F416862

General Info

Members Datasets Scaffolds Average Seq Length
346 237 692 260

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0149599|Ga0466963_0149599_239_1072
Length 277
Sequence MDKVAASAAAAVADIPDGASIAVGGFGLSGVPNVLIEALYAAGASGLSVVSNNCGVDGGGLGVLLAARRIARVTGSYVGENKEFARQYLAGELEVELIPQGTLAERLRAGGCGIPAFFTPAGVGTQVAEGGLPWRYAADGSVALASPPKEVREFDGAQYVMERGIVTDYALVHAAKGDRHGNLVFAKSSRNFNPLAAMAGRVTVAEVEELVEPGDLDPDEVHLPGVFVQRVVVLSPEQAADKRIERRTVTARGAGETAGVRASTGSNTVSATETAAS

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
107 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
108 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
109 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
110 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
113 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
132 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
133 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
218 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
219 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
220 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
221 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
222 2808606448 Streptomyces sp. 193411 Isolate Unclassified
223 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
224 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
225 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
226 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
227 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
228 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
229 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
230 2919395869 Microbacterium resistens 2980 Isolate Unclassified
231 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
232 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
233 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
234 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
235 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
236 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
237 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.49
Metatranscriptomes 1.45
Isolates 6.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 6.65
Rhizosphere 83.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0149599 3300044694 Bacteria 1621
2 JGI24746J21847_1003809 3300001977 Bacteria 2382
3 JGI24737J22298_10029557 3300001990 Bacteria 1718
4 JGI24743J22301_10016769 3300001991 Bacteria 1369
5 Ga0006562J51391_1246357 3300003578 Bacteria 60288
6 Ga0006562J51391_1246358 3300003578 Bacteria 60288
7 Ga0070658_10402354 3300005327 Bacteria 1176
8 Ga0068869_100005633 3300005334 Bacteria 7895
9 Ga0070682_100040606 3300005337 Bacteria 2863
10 Ga0068868_100086962 3300005338 Bacteria 2513
11 Ga0070691_10278339 3300005341 Bacteria 907
12 Ga0070668_100146932 3300005347 Bacteria 1903
13 Ga0070675_100110221 3300005354 Bacteria 2327
14 Ga0070674_100377378 3300005356 Bacteria 1152
15 Ga0070673_100049859 3300005364 Bacteria 3270
16 Ga0070688_100004616 3300005365 Bacteria 7190
17 Ga0070667_100613865 3300005367 Bacteria 1003
18 Ga0070709_10213835 3300005434 Bacteria 1372
19 Ga0070714_100013882 3300005435 Bacteria 6460
20 Ga0070710_10004550 3300005437 Bacteria 6554
21 Ga0070711_100094241 3300005439 Bacteria 2164
22 Ga0070705_100034093 3300005440 Bacteria 2843
23 Ga0070694_100056978 3300005444 Bacteria 2656
24 Ga0068867_100191661 3300005459 Bacteria 1631
25 Ga0068853_100025710 3300005539 Bacteria 4941
26 Ga0070696_100116705 3300005546 Bacteria 1928
27 Ga0070665_100005218 3300005548 Bacteria 13443
28 Ga0070665_100201961 3300005548 Bacteria 1988
29 Ga0070704_100005863 3300005549 Bacteria 7197
30 Ga0068855_100001319 3300005563 Bacteria 30718
31 Ga0068855_100303133 3300005563 Bacteria 1769
32 Ga0068854_100048417 3300005578 Bacteria 3033
33 Ga0068856_100014159 3300005614 Bacteria 7712
34 Ga0068859_100474412 3300005617 Bacteria 1347
35 Ga0068864_100162946 3300005618 Bacteria 2028
36 Ga0068864_100237127 3300005618 Bacteria 1689
37 Ga0068866_10115473 3300005718 Bacteria 1504
38 Ga0068861_100235892 3300005719 Bacteria 1554
39 Ga0068851_10351297 3300005834 Bacteria 858
40 Ga0068863_100385915 3300005841 Bacteria 1368
41 Ga0068862_100128636 3300005844 Bacteria 2238
42 Ga0070715_10070201 3300006163 Bacteria 1563
43 Ga0070716_100001673 3300006173 Bacteria 9998
44 Ga0075369_10000628 3300006186 Bacteria 11200
45 Ga0075430_100099695 3300006846 Bacteria 2426
46 Ga0075431_100103792 3300006847 Bacteria 2934
47 Ga0097620_100474404 3300006931 Bacteria 1347
48 Ga0105240_10008504 3300009093 Bacteria 14680
49 Ga0105245_10210160 3300009098 Bacteria 1873
50 Ga0105247_10053335 3300009101 Bacteria 2494
51 Ga0105247_10056014 3300009101 Bacteria 2434
52 Ga0105241_10001600 3300009174 Bacteria 17295
53 Ga0105242_10408228 3300009176 Bacteria 1269
54 Ga0105248_10371742 3300009177 Bacteria 1609
55 Ga0105237_10006491 3300009545 Bacteria 12967
56 Ga0105237_10042685 3300009545 Bacteria 4572
57 Ga0105237_10047103 3300009545 Bacteria 4335
58 Ga0105238_10262208 3300009551 Bacteria 1708
59 Ga0105239_10034089 3300010375 Bacteria 5589
60 Ga0105239_10098867 3300010375 Bacteria 3226
61 Ga0105239_10334719 3300010375 Bacteria 1708
62 Ga0105239_10686511 3300010375 Bacteria 1170
63 Ga0157374_10094761 3300013296 Bacteria 2853
64 Ga0157378_10097047 3300013297 Bacteria 2686
65 Ga0163162_10208408 3300013306 Bacteria 2084
66 Ga0157375_10265475 3300013308 Bacteria 1878
67 Ga0157375_10448419 3300013308 Bacteria 1456
68 Ga0157375_11230799 3300013308 Bacteria 879
69 Ga0157377_10003574 3300014745 Bacteria 7037
70 Ga0157376_10826498 3300014969 Bacteria 940
71 Ga0163161_10048274 3300017792 Bacteria 3074
72 Ga0197907_11132411 3300020069 Bacteria 1269
73 Ga0224712_10001064 3300022467 Bacteria 6037
74 Ga0224712_10002043 3300022467 Bacteria 4897
75 Ga0209646_1000098 3300025246 Bacteria 180711
76 Ga0207688_10002121 3300025901 Bacteria 10656
77 Ga0207647_10004127 3300025904 Bacteria 10781
78 Ga0207699_10016467 3300025906 Bacteria 3869
79 Ga0207705_10442849 3300025909 Bacteria 1007
80 Ga0207654_10117320 3300025911 Bacteria 1666
81 Ga0207695_10002196 3300025913 Bacteria 29403
82 Ga0207695_10036411 3300025913 Bacteria 5320
83 Ga0207695_10604690 3300025913 Bacteria 977
84 Ga0207671_10000115 3300025914 Bacteria 123555
85 Ga0207671_10011904 3300025914 Bacteria 7033
86 Ga0207693_10004862 3300025915 Bacteria 11307
87 Ga0207663_10263256 3300025916 Bacteria 1274
88 Ga0207662_10211113 3300025918 Bacteria 1260
89 Ga0207681_10240898 3300025923 Bacteria 1408
90 Ga0207694_10002169 3300025924 Bacteria 16144
91 Ga0207659_10045731 3300025926 Bacteria 3088
92 Ga0207687_10267781 3300025927 Bacteria 1364
93 Ga0207664_10018187 3300025929 Bacteria 5166
94 Ga0207644_10690652 3300025931 Bacteria 851
95 Ga0207706_10035669 3300025933 Bacteria 4421
96 Ga0207686_10040923 3300025934 Bacteria 2821
97 Ga0207709_10062041 3300025935 Bacteria 2338
98 Ga0207704_10185618 3300025938 Bacteria 1507
99 Ga0207667_10120667 3300025949 Bacteria 2701
100 Ga0207667_10521780 3300025949 Bacteria 1203
101 Ga0207651_10116879 3300025960 Bacteria 2014
102 Ga0207668_10569395 3300025972 Bacteria 983
103 Ga0207658_10079945 3300025986 Bacteria 2503
104 Ga0207677_10136456 3300026023 Bacteria 1871
105 Ga0207703_10048535 3300026035 Bacteria 3428
106 Ga0207639_10091961 3300026041 Bacteria 2430
107 Ga0207702_10393874 3300026078 Bacteria 1334
108 Ga0207676_10192402 3300026095 Bacteria 1796
109 Ga0207698_10682923 3300026142 Bacteria 1020
110 Ga0268266_10049828 3300028379 Bacteria 3592
111 Ga0268266_10111401 3300028379 Bacteria 2425
112 Ga0307511_10237762 3300030521 Bacteria 892
113 Ga0265327_10075538 3300031251 Bacteria 1676
114 Ga0307509_10114720 3300031507 Bacteria 2688
115 Ga0307508_10440523 3300031616 Bacteria 895
116 Ga0307410_10043117 3300031852 Bacteria 2988
117 Ga0307416_100452093 3300032002 Bacteria 1337
118 Ga0307411_10151065 3300032005 Bacteria 1726
119 Ga0307507_10000016 3300033179 Bacteria 225984
120 Ga0307507_10109594 3300033179 Bacteria 2264
121 Ga0373931_0120932 3300035691 Bacteria 1496
122 Ga0395900_0043310 3300037418 Bacteria 4640
123 Ga0439436_0013665 3300041404 Bacteria 2455
124 Ga0439439_0003913 3300041406 Bacteria 3317
125 Ga0439433_0040378 3300041999 Bacteria 1085
126 Ga0439442_016076 3300042002 Bacteria 1542
127 Ga0439449_0015783 3300042007 Bacteria 2839
128 Ga0439449_0048880 3300042007 Bacteria 1565
129 Ga0439457_003701 3300042014 Bacteria 4120
130 Ga0439459_0006750 3300042438 Bacteria 1923
131 Ga0439459_0027683 3300042438 Bacteria 1133
132 Ga0466969_0000919 3300044656 Bacteria 15867
133 Ga0466969_0017455 3300044656 Bacteria 3746
134 Ga0466969_0026049 3300044656 Bacteria 3001
135 Ga0466966_0003702 3300044684 Bacteria 10080
136 Ga0466966_0010304 3300044684 Bacteria 6202
137 Ga0466966_0019307 3300044684 Bacteria 4486
138 Ga0466966_0056583 3300044684 Bacteria 2480
139 Ga0466961_0001456 3300044693 Bacteria 14703
140 Ga0466961_0019725 3300044693 Bacteria 4338
141 Ga0466961_0065294 3300044693 Bacteria 2312
142 Ga0466971_0000389 3300044719 Bacteria 16955
143 Ga0466971_0042360 3300044719 Bacteria 2046
144 Ga0466971_0049010 3300044719 Bacteria 1900
145 Ga0466968_0028042 3300044735 Bacteria 2320
146 Ga0466970_0020679 3300044765 Bacteria 3422
147 Ga0466970_0106102 3300044765 Bacteria 1532
148 Ga0466970_0176825 3300044765 Bacteria 1184
149 Ga0466970_0176996 3300044765 Bacteria 1183
150 Ga0466959_0000894 3300045049 Bacteria 17561
151 Ga0466959_0036879 3300045049 Bacteria 3611
152 Ga0466959_0046569 3300045049 Bacteria 3190
153 Ga0466959_0258605 3300045049 Bacteria 1199
154 Ga0466958_0028529 3300045836 Bacteria 3310
155 Ga0466958_0055168 3300045836 Bacteria 2411
156 Ga0466958_0141841 3300045836 Bacteria 1513
157 Ga0495617_003355 3300046452 Bacteria 6045
158 Ga0495592_0134304 3300046454 Bacteria 1727
159 Ga0495592_0252600 3300046454 Bacteria 1164
160 Ga0495603_0001101 3300046455 Bacteria 15686
161 Ga0495603_0003285 3300046455 Bacteria 9632
162 Ga0495603_0003785 3300046455 Bacteria 9000
163 Ga0495603_0020822 3300046455 Bacteria 3970
164 Ga0495629_0003319 3300046459 Bacteria 12166
165 Ga0495629_0004558 3300046459 Bacteria 10365
166 Ga0495629_0021165 3300046459 Bacteria 4642
167 Ga0495629_0051196 3300046459 Bacteria 2890
168 Ga0495651_0000091 3300046462 Bacteria 66174
169 Ga0495651_0000244 3300046462 Bacteria 42021
170 Ga0495582_0152567 3300046473 Bacteria 1312
171 Ga0495605_0001775 3300046474 Bacteria 13836
172 Ga0495605_0064576 3300046474 Bacteria 1743
173 Ga0495585_0045715 3300046492 Bacteria 2443
174 Ga0495594_0001039 3300046499 Bacteria 14456
175 Ga0495607_0019905 3300046501 Bacteria 4252
176 Ga0495607_0131160 3300046501 Bacteria 1304
177 Ga0495583_0007965 3300046506 Bacteria 6556
178 Ga0495583_0044218 3300046506 Bacteria 2068
179 Ga0495608_0192339 3300046511 Bacteria 1288
180 Ga0495616_0134699 3300046513 Bacteria 1129
181 Ga0495618_0059406 3300046514 Bacteria 2423
182 Ga0495618_0074386 3300046514 Bacteria 2163
183 Ga0495620_0013672 3300046515 Bacteria 4149
184 Ga0495620_0016638 3300046515 Bacteria 3684
185 Ga0495628_0012740 3300046516 Bacteria 7083
186 Ga0495628_0053466 3300046516 Bacteria 3187
187 Ga0495631_0003120 3300046518 Bacteria 9132
188 Ga0495643_0002374 3300046522 Bacteria 15069
189 Ga0495644_0075182 3300046523 Bacteria 1272
190 Ga0495648_0006672 3300046524 Bacteria 9350
191 Ga0495648_0089128 3300046524 Bacteria 1732
192 Ga0495666_0087763 3300046526 Bacteria 1469
193 Ga0495666_0166808 3300046526 Bacteria 1019
194 Ga0495652_0001091 3300046529 Bacteria 30685
195 Ga0495652_0003630 3300046529 Bacteria 15106
196 Ga0495652_0063241 3300046529 Bacteria 3117
197 Ga0495640_0013181 3300046533 Bacteria 6288
198 Ga0495609_0039185 3300046538 Bacteria 2134
199 Ga0495597_0032643 3300046542 Bacteria 2362
200 Ga0495622_0003725 3300046557 Bacteria 7131
201 Ga0495622_0048965 3300046557 Bacteria 1962
202 Ga0495633_0099733 3300046558 Bacteria 1348
203 Ga0495667_0335267 3300046559 Bacteria 956
204 Ga0495668_0008770 3300046616 Bacteria 6271
205 Ga0495668_0028435 3300046616 Bacteria 3161
206 Ga0495634_0309941 3300046642 Bacteria 952
207 Ga0495625_0087301 3300046660 Bacteria 2162
208 Ga0495588_0002018 3300046674 Bacteria 8681
209 Ga0495657_0042286 3300046675 Bacteria 3112
210 Ga0495657_0085567 3300046675 Bacteria 2032
211 Ga0495613_0000730 3300046689 Bacteria 25745
212 Ga0495613_0001500 3300046689 Bacteria 17769
213 Ga0495613_0004680 3300046689 Bacteria 10268
214 Ga0495613_0014190 3300046689 Bacteria 5910
215 Ga0495624_0028776 3300046690 Bacteria 3628
216 Ga0495649_0049236 3300046694 Bacteria 2289
217 Ga0495589_0003033 3300046794 Bacteria 9221
218 Ga0495589_0006663 3300046794 Bacteria 6083
219 Ga0495600_0015012 3300046809 Bacteria 4892
220 Ga0495600_0064925 3300046809 Bacteria 2386
221 Ga0495581_0124650 3300047315 Bacteria 1500
222 Ga0495604_0001076 3300047317 Bacteria 22636
223 Ga0495604_0089733 3300047317 Bacteria 2284
224 Ga0495636_0064387 3300047318 Bacteria 1555
225 Ga0495636_0086683 3300047318 Bacteria 1354
226 Ga0495636_0093569 3300047318 Bacteria 1307
227 Ga0495676_0000975 3300047321 Bacteria 23977
228 Ga0495676_0005320 3300047321 Bacteria 11786
229 Ga0495676_0008973 3300047321 Bacteria 9126
230 Ga0495676_0010923 3300047321 Bacteria 8208
231 Ga0495676_0078205 3300047321 Bacteria 2519
232 Ga0495680_0002408 3300047322 Bacteria 19184
233 Ga0495687_003551 3300047443 Bacteria 11212
234 Ga0495687_014086 3300047443 Bacteria 4135
235 Ga0495687_034788 3300047443 Bacteria 2272
236 Ga0495687_068691 3300047443 Bacteria 1429
237 Ga0495685_000783 3300047447 Bacteria 9728
238 Ga0495685_001359 3300047447 Bacteria 7489
239 Ga0495685_024938 3300047447 Bacteria 2058
240 Ga0495685_033777 3300047447 Bacteria 1757
241 Ga0495686_0009189 3300047472 Bacteria 7154
242 Ga0495593_0105710 3300047673 Bacteria 1440
243 Ga0495614_0006773 3300048089 Bacteria 5126
244 Ga0495626_0009274 3300048091 Bacteria 5325
245 Ga0496100_0001987 3300048903 Bacteria 10248
246 Ga0496100_0078509 3300048903 Bacteria 2222
247 Ga0496101_0000002 3300048904 Bacteria 410971
248 Ga0496102_0000009 3300048905 Bacteria 344149
249 Ga0496103_0000051 3300048906 Bacteria 150397
250 Ga0496103_0072146 3300048906 Bacteria 2162
251 Ga0496104_0067551 3300048907 Bacteria 3396
252 Ga0496105_0013849 3300048908 Bacteria 6406
253 Ga0496105_0310186 3300048908 Bacteria 1267
254 Ga0496106_0006046 3300048909 Bacteria 8957
255 Ga0496106_0344106 3300048909 Bacteria 1197
256 Ga0496107_0023352 3300048910 Bacteria 4373
257 Ga0496107_0056160 3300048910 Bacteria 2844
258 Ga0496109_0022487 3300048912 Bacteria 5586
259 Ga0496109_0032990 3300048912 Bacteria 4658
260 Ga0496110_0023837 3300048913 Bacteria 5209
261 Ga0496111_0148122 3300048914 Bacteria 1741
262 Ga0496111_0300361 3300048914 Bacteria 1190
263 Ga0496111_0409541 3300048914 Bacteria 1002
264 Ga0496112_0005768 3300048915 Bacteria 10770
265 Ga0496113_0484701 3300048916 Bacteria 993
266 Ga0496114_0118179 3300048917 Bacteria 2278
267 Ga0496115_0109856 3300048918 Bacteria 2265
268 Ga0496116_0000141 3300048919 Bacteria 150405
269 Ga0496117_0000019 3300048920 Bacteria 469256
270 Ga0496118_0000020 3300048921 Bacteria 470521
271 Ga0496119_0030227 3300048922 Bacteria 3657
272 Ga0496119_0030534 3300048922 Bacteria 3630
273 Ga0496120_0031975 3300048923 Bacteria 3178
274 Ga0496121_0002884 3300048924 Bacteria 25319
275 Ga0496126_0010823 3300048929 Bacteria 9512
276 Ga0496126_0155192 3300048929 Bacteria 1960
277 Ga0495678_035656 3300049459 Bacteria 2037
278 Ga0501031_0003900 3300049568 Bacteria 9597
279 Ga0501031_0075454 3300049568 Bacteria 2195
280 Ga0501031_0312222 3300049568 Bacteria 1019
281 Ga0501032_0001163 3300049569 Bacteria 21103
282 Ga0501033_0003310 3300049570 Bacteria 13307
283 Ga0501033_0367967 3300049570 Bacteria 1005
284 Ga0501034_0109030 3300049571 Bacteria 2759
285 Ga0501034_0162628 3300049571 Bacteria 2202
286 Ga0501036_0024978 3300049572 Bacteria 5039
287 Ga0501036_0038282 3300049572 Bacteria 4059
288 Ga0501036_0059036 3300049572 Bacteria 3250
289 Ga0501037_0006851 3300049573 Bacteria 8324
290 Ga0501037_0289645 3300049573 Bacteria 1139
291 Ga0501038_0007844 3300049574 Bacteria 9838
292 Ga0501038_0073225 3300049574 Bacteria 2901
293 Ga0501039_0002928 3300049575 Bacteria 12774
294 Ga0501039_0083583 3300049575 Bacteria 2486
295 Ga0501043_0000335 3300049579 Bacteria 42702
296 Ga0501043_0095338 3300049579 Bacteria 2338
297 Ga0501043_0302887 3300049579 Bacteria 1221
298 Ga0501043_0375839 3300049579 Bacteria 1076
299 Ga0501046_0008283 3300049580 Bacteria 9076
300 Ga0501047_0013884 3300049581 Bacteria 7649
301 Ga0501047_0134193 3300049581 Bacteria 2356
302 Ga0501047_0426977 3300049581 Bacteria 1156
303 Ga0501048_0104538 3300049582 Bacteria 1998
304 Ga0501069_0240468 3300049585 Bacteria 1055
305 Ga0501070_0002341 3300049586 Bacteria 16632
306 Ga0501074_0038274 3300049590 Bacteria 3476
307 Ga0501035_0001747 3300049822 Bacteria 21950
308 Ga0501035_0008583 3300049822 Bacteria 9510
309 Ga0501044_0005693 3300049823 Bacteria 13811
310 Ga0501044_0208514 3300049823 Bacteria 1909
311 Ga0501044_0222991 3300049823 Bacteria 1835
312 Ga0501044_0386475 3300049823 Bacteria 1314
313 Ga0501045_0227332 3300049824 Bacteria 1389
314 nmdc:mga0qj67_25580_c1 3300050509 Bacteria 4561
315 nmdc:mga06r32_303806_c1 3300050510 Bacteria 1581
316 nmdc:mga0sz30_1090_c1 3300050516 Bacteria 9763
317 Ga0495601_0011851 3300053077 Bacteria 5226
318 Ga0495612_0124997 3300053078 Bacteria 1108
319 Ga0495619_0096231 3300053085 Bacteria 2010
320 Ga0501084_0062975 3300054114 Bacteria 3105
321 Ga0466962_0000118 3300061719 Bacteria 32198
322 Ga0466962_0003848 3300061719 Bacteria 7172
323 Ga0466962_0005172 3300061719 Bacteria 6279
324 Ga0466962_0021267 3300061719 Bacteria 3117
325 Ga0466962_0204241 3300061719 Bacteria 966
326 2616698019 2616644814 Bacteria 11555299
327 2676491123 2675903060 Bacteria 10051191
328 2747954874 2747842429 Bacteria 3914386
329 2760304200 2758568522 Bacteria 5953541
330 2809227650 2808606447 Bacteria 3572005
331 2809235485 2808606448 Bacteria 8656184
332 2811846299 2808606982 Bacteria 7791042
333 2852634415 2852632344 Bacteria 3463163
334 2868092391 2868088558 Bacteria 7609351
335 2884698009 2884693830 Bacteria 11273186
336 2895445069 2895442618 Bacteria 11027144
337 2902794172 2902792274 Bacteria 7270173
338 2902803641 2902799365 Bacteria 5419524
339 2919396311 2919395869 Bacteria 3704152
340 2939586889 2939582691 Bacteria 7088898
341 2947225511 2947224130 Bacteria 9938529
342 3006324431 3006321560 Bacteria 8247479
343 3006501755 3006493962 Bacteria 8825450
344 8004185427 8004182704 Bacteria 3391155
345 8004213860 8004212874 Bacteria 2861420
346 8023624141 8023623736 Bacteria 8593882
347 Ga0466963_0149599
348 JGI24746J21847_1003809
349 JGI24737J22298_10029557
350 JGI24743J22301_10016769
351 Ga0006562J51391_1246357
352 Ga0006562J51391_1246358
353 Ga0070658_10402354
354 Ga0068869_100005633
355 Ga0070682_100040606
356 Ga0068868_100086962
357 Ga0070691_10278339
358 Ga0070668_100146932
359 Ga0070675_100110221
360 Ga0070674_100377378
361 Ga0070673_100049859
362 Ga0070688_100004616
363 Ga0070667_100613865
364 Ga0070709_10213835
365 Ga0070714_100013882
366 Ga0070710_10004550
367 Ga0070711_100094241
368 Ga0070705_100034093
369 Ga0070694_100056978
370 Ga0068867_100191661
371 Ga0068853_100025710
372 Ga0070696_100116705
373 Ga0070665_100005218
374 Ga0070665_100201961
375 Ga0070704_100005863
376 Ga0068855_100001319
377 Ga0068855_100303133
378 Ga0068854_100048417
379 Ga0068856_100014159
380 Ga0068859_100474412
381 Ga0068864_100162946
382 Ga0068864_100237127
383 Ga0068866_10115473
384 Ga0068861_100235892
385 Ga0068851_10351297
386 Ga0068863_100385915
387 Ga0068862_100128636
388 Ga0070715_10070201
389 Ga0070716_100001673
390 Ga0075369_10000628
391 Ga0075430_100099695
392 Ga0075431_100103792
393 Ga0097620_100474404
394 Ga0105240_10008504
395 Ga0105245_10210160
396 Ga0105247_10053335
397 Ga0105247_10056014
398 Ga0105241_10001600
399 Ga0105242_10408228
400 Ga0105248_10371742
401 Ga0105237_10006491
402 Ga0105237_10042685
403 Ga0105237_10047103
404 Ga0105238_10262208
405 Ga0105239_10034089
406 Ga0105239_10098867
407 Ga0105239_10334719
408 Ga0105239_10686511
409 Ga0157374_10094761
410 Ga0157378_10097047
411 Ga0163162_10208408
412 Ga0157375_10265475
413 Ga0157375_10448419
414 Ga0157375_11230799
415 Ga0157377_10003574
416 Ga0157376_10826498
417 Ga0163161_10048274
418 Ga0197907_11132411
419 Ga0224712_10001064
420 Ga0224712_10002043
421 Ga0209646_1000098
422 Ga0207688_10002121
423 Ga0207647_10004127
424 Ga0207699_10016467
425 Ga0207705_10442849
426 Ga0207654_10117320
427 Ga0207695_10002196
428 Ga0207695_10036411
429 Ga0207695_10604690
430 Ga0207671_10000115
431 Ga0207671_10011904
432 Ga0207693_10004862
433 Ga0207663_10263256
434 Ga0207662_10211113
435 Ga0207681_10240898
436 Ga0207694_10002169
437 Ga0207659_10045731
438 Ga0207687_10267781
439 Ga0207664_10018187
440 Ga0207644_10690652
441 Ga0207706_10035669
442 Ga0207686_10040923
443 Ga0207709_10062041
444 Ga0207704_10185618
445 Ga0207667_10120667
446 Ga0207667_10521780
447 Ga0207651_10116879
448 Ga0207668_10569395
449 Ga0207658_10079945
450 Ga0207677_10136456
451 Ga0207703_10048535
452 Ga0207639_10091961
453 Ga0207702_10393874
454 Ga0207676_10192402
455 Ga0207698_10682923
456 Ga0268266_10049828
457 Ga0268266_10111401
458 Ga0307511_10237762
459 Ga0265327_10075538
460 Ga0307509_10114720
461 Ga0307508_10440523
462 Ga0307410_10043117
463 Ga0307416_100452093
464 Ga0307411_10151065
465 Ga0307507_10000016
466 Ga0307507_10109594
467 Ga0373931_0120932
468 Ga0395900_0043310
469 Ga0439436_0013665
470 Ga0439439_0003913
471 Ga0439433_0040378
472 Ga0439442_016076
473 Ga0439449_0015783
474 Ga0439449_0048880
475 Ga0439457_003701
476 Ga0439459_0006750
477 Ga0439459_0027683
478 Ga0466969_0000919
479 Ga0466969_0017455
480 Ga0466969_0026049
481 Ga0466966_0003702
482 Ga0466966_0010304
483 Ga0466966_0019307
484 Ga0466966_0056583
485 Ga0466961_0001456
486 Ga0466961_0019725
487 Ga0466961_0065294
488 Ga0466971_0000389
489 Ga0466971_0042360
490 Ga0466971_0049010
491 Ga0466968_0028042
492 Ga0466970_0020679
493 Ga0466970_0106102
494 Ga0466970_0176825
495 Ga0466970_0176996
496 Ga0466959_0000894
497 Ga0466959_0036879
498 Ga0466959_0046569
499 Ga0466959_0258605
500 Ga0466958_0028529
501 Ga0466958_0055168
502 Ga0466958_0141841
503 Ga0495617_003355
504 Ga0495592_0134304
505 Ga0495592_0252600
506 Ga0495603_0001101
507 Ga0495603_0003285
508 Ga0495603_0003785
509 Ga0495603_0020822
510 Ga0495629_0003319
511 Ga0495629_0004558
512 Ga0495629_0021165
513 Ga0495629_0051196
514 Ga0495651_0000091
515 Ga0495651_0000244
516 Ga0495582_0152567
517 Ga0495605_0001775
518 Ga0495605_0064576
519 Ga0495585_0045715
520 Ga0495594_0001039
521 Ga0495607_0019905
522 Ga0495607_0131160
523 Ga0495583_0007965
524 Ga0495583_0044218
525 Ga0495608_0192339
526 Ga0495616_0134699
527 Ga0495618_0059406
528 Ga0495618_0074386
529 Ga0495620_0013672
530 Ga0495620_0016638
531 Ga0495628_0012740
532 Ga0495628_0053466
533 Ga0495631_0003120
534 Ga0495643_0002374
535 Ga0495644_0075182
536 Ga0495648_0006672
537 Ga0495648_0089128
538 Ga0495666_0087763
539 Ga0495666_0166808
540 Ga0495652_0001091
541 Ga0495652_0003630
542 Ga0495652_0063241
543 Ga0495640_0013181
544 Ga0495609_0039185
545 Ga0495597_0032643
546 Ga0495622_0003725
547 Ga0495622_0048965
548 Ga0495633_0099733
549 Ga0495667_0335267
550 Ga0495668_0008770
551 Ga0495668_0028435
552 Ga0495634_0309941
553 Ga0495625_0087301
554 Ga0495588_0002018
555 Ga0495657_0042286
556 Ga0495657_0085567
557 Ga0495613_0000730
558 Ga0495613_0001500
559 Ga0495613_0004680
560 Ga0495613_0014190
561 Ga0495624_0028776
562 Ga0495649_0049236
563 Ga0495589_0003033
564 Ga0495589_0006663
565 Ga0495600_0015012
566 Ga0495600_0064925
567 Ga0495581_0124650
568 Ga0495604_0001076
569 Ga0495604_0089733
570 Ga0495636_0064387
571 Ga0495636_0086683
572 Ga0495636_0093569
573 Ga0495676_0000975
574 Ga0495676_0005320
575 Ga0495676_0008973
576 Ga0495676_0010923
577 Ga0495676_0078205
578 Ga0495680_0002408
579 Ga0495687_003551
580 Ga0495687_014086
581 Ga0495687_034788
582 Ga0495687_068691
583 Ga0495685_000783
584 Ga0495685_001359
585 Ga0495685_024938
586 Ga0495685_033777
587 Ga0495686_0009189
588 Ga0495593_0105710
589 Ga0495614_0006773
590 Ga0495626_0009274
591 Ga0496100_0001987
592 Ga0496100_0078509
593 Ga0496101_0000002
594 Ga0496102_0000009
595 Ga0496103_0000051
596 Ga0496103_0072146
597 Ga0496104_0067551
598 Ga0496105_0013849
599 Ga0496105_0310186
600 Ga0496106_0006046
601 Ga0496106_0344106
602 Ga0496107_0023352
603 Ga0496107_0056160
604 Ga0496109_0022487
605 Ga0496109_0032990
606 Ga0496110_0023837
607 Ga0496111_0148122
608 Ga0496111_0300361
609 Ga0496111_0409541
610 Ga0496112_0005768
611 Ga0496113_0484701
612 Ga0496114_0118179
613 Ga0496115_0109856
614 Ga0496116_0000141
615 Ga0496117_0000019
616 Ga0496118_0000020
617 Ga0496119_0030227
618 Ga0496119_0030534
619 Ga0496120_0031975
620 Ga0496121_0002884
621 Ga0496126_0010823
622 Ga0496126_0155192
623 Ga0495678_035656
624 Ga0501031_0003900
625 Ga0501031_0075454
626 Ga0501031_0312222
627 Ga0501032_0001163
628 Ga0501033_0003310
629 Ga0501033_0367967
630 Ga0501034_0109030
631 Ga0501034_0162628
632 Ga0501036_0024978
633 Ga0501036_0038282
634 Ga0501036_0059036
635 Ga0501037_0006851
636 Ga0501037_0289645
637 Ga0501038_0007844
638 Ga0501038_0073225
639 Ga0501039_0002928
640 Ga0501039_0083583
641 Ga0501043_0000335
642 Ga0501043_0095338
643 Ga0501043_0302887
644 Ga0501043_0375839
645 Ga0501046_0008283
646 Ga0501047_0013884
647 Ga0501047_0134193
648 Ga0501047_0426977
649 Ga0501048_0104538
650 Ga0501069_0240468
651 Ga0501070_0002341
652 Ga0501074_0038274
653 Ga0501035_0001747
654 Ga0501035_0008583
655 Ga0501044_0005693
656 Ga0501044_0208514
657 Ga0501044_0222991
658 Ga0501044_0386475
659 Ga0501045_0227332
660 nmdc:mga0qj67_25580_c1
661 nmdc:mga06r32_303806_c1
662 nmdc:mga0sz30_1090_c1
663 Ga0495601_0011851
664 Ga0495612_0124997
665 Ga0495619_0096231
666 Ga0501084_0062975
667 Ga0466962_0000118
668 Ga0466962_0003848
669 Ga0466962_0005172
670 Ga0466962_0021267
671 Ga0466962_0204241
672 2616698019
673 2676491123
674 2747954874
675 2760304200
676 2809227650
677 2809235485
678 2811846299
679 2852634415
680 2868092391
681 2884698009
682 2895445069
683 2902794172
684 2902803641
685 2919396311
686 2939586889
687 2947225511
688 3006324431
689 3006501755
690 8004185427
691 8004213860
692 8023624141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

5

234

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dlx-assembly1.cif.gz_A crystal structure of human 3-oxoacid coa transferase 1 0.9762 5 235
1ooy-assembly1.cif.gz_B succinyl-coa:3-ketoacid coa transferase from pig heart 0.9754 5 235
2nrc-assembly3.cif.gz_D c28a mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9752 5 235
3dlx-assembly2.cif.gz_C crystal structure of human 3-oxoacid coa transferase 1 0.9751 5 237
2nrc-assembly3.cif.gz_B c28a mutant of succinyl-coa:3-ketoacid coa transferase from pig heart 0.9749 5 236
ID Description Score Start End Superfamily
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9741 5 236 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9659 5 236 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9636 4 234 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9612 2 238 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9463 4 234 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A2G5UUV4-F1-model_v4 Uncharacterized protein 0.9821 5 115 GO:0005739
GO:0008260
GO:0046950
AF-A0A1X0BVI3-F1-model_v4 deleted 0.9809 3 236
AF-A0A2U3P921-F1-model_v4 Succinyl-CoA--3-ketoacid-CoA transferase 0.98 63 236 GO:0008410
AF-A0A0N4VK64-F1-model_v4 3-oxoacid CoA-transferase 0.9795 5 105 GO:0005739
GO:0008260
GO:0046950
AF-A0A4R2D7R2-F1-model_v4 3-oxoacid CoA-transferase A subunit 0.9793 3 127 GO:0008260
GO:0046950

Map