F416807

General Info

Members Datasets Scaffolds Average Seq Length
346 200 692 166

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_101416490|Ga0307408_1014164901
Length 193
Sequence VAVVTDPADLLRRHGIQVTAQRLAVLRAVSSEPHVTADAVADAVRAEIGAISLQSVYDALSVLVTEGLIRRIQPAGSPARFEDRVGDNHHHLICRVCGSVVDVDCAVGKAPCLTAHDDNGYQIDEAEVAYWGRCPDCQGKSKTRSSMRQKVRQVRLKPDTTTADATTARRSGPPARDQRPKPRDRKKRISRTK

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
125 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
126 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
192 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
195 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
198 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 2.02
Rhizosphere 95.95
Stem 0
Stem Tuber 0
Unclassified 8.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_101416490 3300031548 Bacteria 655
2 Ga0065712_10015508 3300005290 Bacteria 1497
3 Ga0065712_10067776 3300005290 Bacteria 42236
4 Ga0065715_10097607 3300005293 Bacteria 3678
5 Ga0065707_10000759 3300005295 Bacteria 21072
6 Ga0065707_10040473 3300005295 Bacteria 1084
7 Ga0065707_10504966 3300005295 Unclassified 754
8 Ga0070676_10015730 3300005328 Bacteria 4174
9 Ga0070676_10801436 3300005328 Unclassified 695
10 Ga0070670_100386099 3300005331 Bacteria 1234
11 Ga0070677_10345047 3300005333 Bacteria 770
12 Ga0068869_100119975 3300005334 Bacteria 2010
13 Ga0068869_100417299 3300005334 Bacteria 1107
14 Ga0070666_10008761 3300005335 Bacteria 6289
15 Ga0068868_100296609 3300005338 Unclassified 1372
16 Ga0070689_100219403 3300005340 Bacteria 1559
17 Ga0070689_100382629 3300005340 Unclassified 1186
18 Ga0070668_100508725 3300005347 Bacteria 1043
19 Ga0070668_101198563 3300005347 Bacteria 688
20 Ga0070668_101292253 3300005347 Bacteria 663
21 Ga0070669_100143727 3300005353 Bacteria 1841
22 Ga0070669_100232814 3300005353 Bacteria 1461
23 Ga0070669_100242674 3300005353 Bacteria 1432
24 Ga0070669_100808943 3300005353 Bacteria 797
25 Ga0070669_100829348 3300005353 Bacteria 787
26 Ga0070675_100019152 3300005354 Bacteria 5453
27 Ga0070675_100058840 3300005354 Unclassified 3170
28 Ga0070675_100069282 3300005354 Bacteria 2922
29 Ga0070671_100446141 3300005355 Bacteria 1110
30 Ga0070674_100025989 3300005356 Bacteria 3819
31 Ga0070674_100487256 3300005356 Bacteria 1024
32 Ga0070674_101300828 3300005356 Bacteria 648
33 Ga0070673_100001897 3300005364 Bacteria 12540
34 Ga0070688_100044524 3300005365 Bacteria 2739
35 Ga0070659_100276663 3300005366 Bacteria 1396
36 Ga0070667_100737078 3300005367 Unclassified 913
37 Ga0070700_100222567 3300005441 Bacteria 1338
38 Ga0070700_100324758 3300005441 Bacteria 1132
39 Ga0070700_100436882 3300005441 Bacteria 993
40 Ga0070694_100233756 3300005444 Bacteria 1384
41 Ga0070678_100145686 3300005456 Bacteria 1901
42 Ga0070678_100492952 3300005456 Bacteria 1080
43 Ga0070662_100238618 3300005457 Bacteria 1457
44 Ga0070662_100988766 3300005457 Bacteria 720
45 Ga0070681_10629799 3300005458 Bacteria 987
46 Ga0068867_100102518 3300005459 Bacteria 2187
47 Ga0068867_100779271 3300005459 Bacteria 851
48 Ga0070685_10598656 3300005466 Bacteria 793
49 Ga0070698_100088624 3300005471 Bacteria 3079
50 Ga0070672_100117640 3300005543 Bacteria 2173
51 Ga0070695_100534886 3300005545 Unclassified 911
52 Ga0070704_100209170 3300005549 Bacteria 1580
53 Ga0070664_100174876 3300005564 Bacteria 1906
54 Ga0068859_100262450 3300005617 Bacteria 1819
55 Ga0068859_100570194 3300005617 Bacteria 1226
56 Ga0068866_10278015 3300005718 Bacteria 1036
57 Ga0068866_10381593 3300005718 Bacteria 904
58 Ga0068861_100129937 3300005719 Bacteria 2043
59 Ga0068861_100279576 3300005719 Bacteria 1437
60 Ga0068870_10018948 3300005840 Bacteria 3332
61 Ga0068870_10076348 3300005840 Bacteria 1840
62 Ga0068870_10181069 3300005840 Bacteria 1265
63 Ga0068858_100332288 3300005842 Bacteria 1454
64 Ga0068858_100358818 3300005842 Bacteria 1397
65 Ga0068860_101087312 3300005843 Bacteria 819
66 Ga0068862_100005556 3300005844 Bacteria 10533
67 Ga0068862_100073945 3300005844 Bacteria 2945
68 Ga0068862_100192008 3300005844 Bacteria 1838
69 Ga0068862_100327980 3300005844 Bacteria 1415
70 Ga0068862_100483322 3300005844 Bacteria 1173
71 Ga0068862_100630585 3300005844 Bacteria 1032
72 Ga0081539_10000017 3300005985 Bacteria 375107
73 Ga0075368_10050779 3300006042 Bacteria 1648
74 Ga0075364_10045958 3300006051 Bacteria 2842
75 Ga0075432_10194318 3300006058 Bacteria 800
76 Ga0075367_10303917 3300006178 Bacteria 1004
77 Ga0075369_10116488 3300006186 Bacteria 1207
78 Ga0097621_100403254 3300006237 Bacteria 1224
79 Ga0097621_100975124 3300006237 Bacteria 792
80 Ga0068871_100019035 3300006358 Bacteria 5234
81 Ga0075428_100007864 3300006844 Bacteria 11823
82 Ga0075428_100173670 3300006844 Bacteria 2335
83 Ga0075428_100259519 3300006844 Bacteria 1871
84 Ga0075428_100899033 3300006844 Bacteria 939
85 Ga0075430_100012145 3300006846 Bacteria 7331
86 Ga0075430_100109004 3300006846 Bacteria 2310
87 Ga0075431_100015851 3300006847 Bacteria 7642
88 Ga0075431_100132423 3300006847 Bacteria 2571
89 Ga0075431_100140199 3300006847 Bacteria 2492
90 Ga0075431_101028027 3300006847 Bacteria 790
91 Ga0075433_10022169 3300006852 Bacteria 5331
92 Ga0075433_10025406 3300006852 Bacteria 5007
93 Ga0075434_100010150 3300006871 Bacteria 8821
94 Ga0075434_100015321 3300006871 Bacteria 7348
95 Ga0075429_100006962 3300006880 Bacteria 9825
96 Ga0075429_100224733 3300006880 Bacteria 1644
97 Ga0075429_100262906 3300006880 Bacteria 1511
98 Ga0075429_100705214 3300006880 Bacteria 884
99 Ga0097620_100262448 3300006931 Bacteria 1819
100 Ga0097620_100570138 3300006931 Bacteria 1226
101 Ga0075435_100003860 3300007076 Bacteria 10222
102 Ga0075435_100915387 3300007076 Unclassified 765
103 Ga0111539_10109398 3300009094 Bacteria 3243
104 Ga0111539_10127824 3300009094 Bacteria 2976
105 Ga0111539_10167889 3300009094 Bacteria 2564
106 Ga0111539_11124780 3300009094 Bacteria 913
107 Ga0111539_11133309 3300009094 Bacteria 909
108 Ga0105245_10844678 3300009098 Bacteria 955
109 Ga0114129_10512191 3300009147 Bacteria 1565
110 Ga0114129_10577180 3300009147 Bacteria 1459
111 Ga0114129_10638450 3300009147 Bacteria 1375
112 Ga0105243_10143938 3300009148 Bacteria 2037
113 Ga0105243_10792862 3300009148 Bacteria 933
114 Ga0105243_10802176 3300009148 Unclassified 928
115 Ga0105242_10281923 3300009176 Bacteria 1510
116 Ga0105248_10095107 3300009177 Bacteria 3354
117 Ga0105248_10470840 3300009177 Bacteria 1416
118 Ga0105248_11194206 3300009177 Bacteria 860
119 Ga0105249_10262303 3300009553 Bacteria 1717
120 Ga0105249_10324461 3300009553 Bacteria 1552
121 Ga0105249_12820542 3300009553 Bacteria 557
122 Ga0157374_10145590 3300013296 Bacteria 2301
123 Ga0157378_10086772 3300013297 Bacteria 2837
124 Ga0157378_10600835 3300013297 Bacteria 1111
125 Ga0157375_10456356 3300013308 Bacteria 1443
126 Ga0157375_11048866 3300013308 Bacteria 953
127 Ga0163163_10215089 3300014325 Bacteria 1971
128 Ga0163163_11185269 3300014325 Unclassified 826
129 Ga0157380_10049323 3300014326 Bacteria 3320
130 Ga0157380_10093043 3300014326 Bacteria 2493
131 Ga0157380_10208727 3300014326 Bacteria 1739
132 Ga0157380_10238428 3300014326 Bacteria 1638
133 Ga0157377_10003866 3300014745 Bacteria 6820
134 Ga0157377_10430696 3300014745 Bacteria 906
135 Ga0157379_10108940 3300014968 Bacteria 2488
136 Ga0157376_10129623 3300014969 Bacteria 2248
137 Ga0157376_10285070 3300014969 Bacteria 1557
138 Ga0163161_10882769 3300017792 Bacteria 756
139 Ga0207682_10045988 3300025893 Bacteria 1793
140 Ga0207642_10287488 3300025899 Bacteria 948
141 Ga0207680_10010441 3300025903 Bacteria 4644
142 Ga0207680_10213795 3300025903 Bacteria 1319
143 Ga0207643_10001015 3300025908 Bacteria 16714
144 Ga0207643_10028031 3300025908 Bacteria 3125
145 Ga0207643_10085170 3300025908 Bacteria 1835
146 Ga0207684_10201707 3300025910 Bacteria 1716
147 Ga0207649_10420140 3300025920 Bacteria 1004
148 Ga0207681_10054353 3300025923 Bacteria 2722
149 Ga0207681_10111263 3300025923 Bacteria 1993
150 Ga0207681_10426570 3300025923 Bacteria 1075
151 Ga0207650_10098817 3300025925 Bacteria 2243
152 Ga0207659_10112772 3300025926 Bacteria 2070
153 Ga0207659_10141819 3300025926 Bacteria 1866
154 Ga0207659_10341598 3300025926 Unclassified 1240
155 Ga0207659_10634228 3300025926 Bacteria 912
156 Ga0207644_10176565 3300025931 Bacteria 1671
157 Ga0207644_10586128 3300025931 Bacteria 925
158 Ga0207706_10404135 3300025933 Bacteria 1184
159 Ga0207706_11029326 3300025933 Bacteria 691
160 Ga0207709_10549982 3300025935 Bacteria 908
161 Ga0207669_10229026 3300025937 Bacteria 1370
162 Ga0207669_10350526 3300025937 Bacteria 1140
163 Ga0207669_11062354 3300025937 Bacteria 682
164 Ga0207704_10272975 3300025938 Bacteria 1281
165 Ga0207691_10057823 3300025940 Bacteria 3528
166 Ga0207691_10126142 3300025940 Bacteria 2264
167 Ga0207691_10205555 3300025940 Bacteria 1713
168 Ga0207691_10563690 3300025940 Bacteria 965
169 Ga0207711_10131424 3300025941 Bacteria 2245
170 Ga0207711_10209955 3300025941 Bacteria 1778
171 Ga0207689_10048692 3300025942 Bacteria 3497
172 Ga0207661_10288345 3300025944 Unclassified 1469
173 Ga0207679_10070934 3300025945 Bacteria 2627
174 Ga0207651_10021887 3300025960 Bacteria 3895
175 Ga0207651_10547016 3300025960 Unclassified 1006
176 Ga0207712_10053914 3300025961 Bacteria 2823
177 Ga0207668_10222314 3300025972 Bacteria 1517
178 Ga0207668_10313131 3300025972 Bacteria 1300
179 Ga0207668_11195908 3300025972 Bacteria 683
180 Ga0207668_11630315 3300025972 Bacteria 582
181 Ga0207708_10042804 3300026075 Bacteria 3451
182 Ga0207708_10282884 3300026075 Bacteria 1344
183 Ga0207708_10874448 3300026075 Bacteria 777
184 Ga0207641_10050221 3300026088 Bacteria 3528
185 Ga0207648_10147453 3300026089 Bacteria 2076
186 Ga0207648_10441465 3300026089 Bacteria 1184
187 Ga0207674_10187022 3300026116 Unclassified 2021
188 Ga0207674_10497041 3300026116 Bacteria 1178
189 Ga0207675_101271979 3300026118 Bacteria 756
190 Ga0207683_10046201 3300026121 Bacteria 3810
191 Ga0207683_10269323 3300026121 Bacteria 1556
192 Ga0209813_10095891 3300027866 Bacteria 1003
193 Ga0207428_10007180 3300027907 Bacteria 10186
194 Ga0207428_10058005 3300027907 Bacteria 3073
195 Ga0207428_10542961 3300027907 Unclassified 841
196 Ga0268265_10108488 3300028380 Bacteria 2260
197 Ga0268265_10125094 3300028380 Bacteria 2126
198 Ga0268265_10416644 3300028380 Bacteria 1246
199 Ga0268265_10631592 3300028380 Bacteria 1027
200 Ga0268264_10405620 3300028381 Bacteria 1311
201 Ga0307405_10371864 3300031731 Bacteria 1110
202 Ga0307406_10149505 3300031901 Unclassified 1664
203 Ga0307407_10011327 3300031903 Bacteria 4241
204 Ga0307412_10297438 3300031911 Bacteria 1274
205 Ga0307409_100262326 3300031995 Bacteria 1586
206 Ga0373932_0022831 3300035112 Bacteria 1666
207 Ga0373945_0126237 3300035116 Bacteria 1021
208 Ga0373954_0033372 3300035118 Bacteria 2382
209 Ga0373956_0001082 3300035119 Bacteria 11199
210 Ga0373956_0270006 3300035119 Unclassified 809
211 Ga0373956_0308441 3300035119 Bacteria 754
212 Ga0373957_0102750 3300035120 Bacteria 1145
213 Ga0373955_0059434 3300035172 Bacteria 2105
214 Ga0373931_0151317 3300035691 Bacteria 1353
215 Ga0373933_0001804 3300035724 Bacteria 12411
216 Ga0373933_0682720 3300035724 Unclassified 675
217 Ga0373937_0000685 3300036401 Bacteria 29468
218 Ga0373937_0537186 3300036401 Bacteria 1111
219 Ga0373925_0925027 3300037068 Unclassified 718
220 Ga0451807_2648505 3300041486 Bacteria 1171
221 Ga0450923_113121 3300042125 Bacteria 635
222 Ga0439446_0037739 3300042156 Unclassified 1415
223 Ga0439446_0107134 3300042156 Bacteria 889
224 Ga0450908_001246 3300042184 Bacteria 4930
225 Ga0439435_0041763 3300042436 Unclassified 1286
226 Ga0439435_0076448 3300042436 Bacteria 999
227 Ga0450918_005284 3300042531 Bacteria 2327
228 Ga0466959_0391594 3300045049 Bacteria 945
229 Ga0466958_0355761 3300045836 Bacteria 943
230 Ga0495592_0021567 3300046454 Bacteria 4900
231 Ga0495603_0293379 3300046455 Bacteria 934
232 Ga0495629_0595461 3300046459 Unclassified 740
233 Ga0495651_0225861 3300046462 Bacteria 1293
234 Ga0495653_0334945 3300046463 Bacteria 977
235 Ga0495580_0295115 3300046472 Bacteria 1104
236 Ga0495582_0105353 3300046473 Bacteria 1581
237 Ga0495608_0039894 3300046511 Bacteria 3146
238 Ga0495618_0341540 3300046514 Bacteria 924
239 Ga0495628_0018338 3300046516 Bacteria 5799
240 Ga0495630_0024023 3300046517 Bacteria 4507
241 Ga0495640_0349522 3300046533 Bacteria 913
242 Ga0495586_0138149 3300046535 Unclassified 1367
243 Ga0495645_0266368 3300046543 Unclassified 1132
244 Ga0495659_0016212 3300046664 Bacteria 2456
245 Ga0495658_0014930 3300046683 Bacteria 3979
246 Ga0495613_0001316 3300046689 Bacteria 18966
247 Ga0495649_0576486 3300046694 Unclassified 556
248 Ga0495674_0142853 3300047319 Bacteria 2011
249 Ga0495680_0132656 3300047322 Unclassified 1829
250 Ga0495680_0383321 3300047322 Bacteria 973
251 Ga0495675_0219059 3300047444 Bacteria 1153
252 Ga0495684_0002593 3300047471 Bacteria 14368
253 Ga0496104_0551806 3300048907 Bacteria 1063
254 Ga0496106_0125528 3300048909 Bacteria 2009
255 Ga0496108_0353768 3300048911 Bacteria 1282
256 Ga0496109_0668880 3300048912 Bacteria 976
257 Ga0496110_0019125 3300048913 Bacteria 5757
258 Ga0496111_0346150 3300048914 Bacteria 1100
259 Ga0501031_0638849 3300049568 Bacteria 684
260 Ga0501031_0818344 3300049568 Bacteria 597
261 Ga0501034_0056685 3300049571 Bacteria 3941
262 Ga0501036_0035863 3300049572 Bacteria 4197
263 Ga0501038_0553443 3300049574 Bacteria 875
264 Ga0501039_0051047 3300049575 Bacteria 3201
265 Ga0501039_0054353 3300049575 Bacteria 3099
266 Ga0501039_0055591 3300049575 Bacteria 3066
267 Ga0501040_0032433 3300049576 Bacteria 3534
268 Ga0501040_0040710 3300049576 Bacteria 3162
269 Ga0501041_0116864 3300049577 Bacteria 1656
270 Ga0501041_0136464 3300049577 Bacteria 1529
271 Ga0501042_0042594 3300049578 Bacteria 3232
272 Ga0501042_0069252 3300049578 Bacteria 2523
273 Ga0501043_0049379 3300049579 Bacteria 3308
274 Ga0501043_0091474 3300049579 Bacteria 2392
275 Ga0501043_0948543 3300049579 Bacteria 615
276 Ga0501046_0018645 3300049580 Bacteria 5768
277 Ga0501046_0217026 3300049580 Bacteria 1418
278 Ga0501047_0001056 3300049581 Bacteria 27470
279 Ga0501047_0254790 3300049581 Bacteria 1603
280 Ga0501048_0011513 3300049582 Bacteria 6597
281 Ga0501048_0186680 3300049582 Bacteria 1469
282 Ga0501068_0025538 3300049584 Bacteria 3475
283 Ga0501068_0080657 3300049584 Bacteria 1996
284 Ga0501069_0045040 3300049585 Bacteria 2443
285 Ga0501070_0129499 3300049586 Bacteria 2085
286 Ga0501070_0179810 3300049586 Bacteria 1741
287 Ga0501071_0009821 3300049587 Bacteria 6388
288 Ga0501071_0010236 3300049587 Bacteria 6277
289 Ga0501071_0560608 3300049587 Bacteria 878
290 Ga0501072_0051056 3300049588 Bacteria 3256
291 Ga0501073_0062724 3300049589 Bacteria 2592
292 Ga0501074_0214173 3300049590 Bacteria 1372
293 Ga0501075_0012444 3300049591 Bacteria 6047
294 Ga0501075_0063027 3300049591 Bacteria 2795
295 Ga0501076_0006171 3300049592 Bacteria 8674
296 Ga0501077_0095788 3300049593 Bacteria 1881
297 Ga0501077_0146595 3300049593 Bacteria 1497
298 Ga0501077_0321050 3300049593 Bacteria 987
299 Ga0501079_0095804 3300049741 Bacteria 2300
300 Ga0501079_0213276 3300049741 Bacteria 1508
301 Ga0501080_0028906 3300049742 Bacteria 5161
302 Ga0501080_0210233 3300049742 Bacteria 1783
303 Ga0501081_0048739 3300049743 Bacteria 2915
304 Ga0501083_0035433 3300049744 Bacteria 3409
305 Ga0501035_0615848 3300049822 Bacteria 883
306 Ga0501044_0001006 3300049823 Bacteria 33924
307 Ga0501044_0197621 3300049823 Bacteria 1970
308 Ga0501045_0005387 3300049824 Bacteria 8864
309 nmdc:mga04h51_89756_c1 3300050495 Bacteria 1104
310 nmdc:mga07m45_36376_c1 3300050496 Bacteria 2014
311 nmdc:mga05p37_833869_c1 3300050507 Bacteria 1004
312 nmdc:mga09592_195172_c1 3300050508 Bacteria 1753
313 nmdc:mga09592_216044_c1 3300050508 Bacteria 1661
314 nmdc:mga09592_253079_c1 3300050508 Bacteria 1527
315 nmdc:mga09592_588273_c1 3300050508 Bacteria 954
316 nmdc:mga09592_985046_c1 3300050508 Bacteria 705
317 nmdc:mga0qj67_114277_c2 3300050509 Bacteria 1751
318 nmdc:mga0qj67_196838_c1 3300050509 Bacteria 1638
319 nmdc:mga0qj67_41290_c1 3300050509 Bacteria 3628
320 nmdc:mga0qj67_57777_c1 3300050509 Bacteria 3076
321 nmdc:mga0qj67_960190_c1 3300050509 Bacteria 672
322 nmdc:mga06r32_12640_c1 3300050510 Bacteria 7628
323 nmdc:mga08y16_142349_c1 3300050511 Bacteria 2493
324 nmdc:mga08y16_25110_c1 3300050511 Bacteria 6285
325 nmdc:mga08y16_338000_c1 3300050511 Bacteria 1548
326 nmdc:mga08y16_536514_c1 3300050511 Bacteria 1185
327 nmdc:mga08y16_76030_c1 3300050511 Bacteria 3500
328 nmdc:mga0n895_31372_c1 3300050512 Bacteria 5088
329 nmdc:mga0n895_64009_c1 3300050512 Bacteria 3637
330 nmdc:mga0n895_642112_c1 3300050512 Unclassified 1061
331 nmdc:mga0rr50_10481_c1 3300050513 Bacteria 5883
332 nmdc:mga0rr50_855866_c1 3300050513 Unclassified 775
333 nmdc:mga0rr50_975800_c1 3300050513 Unclassified 722
334 nmdc:mga0a205_17413_c1 3300050515 Bacteria 6736
335 nmdc:mga0a205_34224_c1 3300050515 Bacteria 4875
336 Ga0495601_0000824 3300053077 Bacteria 16796
337 Ga0495595_0179962 3300053084 Bacteria 1048
338 Ga0495595_0266247 3300053084 Bacteria 859
339 Ga0495619_0008891 3300053085 Bacteria 6346
340 Ga0501084_0003443 3300054114 Bacteria 12847
341 Ga0501084_0051585 3300054114 Bacteria 3443
342 Ga0590071_028530 3300059421 Bacteria 1326
343 Ga0501082_0024787 3300060353 Bacteria 5170
344 Ga0501082_0102074 3300060353 Bacteria 2481
345 Ga0530510_0006440 3300061734 Bacteria 8178
346 Ga0530510_0274949 3300061734 Bacteria 1257
347 Ga0307408_101416490
348 Ga0065712_10015508
349 Ga0065712_10067776
350 Ga0065715_10097607
351 Ga0065707_10000759
352 Ga0065707_10040473
353 Ga0065707_10504966
354 Ga0070676_10015730
355 Ga0070676_10801436
356 Ga0070670_100386099
357 Ga0070677_10345047
358 Ga0068869_100119975
359 Ga0068869_100417299
360 Ga0070666_10008761
361 Ga0068868_100296609
362 Ga0070689_100219403
363 Ga0070689_100382629
364 Ga0070668_100508725
365 Ga0070668_101198563
366 Ga0070668_101292253
367 Ga0070669_100143727
368 Ga0070669_100232814
369 Ga0070669_100242674
370 Ga0070669_100808943
371 Ga0070669_100829348
372 Ga0070675_100019152
373 Ga0070675_100058840
374 Ga0070675_100069282
375 Ga0070671_100446141
376 Ga0070674_100025989
377 Ga0070674_100487256
378 Ga0070674_101300828
379 Ga0070673_100001897
380 Ga0070688_100044524
381 Ga0070659_100276663
382 Ga0070667_100737078
383 Ga0070700_100222567
384 Ga0070700_100324758
385 Ga0070700_100436882
386 Ga0070694_100233756
387 Ga0070678_100145686
388 Ga0070678_100492952
389 Ga0070662_100238618
390 Ga0070662_100988766
391 Ga0070681_10629799
392 Ga0068867_100102518
393 Ga0068867_100779271
394 Ga0070685_10598656
395 Ga0070698_100088624
396 Ga0070672_100117640
397 Ga0070695_100534886
398 Ga0070704_100209170
399 Ga0070664_100174876
400 Ga0068859_100262450
401 Ga0068859_100570194
402 Ga0068866_10278015
403 Ga0068866_10381593
404 Ga0068861_100129937
405 Ga0068861_100279576
406 Ga0068870_10018948
407 Ga0068870_10076348
408 Ga0068870_10181069
409 Ga0068858_100332288
410 Ga0068858_100358818
411 Ga0068860_101087312
412 Ga0068862_100005556
413 Ga0068862_100073945
414 Ga0068862_100192008
415 Ga0068862_100327980
416 Ga0068862_100483322
417 Ga0068862_100630585
418 Ga0081539_10000017
419 Ga0075368_10050779
420 Ga0075364_10045958
421 Ga0075432_10194318
422 Ga0075367_10303917
423 Ga0075369_10116488
424 Ga0097621_100403254
425 Ga0097621_100975124
426 Ga0068871_100019035
427 Ga0075428_100007864
428 Ga0075428_100173670
429 Ga0075428_100259519
430 Ga0075428_100899033
431 Ga0075430_100012145
432 Ga0075430_100109004
433 Ga0075431_100015851
434 Ga0075431_100132423
435 Ga0075431_100140199
436 Ga0075431_101028027
437 Ga0075433_10022169
438 Ga0075433_10025406
439 Ga0075434_100010150
440 Ga0075434_100015321
441 Ga0075429_100006962
442 Ga0075429_100224733
443 Ga0075429_100262906
444 Ga0075429_100705214
445 Ga0097620_100262448
446 Ga0097620_100570138
447 Ga0075435_100003860
448 Ga0075435_100915387
449 Ga0111539_10109398
450 Ga0111539_10127824
451 Ga0111539_10167889
452 Ga0111539_11124780
453 Ga0111539_11133309
454 Ga0105245_10844678
455 Ga0114129_10512191
456 Ga0114129_10577180
457 Ga0114129_10638450
458 Ga0105243_10143938
459 Ga0105243_10792862
460 Ga0105243_10802176
461 Ga0105242_10281923
462 Ga0105248_10095107
463 Ga0105248_10470840
464 Ga0105248_11194206
465 Ga0105249_10262303
466 Ga0105249_10324461
467 Ga0105249_12820542
468 Ga0157374_10145590
469 Ga0157378_10086772
470 Ga0157378_10600835
471 Ga0157375_10456356
472 Ga0157375_11048866
473 Ga0163163_10215089
474 Ga0163163_11185269
475 Ga0157380_10049323
476 Ga0157380_10093043
477 Ga0157380_10208727
478 Ga0157380_10238428
479 Ga0157377_10003866
480 Ga0157377_10430696
481 Ga0157379_10108940
482 Ga0157376_10129623
483 Ga0157376_10285070
484 Ga0163161_10882769
485 Ga0207682_10045988
486 Ga0207642_10287488
487 Ga0207680_10010441
488 Ga0207680_10213795
489 Ga0207643_10001015
490 Ga0207643_10028031
491 Ga0207643_10085170
492 Ga0207684_10201707
493 Ga0207649_10420140
494 Ga0207681_10054353
495 Ga0207681_10111263
496 Ga0207681_10426570
497 Ga0207650_10098817
498 Ga0207659_10112772
499 Ga0207659_10141819
500 Ga0207659_10341598
501 Ga0207659_10634228
502 Ga0207644_10176565
503 Ga0207644_10586128
504 Ga0207706_10404135
505 Ga0207706_11029326
506 Ga0207709_10549982
507 Ga0207669_10229026
508 Ga0207669_10350526
509 Ga0207669_11062354
510 Ga0207704_10272975
511 Ga0207691_10057823
512 Ga0207691_10126142
513 Ga0207691_10205555
514 Ga0207691_10563690
515 Ga0207711_10131424
516 Ga0207711_10209955
517 Ga0207689_10048692
518 Ga0207661_10288345
519 Ga0207679_10070934
520 Ga0207651_10021887
521 Ga0207651_10547016
522 Ga0207712_10053914
523 Ga0207668_10222314
524 Ga0207668_10313131
525 Ga0207668_11195908
526 Ga0207668_11630315
527 Ga0207708_10042804
528 Ga0207708_10282884
529 Ga0207708_10874448
530 Ga0207641_10050221
531 Ga0207648_10147453
532 Ga0207648_10441465
533 Ga0207674_10187022
534 Ga0207674_10497041
535 Ga0207675_101271979
536 Ga0207683_10046201
537 Ga0207683_10269323
538 Ga0209813_10095891
539 Ga0207428_10007180
540 Ga0207428_10058005
541 Ga0207428_10542961
542 Ga0268265_10108488
543 Ga0268265_10125094
544 Ga0268265_10416644
545 Ga0268265_10631592
546 Ga0268264_10405620
547 Ga0307405_10371864
548 Ga0307406_10149505
549 Ga0307407_10011327
550 Ga0307412_10297438
551 Ga0307409_100262326
552 Ga0373932_0022831
553 Ga0373945_0126237
554 Ga0373954_0033372
555 Ga0373956_0001082
556 Ga0373956_0270006
557 Ga0373956_0308441
558 Ga0373957_0102750
559 Ga0373955_0059434
560 Ga0373931_0151317
561 Ga0373933_0001804
562 Ga0373933_0682720
563 Ga0373937_0000685
564 Ga0373937_0537186
565 Ga0373925_0925027
566 Ga0451807_2648505
567 Ga0450923_113121
568 Ga0439446_0037739
569 Ga0439446_0107134
570 Ga0450908_001246
571 Ga0439435_0041763
572 Ga0439435_0076448
573 Ga0450918_005284
574 Ga0466959_0391594
575 Ga0466958_0355761
576 Ga0495592_0021567
577 Ga0495603_0293379
578 Ga0495629_0595461
579 Ga0495651_0225861
580 Ga0495653_0334945
581 Ga0495580_0295115
582 Ga0495582_0105353
583 Ga0495608_0039894
584 Ga0495618_0341540
585 Ga0495628_0018338
586 Ga0495630_0024023
587 Ga0495640_0349522
588 Ga0495586_0138149
589 Ga0495645_0266368
590 Ga0495659_0016212
591 Ga0495658_0014930
592 Ga0495613_0001316
593 Ga0495649_0576486
594 Ga0495674_0142853
595 Ga0495680_0132656
596 Ga0495680_0383321
597 Ga0495675_0219059
598 Ga0495684_0002593
599 Ga0496104_0551806
600 Ga0496106_0125528
601 Ga0496108_0353768
602 Ga0496109_0668880
603 Ga0496110_0019125
604 Ga0496111_0346150
605 Ga0501031_0638849
606 Ga0501031_0818344
607 Ga0501034_0056685
608 Ga0501036_0035863
609 Ga0501038_0553443
610 Ga0501039_0051047
611 Ga0501039_0054353
612 Ga0501039_0055591
613 Ga0501040_0032433
614 Ga0501040_0040710
615 Ga0501041_0116864
616 Ga0501041_0136464
617 Ga0501042_0042594
618 Ga0501042_0069252
619 Ga0501043_0049379
620 Ga0501043_0091474
621 Ga0501043_0948543
622 Ga0501046_0018645
623 Ga0501046_0217026
624 Ga0501047_0001056
625 Ga0501047_0254790
626 Ga0501048_0011513
627 Ga0501048_0186680
628 Ga0501068_0025538
629 Ga0501068_0080657
630 Ga0501069_0045040
631 Ga0501070_0129499
632 Ga0501070_0179810
633 Ga0501071_0009821
634 Ga0501071_0010236
635 Ga0501071_0560608
636 Ga0501072_0051056
637 Ga0501073_0062724
638 Ga0501074_0214173
639 Ga0501075_0012444
640 Ga0501075_0063027
641 Ga0501076_0006171
642 Ga0501077_0095788
643 Ga0501077_0146595
644 Ga0501077_0321050
645 Ga0501079_0095804
646 Ga0501079_0213276
647 Ga0501080_0028906
648 Ga0501080_0210233
649 Ga0501081_0048739
650 Ga0501083_0035433
651 Ga0501035_0615848
652 Ga0501044_0001006
653 Ga0501044_0197621
654 Ga0501045_0005387
655 nmdc:mga04h51_89756_c1
656 nmdc:mga07m45_36376_c1
657 nmdc:mga05p37_833869_c1
658 nmdc:mga09592_195172_c1
659 nmdc:mga09592_216044_c1
660 nmdc:mga09592_253079_c1
661 nmdc:mga09592_588273_c1
662 nmdc:mga09592_985046_c1
663 nmdc:mga0qj67_114277_c2
664 nmdc:mga0qj67_196838_c1
665 nmdc:mga0qj67_41290_c1
666 nmdc:mga0qj67_57777_c1
667 nmdc:mga0qj67_960190_c1
668 nmdc:mga06r32_12640_c1
669 nmdc:mga08y16_142349_c1
670 nmdc:mga08y16_25110_c1
671 nmdc:mga08y16_338000_c1
672 nmdc:mga08y16_536514_c1
673 nmdc:mga08y16_76030_c1
674 nmdc:mga0n895_31372_c1
675 nmdc:mga0n895_64009_c1
676 nmdc:mga0n895_642112_c1
677 nmdc:mga0rr50_10481_c1
678 nmdc:mga0rr50_855866_c1
679 nmdc:mga0rr50_975800_c1
680 nmdc:mga0a205_17413_c1
681 nmdc:mga0a205_34224_c1
682 Ga0495601_0000824
683 Ga0495595_0179962
684 Ga0495595_0266247
685 Ga0495619_0008891
686 Ga0501084_0003443
687 Ga0501084_0051585
688 Ga0590071_028530
689 Ga0501082_0024787
690 Ga0501082_0102074
691 Ga0530510_0006440
692 Ga0530510_0274949

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01475

FUR

Ferric uptake regulator family

13

130

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9231 21 80
2g9w-assembly1.cif.gz_B crystal structure of rv1846c, a putative transcriptional regulatory protein of mycobacterium tuberculosis 0.9035 15 81
2fu4-assembly1.cif.gz_A crystal structure of the dna binding domain of e.coli fur (ferric uptake regulator) 0.8926 4 80
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.8918 19 80
5k5o-assembly1.cif.gz_C structure of aspa-26mer dna complex 0.8816 20 80
ID Description Score Start End Superfamily
af_P9WN87_5_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9741 4 80 1.10.10.10
af_P9WN87_5_83_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9385 4 80 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9289 20 80 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9231 21 80 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.921 17 81 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A519GNQ1-F1-model_v4 Transcriptional repressor 0.9508 1 102 GO:0000976
GO:0003700
GO:0005737
GO:0008270
GO:0045892
GO:1900376
AF-A0A519GNQ1-F1-model_v4 Transcriptional repressor 0.9333 1 102 GO:0000976
GO:0003700
GO:0005737
GO:0008270
GO:0045892
GO:1900376
AF-A0A519KVH4-F1-model_v4 Ferric uptake regulation protein 0.9139 5 100 GO:0000976
GO:0003700
GO:0005829
GO:0008270
GO:0045892
GO:1900376
AF-A0A357X4C4-F1-model_v4 deleted 0.8874 2 103
AF-M9R4D0-F1-model_v4 Ferric uptake regulator protein Fur 0.8783 1 100 GO:0000976
GO:0003700
GO:0008270
GO:0045892
GO:1900376

Map