 Bacteria 3949
131 Ga0075435_100024831 3300007076 Bacteria 4658
132 Ga0075435_100397842 3300007076 Bacteria 1184
133 Ga0105244_10281821 3300009036 Bacteria 771
134 Ga0111539_10003329 3300009094 Bacteria 21226
135 Ga0111539_10360309 3300009094 Bacteria 1693
136 Ga0111539_10697650 3300009094 Bacteria 1181
137 Ga0111539_11721937 3300009094 Unclassified 727
138 Ga0111539_11911031 3300009094 Bacteria 688
139 Ga0105247_10775775 3300009101 Bacteria 729
140 Ga0114129_10003194 3300009147 Bacteria 22994
141 Ga0114129_10008965 3300009147 Bacteria 14263
142 Ga0114129_10027617 3300009147 Bacteria 8036
143 Ga0114129_10037329 3300009147 Bacteria 6860
144 Ga0114129_10125848 3300009147 Bacteria 3523
145 Ga0114129_10129702 3300009147 Bacteria 3464
146 Ga0114129_10137087 3300009147 Bacteria 3357
147 Ga0114129_10306015 3300009147 Bacteria 2117
148 Ga0114129_10513110 3300009147 Bacteria 1564
149 Ga0114129_10680955 3300009147 Bacteria 1324
150 Ga0114129_11111958 3300009147 Bacteria 989
151 Ga0114129_12664964 3300009147 Unclassified 596
152 Ga0105243_10017166 3300009148 Bacteria 5474
153 Ga0105242_10321653 3300009176 Bacteria 1419
154 Ga0105248_10038851 3300009177 Bacteria 5328
155 Ga0105248_10214388 3300009177 Bacteria 2169
156 Ga0105238_11444636 3300009551 Bacteria 716
157 Ga0105249_10036138 3300009553 Bacteria 4481
158 Ga0105239_11102460 3300010375 Bacteria 914
159 Ga0105246_10041415 3300011119 Bacteria 3113
160 Ga0163162_10101914 3300013306 Unclassified 2963
161 Ga0163162_10479106 3300013306 Bacteria 1376
162 Ga0157375_10119877 3300013308 Bacteria 2739
163 Ga0157380_10004307 3300014326 Bacteria 9867
164 Ga0157380_10102024 3300014326 Unclassified 2392
165 Ga0157380_10175951 3300014326 Bacteria 1875
166 Ga0157380_10222181 3300014326 Bacteria 1691
167 Ga0157380_10884000 3300014326 Bacteria 918
168 Ga0157377_10018609 3300014745 Bacteria 3612
169 Ga0157379_10172561 3300014968 Bacteria 1952
170 Ga0163161_10111019 3300017792 Bacteria 2050
171 Ga0207653_10104886 3300025885 Bacteria 1004
172 Ga0207710_10367706 3300025900 Bacteria 734
173 Ga0207645_10201974 3300025907 Bacteria 1308
174 Ga0207643_10015022 3300025908 Bacteria 4212
175 Ga0207643_10360897 3300025908 Bacteria 913
176 Ga0207684_10014859 3300025910 Bacteria 6700
177 Ga0207684_10050712 3300025910 Bacteria 3521
178 Ga0207684_10202350 3300025910 Bacteria 1713
179 Ga0207684_10993856 3300025910 Bacteria 702
180 Ga0207662_10154610 3300025918 Bacteria 1461
181 Ga0207646_10000077 3300025922 Bacteria 134395
182 Ga0207646_10004470 3300025922 Bacteria 15154
183 Ga0207646_10077565 3300025922 Bacteria 2969
184 Ga0207681_10071805 3300025923 Bacteria 2416
185 Ga0207681_10122080 3300025923 Bacteria 1912
186 Ga0207650_10527350 3300025925 Bacteria 989
187 Ga0207659_10307265 3300025926 Bacteria 1304
188 Ga0207706_10015804 3300025933 Bacteria 6824
189 Ga0207686_10123050 3300025934 Bacteria 1768
190 Ga0207670_10053849 3300025936 Bacteria 2713
191 Ga0207669_10130541 3300025937 Bacteria 1725
192 Ga0207704_10006474 3300025938 Bacteria 5463
193 Ga0207691_10038881 3300025940 Bacteria 4402
194 Ga0207691_10168088 3300025940 Bacteria 1921
195 Ga0207711_10129527 3300025941 Bacteria 2261
196 Ga0207711_10352785 3300025941 Bacteria 1362
197 Ga0207689_10031062 3300025942 Bacteria 4449
198 Ga0207689_10054696 3300025942 Bacteria 3286
199 Ga0207679_11153091 3300025945 Bacteria 711
200 Ga0207651_10213401 3300025960 Bacteria 1555
201 Ga0207651_10906052 3300025960 Bacteria 785
202 Ga0207668_10080891 3300025972 Bacteria 2355
203 Ga0207658_10046549 3300025986 Bacteria 3169
204 Ga0207677_10126431 3300026023 Bacteria 1933
205 Ga0207703_10172893 3300026035 Bacteria 1901
206 Ga0207703_10332838 3300026035 Bacteria 1393
207 Ga0207678_10048689 3300026067 Bacteria 3663
208 Ga0207708_10024244 3300026075 Bacteria 4587
209 Ga0207708_10131646 3300026075 Bacteria 1956
210 Ga0207648_10000668 3300026089 Bacteria 38381
211 Ga0207676_10167922 3300026095 Bacteria 1909
212 Ga0207676_11681545 3300026095 Bacteria 633
213 Ga0207674_10433446 3300026116 Bacteria 1270
214 Ga0207675_100021028 3300026118 Bacteria 6083
215 Ga0207675_100156167 3300026118 Bacteria 2174
216 Ga0207675_100873269 3300026118 Bacteria 915
217 Ga0207428_10000032 3300027907 Bacteria 232162
218 Ga0207428_10012933 3300027907 Bacteria 7316
219 Ga0268266_10541314 3300028379 Bacteria 1115
220 Ga0268265_10102170 3300028380 Bacteria 2318
221 Ga0268265_10148214 3300028380 Bacteria 1975
222 Ga0268265_10180675 3300028380 Bacteria 1812
223 Ga0268265_10555329 3300028380 Bacteria 1091
224 Ga0268265_11081679 3300028380 Bacteria 795
225 Ga0268264_10212212 3300028381 Bacteria 1778
226 Ga0316576_10003661 3300031727 Bacteria 9062
227 Ga0316576_10215781 3300031727 Bacteria 1444
228 Ga0316576_10243680 3300031727 Bacteria 1350
229 Ga0316576_10507277 3300031727 Bacteria 887
230 Ga0316578_10187842 3300031728 Unclassified 1245
231 Ga0316578_10202778 3300031728 Bacteria 1194
232 Ga0307405_10719859 3300031731 Bacteria 828
233 Ga0316577_10009190 3300031733 Bacteria 5315
234 Ga0307413_10000339 3300031824 Bacteria 14755
235 Ga0307413_11077288 3300031824 Bacteria 693
236 Ga0307410_10001521 3300031852 Bacteria 10553
237 Ga0307410_10372487 3300031852 Bacteria 1147
238 Ga0307412_10479873 3300031911 Bacteria 1031
239 Ga0307409_100027923 3300031995 Bacteria 4009
240 Ga0307416_100136000 3300032002 Bacteria 2223
241 Ga0307416_101436037 3300032002 Bacteria 796
242 Ga0307414_10433134 3300032004 Bacteria 1149
243 Ga0307411_10001886 3300032005 Bacteria 8936
244 Ga0307415_100491188 3300032126 Bacteria 1071
245 Ga0316585_10212324 3300032137 Bacteria 640
246 Ga0316574_0147814 3300035398 Bacteria 1515
247 Ga0373931_0506983 3300035691 Bacteria 779
248 Ga0316582_0002419 3300036647 Bacteria 8760
249 Ga0316584_0048924 3300036712 Bacteria 3159
250 Ga0316584_0050563 3300036712 Bacteria 3108
251 Ga0436365_0955860 3300039437 Bacteria 1471
252 Ga0436362_0980718 3300039453 Unclassified 1119
253 Ga0453684_0255873 3300044712 Bacteria 2008
254 Ga0453684_0352497 3300044712 Bacteria 1659
255 Ga0495638_0038242 3300046460 Bacteria 3050
256 Ga0495638_0057769 3300046460 Bacteria 2406
257 Ga0495584_0114460 3300046491 Bacteria 1365
258 Ga0495663_0181167 3300046525 Archaea 730
259 Ga0495669_0091414 3300046684 Bacteria 1405
260 Ga0495589_0396476 3300046794 Bacteria 634
261 Ga0495672_0047276 3300047320 Bacteria 2560
262 Ga0501031_0489942 3300049568 Unclassified 793
263 Ga0501034_0057872 3300049571 Bacteria 3897
264 Ga0501036_0030072 3300049572 Bacteria 4588
265 Ga0501038_0429092 3300049574 Unclassified 1019
266 Ga0501040_0555797 3300049576 Bacteria 828
267 Ga0501042_0012140 3300049578 Bacteria 5829
268 Ga0501042_1135590 3300049578 Bacteria 570
269 Ga0501043_0450775 3300049579 Unclassified 967
270 Ga0501046_0745689 3300049580 Unclassified 688
271 Ga0501048_0034969 3300049582 Bacteria 3620
272 Ga0501048_0276388 3300049582 Unclassified 1194
273 Ga0501071_0014633 3300049587 Bacteria 5369
274 Ga0501072_0122497 3300049588 Bacteria 2072
275 Ga0501072_0248063 3300049588 Bacteria 1418
276 Ga0501074_0126738 3300049590 Unclassified 1827
277 Ga0501074_0487018 3300049590 Bacteria 874
278 Ga0501075_0298445 3300049591 Bacteria 1227
279 Ga0501076_0002932 3300049592 Bacteria 11823
280 Ga0501076_0131617 3300049592 Unclassified 2029
281 Ga0501076_0168860 3300049592 Bacteria 1783
282 Ga0501077_0393931 3300049593 Unclassified 885
283 Ga0501224_070337 3300049664 Bacteria 553
284 Ga0501079_0115251 3300049741 Bacteria 2089
285 Ga0501079_0723380 3300049741 Unclassified 783
286 Ga0501079_1386298 3300049741 Bacteria 553
287 Ga0501080_0491495 3300049742 Bacteria 1097
288 Ga0501081_0231442 3300049743 Bacteria 1346
289 Ga0501081_0322896 3300049743 Bacteria 1135
290 Ga0501081_0453339 3300049743 Bacteria 953
291 Ga0501045_0185960 3300049824 Unclassified 1548
292 nmdc:mga00v17_327261_c1 3300050491 Unclassified 996
293 nmdc:mga00v17_569404_c1 3300050491 Bacteria 732
294 nmdc:mga00v17_78061_c1 3300050491 Bacteria 2063
295 nmdc:mga0yw44_164282_c1 3300050492 Bacteria 1455
296 nmdc:mga0yw44_276671_c1 3300050492 Bacteria 1121
297 nmdc:mga0k408_226_c1 3300050493 Bacteria 30139
298 nmdc:mga0k408_371568_c1 3300050493 Bacteria 852
299 nmdc:mga0k408_567694_c1 3300050493 Bacteria 670
300 nmdc:mga06z11_16703_c1 3300050494 Bacteria 3312
301 nmdc:mga06z11_2431_c1 3300050494 Bacteria 7100
302 nmdc:mga06z11_45706_c1 3300050494 Unclassified 2215
303 nmdc:mga06z11_517742_c1 3300050494 Bacteria 723
304 nmdc:mga06z11_82304_c1 3300050494 Bacteria 1730
305 nmdc:mga04h51_104509_c1 3300050495 Bacteria 1036
306 nmdc:mga05p37_105449_c1 3300050507 Bacteria 3468
307 nmdc:mga05p37_1118_c2 3300050507 Bacteria 20960
308 nmdc:mga05p37_218941_c1 3300050507 Bacteria 2298
309 nmdc:mga05p37_236161_c1 3300050507 Bacteria 2200
310 nmdc:mga05p37_264480_c1 3300050507 Bacteria 2057
311 nmdc:mga05p37_279038_c1 3300050507 Bacteria 1993
312 nmdc:mga05p37_30008_c1 3300050507 Bacteria 6635
313 nmdc:mga05p37_52677_c1 3300050507 Bacteria 5003
314 nmdc:mga09592_10498_c1 3300050508 Bacteria 7534
315 nmdc:mga09592_21923_c1 3300050508 Bacteria 5268
316 nmdc:mga09592_280647_c1 3300050508 Bacteria 1445
317 nmdc:mga09592_282465_c1 3300050508 Bacteria 1440
318 nmdc:mga09592_356095_c1 3300050508 Bacteria 1266
319 nmdc:mga0qj67_4997_c1 3300050509 Bacteria 9638
320 nmdc:mga06r32_259873_c1 3300050510 Bacteria 1724
321 nmdc:mga06r32_349057_c1 3300050510 Bacteria 1464
322 nmdc:mga08y16_14168_c1 3300050511 Bacteria 8391
323 nmdc:mga08y16_14409_c2 3300050511 Bacteria 6347
324 nmdc:mga08y16_269353_c1 3300050511 Bacteria 1758
325 nmdc:mga08y16_57892_c1 3300050511 Bacteria 4049
326 nmdc:mga0n895_229383_c1 3300050512 Bacteria 1885
327 nmdc:mga0n895_274088_c1 3300050512 Bacteria 1711
328 nmdc:mga0n895_36442_c1 3300050512 Bacteria 4749
329 nmdc:mga0n895_427066_c1 3300050512 Bacteria 1339
330 nmdc:mga0n895_490571_c1 3300050512 Bacteria 1238
331 nmdc:mga0n895_571493_c1 3300050512 Bacteria 1135
332 nmdc:mga0rr50_40817_c1 3300050513 Bacteria 3376
333 nmdc:mga0rr50_46121_c1 3300050513 Bacteria 3208
334 nmdc:mga08x19_43328_c1 3300050514 Bacteria 2871
335 nmdc:mga0a205_147249_c1 3300050515 Bacteria 2255
336 nmdc:mga0a205_31946_c1 3300050515 Bacteria 5046
337 nmdc:mga0a205_40290_c1 3300050515 Bacteria 4497
338 nmdc:mga0a205_46818_c1 3300050515 Bacteria 4171
339 nmdc:mga0a205_745703_c1 3300050515 Bacteria 828
340 Ga0500651_0092385 3300053093 Bacteria 1862
341 Ga0500568_0034864 3300053139 Bacteria 2056
342 Ga0501084_0120321 3300054114 Bacteria 2208
343 Ga0501084_0430251 3300054114 Unclassified 1116
344 Ga0501082_0379543 3300060353 Bacteria 1233
345 Ga0501082_1135896 3300060353 Unclassified 683
346 Ga0530510_0882277 3300061734 Unclassified 683
347 nmdc:mga06r32_312725_c1
348 JGI25406J46586_10013916
349 Ga0070676_10060023
350 Ga0068869_100020121
351 Ga0070666_10263225
352 Ga0070682_100597371
353 Ga0068868_100048110
354 Ga0068868_100257697
355 Ga0070689_100012400
356 Ga0070687_100010255
357 Ga0070669_100008964
358 Ga0070669_100238816
359 Ga0070669_100257624
360 Ga0070675_100548038
361 Ga0070674_100723185
362 Ga0070673_100145155
363 Ga0070688_100010759
364 Ga0070703_10105175
365 Ga0070705_100038578
366 Ga0070700_100263985
367 Ga0070700_100334730
368 Ga0070700_100628346
369 Ga0070694_100074599
370 Ga0070694_100412996
371 Ga0070694_100703262
372 Ga0070708_100106523
373 Ga0070708_100337769
374 Ga0070708_100934777
375 Ga0070663_100214443
376 Ga0070662_100719263
377 Ga0068867_100005080
378 Ga0070706_100003056
379 Ga0070706_100054275
380 Ga0070706_100215088
381 Ga0070706_100723868
382 Ga0070707_100000023
383 Ga0070707_100127853
384 Ga0070707_100357802
385 Ga0070698_100018328
386 Ga0070698_100019130
387 Ga0070698_100040331
388 Ga0070698_100967734
389 Ga0070699_100009016
390 Ga0070699_100018607
391 Ga0070699_100029050
392 Ga0070699_100107941
393 Ga0070699_100215300
394 Ga0070699_100527577
395 Ga0070699_100921122
396 Ga0070697_100030964
397 Ga0070697_100234870
398 Ga0070672_100093450
399 Ga0070672_100514647
400 Ga0070686_100030648
401 Ga0070695_100066831
402 Ga0070695_100072795
403 Ga0070695_100162074
404 Ga0070695_100288414
405 Ga0070695_100351007
406 Ga0070695_100692569
407 Ga0070696_100083022
408 Ga0070696_100087353
409 Ga0070696_100435845
410 Ga0070696_100486089
411 Ga0070696_100745954
412 Ga0070665_100250467
413 Ga0070704_100053734
414 Ga0070704_100054450
415 Ga0070704_100160577
416 Ga0070704_100941813
417 Ga0068859_100056555
418 Ga0068864_100145574
419 Ga0068864_100167940
420 Ga0068866_10043063
421 Ga0068861_100018569
422 Ga0068861_100128746
423 Ga0068861_100808160
424 Ga0068870_10056762
425 Ga0068870_10430669
426 Ga0068870_10568179
427 Ga0068863_100056427
428 Ga0068858_100440477
429 Ga0068860_100027545
430 Ga0068862_100113271
431 Ga0068862_100124501
432 Ga0068862_100129546
433 Ga0081455_10008956
434 Ga0081455_10043022
435 Ga0081539_10000929
436 Ga0075365_10115769
437 Ga0075368_10054618
438 Ga0075368_10066021
439 Ga0075368_10207950
440 Ga0075364_10126669
441 Ga0075364_10146084
442 Ga0075362_10078922
443 Ga0075367_10008089
444 Ga0075367_10046014
445 Ga0075367_10073220
446 Ga0075369_10467364
447 Ga0075366_10008637
448 Ga0075366_10275670
449 Ga0068871_100363296
450 Ga0075428_100007823
451 Ga0075428_100021236
452 Ga0075428_100155808
453 Ga0075428_100275594
454 Ga0075428_100505830
455 Ga0075430_100007811
456 Ga0075430_100981434
457 Ga0075431_100002742
458 Ga0075431_100151113
459 Ga0075431_100319866
460 Ga0075431_100440582
461 Ga0075431_102127350
462 Ga0075433_10025919
463 Ga0075433_10295887
464 Ga0075433_10932793
465 Ga0075433_11185455
466 Ga0075434_100005480
467 Ga0075434_100073436
468 Ga0075434_100098112
469 Ga0075434_100156646
470 Ga0075429_100007814
471 Ga0075429_100174730
472 Ga0075429_100217331
473 Ga0068865_100058173
474 Ga0068865_100300298
475 Ga0075436_100034192
476 Ga0097620_100056557
477 Ga0075435_100024831
478 Ga0075435_100397842
479 Ga0105244_10281821
480 Ga0111539_10003329
481 Ga0111539_10360309
482 Ga0111539_10697650
483 Ga0111539_11721937
484 Ga0111539_11911031
485 Ga0105247_10775775
486 Ga0114129_10003194
487 Ga0114129_10008965
488 Ga0114129_10027617
489 Ga0114129_10037329
490 Ga0114129_10125848
491 Ga0114129_10129702
492 Ga0114129_10137087
493 Ga0114129_10306015
494 Ga0114129_10513110
495 Ga0114129_10680955
496 Ga0114129_11111958
497 Ga0114129_12664964
498 Ga0105243_10017166
499 Ga0105242_10321653
500 Ga0105248_10038851
501 Ga0105248_10214388
502 Ga0105238_11444636
503 Ga0105249_10036138
504 Ga0105239_11102460
505 Ga0105246_10041415
506 Ga0163162_10101914
507 Ga0163162_10479106
508 Ga0157375_10119877
509 Ga0157380_10004307
510 Ga0157380_10102024
511 Ga0157380_10175951
512 Ga0157380_10222181
513 Ga0157380_10884000
514 Ga0157377_10018609
515 Ga0157379_10172561
516 Ga0163161_10111019
517 Ga0207653_10104886
518 Ga0207710_10367706
519 Ga0207645_10201974
520 Ga0207643_10015022
521 Ga0207643_10360897
522 Ga0207684_10014859
523 Ga0207684_10050712
524 Ga0207684_10202350
525 Ga0207684_10993856
526 Ga0207662_10154610
527 Ga0207646_10000077
528 Ga0207646_10004470
529 Ga0207646_10077565
530 Ga0207681_10071805
531 Ga0207681_10122080
532 Ga0207650_10527350
533 Ga0207659_10307265
534 Ga0207706_10015804
535 Ga0207686_10123050
536 Ga0207670_10053849
537 Ga0207669_10130541
538 Ga0207704_10006474
539 Ga0207691_10038881
540 Ga0207691_10168088
541 Ga0207711_10129527
542 Ga0207711_10352785
543 Ga0207689_10031062
544 Ga0207689_10054696
545 Ga0207679_11153091
546 Ga0207651_10213401
547 Ga0207651_10906052
548 Ga0207668_10080891
549 Ga0207658_10046549
550 Ga0207677_10126431
551 Ga0207703_10172893
552 Ga0207703_10332838
553 Ga0207678_10048689
554 Ga0207708_10024244
555 Ga0207708_10131646
556 Ga0207648_10000668
557 Ga0207676_10167922
558 Ga0207676_11681545
559 Ga0207674_10433446
560 Ga0207675_100021028
561 Ga0207675_100156167
562 Ga0207675_100873269
563 Ga0207428_10000032
564 Ga0207428_10012933
565 Ga0268266_10541314
566 Ga0268265_10102170
567 Ga0268265_10148214
568 Ga0268265_10180675
569 Ga0268265_10555329
570 Ga0268265_11081679
571 Ga0268264_10212212
572 Ga0316576_10003661
573 Ga0316576_10215781
574 Ga0316576_10243680
575 Ga0316576_10507277
576 Ga0316578_10187842
577 Ga0316578_10202778
578 Ga0307405_10719859
579 Ga0316577_10009190
580 Ga0307413_10000339
581 Ga0307413_11077288
582 Ga0307410_10001521
583 Ga0307410_10372487
584 Ga0307412_10479873
585 Ga0307409_100027923
586 Ga0307416_100136000
587 Ga0307416_101436037
588 Ga0307414_10433134
589 Ga0307411_10001886
590 Ga0307415_100491188
591 Ga0316585_10212324
592 Ga0316574_0147814
593 Ga0373931_0506983
594 Ga0316582_0002419
595 Ga0316584_0048924
596 Ga0316584_0050563
597 Ga0436365_0955860
598 Ga0436362_0980718
599 Ga0453684_0255873
600 Ga0453684_0352497
601 Ga0495638_0038242
602 Ga0495638_0057769
603 Ga0495584_0114460
604 Ga0495663_0181167
605 Ga0495669_0091414
606 Ga0495589_0396476
607 Ga0495672_0047276
608 Ga0501031_0489942
609 Ga0501034_0057872
610 Ga0501036_0030072
611 Ga0501038_0429092
612 Ga0501040_0555797
613 Ga0501042_0012140
614 Ga0501042_1135590
615 Ga0501043_0450775
616 Ga0501046_0745689
617 Ga0501048_0034969
618 Ga0501048_0276388
619 Ga0501071_0014633
620 Ga0501072_0122497
621 Ga0501072_0248063
622 Ga0501074_0126738
623 Ga0501074_0487018
624 Ga0501075_0298445
625 Ga0501076_0002932
626 Ga0501076_0131617
627 Ga0501076_0168860
628 Ga0501077_0393931
629 Ga0501224_070337
630 Ga0501079_0115251
631 Ga0501079_0723380
632 Ga0501079_1386298
633 Ga0501080_0491495
634 Ga0501081_0231442
635 Ga0501081_0322896
636 Ga0501081_0453339
637 Ga0501045_0185960
638 nmdc:mga00v17_327261_c1
639 nmdc:mga00v17_569404_c1
640 nmdc:mga00v17_78061_c1
641 nmdc:mga0yw44_164282_c1
642 nmdc:mga0yw44_276671_c1
643 nmdc:mga0k408_226_c1
644 nmdc:mga0k408_371568_c1
645 nmdc:mga0k408_567694_c1
646 nmdc:mga06z11_16703_c1
647 nmdc:mga06z11_2431_c1
648 nmdc:mga06z11_45706_c1
649 nmdc:mga06z11_517742_c1
650 nmdc:mga06z11_82304_c1
651 nmdc:mga04h51_104509_c1
652 nmdc:mga05p37_105449_c1
653 nmdc:mga05p37_1118_c2
654 nmdc:mga05p37_218941_c1
655 nmdc:mga05p37_236161_c1
656 nmdc:mga05p37_264480_c1
657 nmdc:mga05p37_279038_c1
658 nmdc:mga05p37_30008_c1
659 nmdc:mga05p37_52677_c1
660 nmdc:mga09592_10498_c1
661 nmdc:mga09592_21923_c1
662 nmdc:mga09592_280647_c1
663 nmdc:mga09592_282465_c1
664 nmdc:mga09592_356095_c1
665 nmdc:mga0qj67_4997_c1
666 nmdc:mga06r32_259873_c1
667 nmdc:mga06r32_349057_c1
668 nmdc:mga08y16_14168_c1
669 nmdc:mga08y16_14409_c2
670 nmdc:mga08y16_269353_c1
671 nmdc:mga08y16_57892_c1
672 nmdc:mga0n895_229383_c1
673 nmdc:mga0n895_274088_c1
674 nmdc:mga0n895_36442_c1
675 nmdc:mga0n895_427066_c1
676 nmdc:mga0n895_490571_c1
677 nmdc:mga0n895_571493_c1
678 nmdc:mga0rr50_40817_c1
679 nmdc:mga0rr50_46121_c1
680 nmdc:mga08x19_43328_c1
681 nmdc:mga0a205_147249_c1
682 nmdc:mga0a205_31946_c1
683 nmdc:mga0a205_40290_c1
684 nmdc:mga0a205_46818_c1
685 nmdc:mga0a205_745703_c1
686 Ga0500651_0092385
687 Ga0500568_0034864
688 Ga0501084_0120321
689 Ga0501084_0430251
690 Ga0501082_0379543
691 Ga0501082_1135896
692 Ga0530510_0882277

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

98

174

0.97

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

27

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4abm-assembly1.cif.gz_B crystal structure of chmp4b hairpin 0.9312 10 72
6zw5-assembly1.cif.gz_F c15 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.9229 10 73
6zw6-assembly1.cif.gz_G c16 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.9213 10 73
6zw4-assembly1.cif.gz_F c14 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.9208 10 73
6zvr-assembly1.cif.gz_D c11 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.9071 10 73
ID Description Score Start End Superfamily
af_P9WMT9_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9836 10 69 1.10.287.180
af_P0A6W5_1_75_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9394 10 69 1.10.287.180
4abmB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ESAT-6-like 0.9313 10 72 1.10.287.1060
af_Q2FXW7_4_78_1.10.287.180 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Transcription elongation factor, GreA/GreB, N-terminal domain 0.9306 9 69 1.10.287.180
3pwfA01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9124 9 72 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7C3RQF1-F1-model_v4 Transcription elongation factor GreA 0.9583 10 158 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A7T0BXH9-F1-model_v4 Transcription elongation factor GreA 0.9503 10 159 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A2V8TF71-F1-model_v4 Transcription elongation factor GreA (Transcript cleavage factor GreA) 0.9366 10 160 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A7W0V2Q5-F1-model_v4 Transcription elongation factor GreA 0.9271 10 144 GO:0003677
GO:0003746
GO:0006354
GO:0032784
GO:0070063
AF-A0A6L7KBC6-F1-model_v4 deleted 0.9263 10 158

Map