F416741

General Info

Members Datasets Scaffolds Average Seq Length
346 269 265 245

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10015020|Ga0105247_100150202
Length 285
Sequence MPSADLTICLRALLQMQLKRTPSPAARMTFVVGPFHHGGWTMRFAAIADIHGNCLALEAVLADIAAIGITEVVNLGDHVSGPLEPRRTADLLIERNFISIRGDQDRRLVELGPPGASQRWDHAQLDRRHLDWLAGQPSTLLYRDDVLLCHGSPRDDAAYWLDRVTADGAIQASTIADIEIDATGVAASLILCAHTHIPRVVRLRNGRLVVNPGSVGCPGYDGRKPVYHKVQTGTPDACYAILAPSPAGWRVTFRYVPYDHMAMAELAKANGMPVWASALATGWVE

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
4 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
5 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
6 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
7 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
8 2643221557 Ensifer sp. Root558 Isolate Unclassified
9 2643221610 Ensifer sp. Root74 Isolate Unclassified
10 2643221618 Ensifer sp. Root231 Isolate Unclassified
11 2643221626 Ensifer sp. Root31 Isolate Unclassified
12 2643221655 Ensifer sp. Root1252 Isolate Unclassified
13 2643221659 Ensifer sp. Root127 Isolate Unclassified
14 2643221668 Ensifer sp. Root423 Isolate Unclassified
15 2643221675 Ensifer sp. Root1298 Isolate Unclassified
16 2643221680 Ensifer sp. Root1312 Isolate Unclassified
17 2643221698 Ensifer sp. Root142 Isolate Unclassified
18 2643221712 Ensifer sp. Root258 Isolate Unclassified
19 2643221723 Ensifer sp. Root278 Isolate Unclassified
20 2643221726 Ensifer sp. Root954 Isolate Unclassified
21 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
22 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
23 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
24 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
25 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
26 2791355263 Rhizobium chutanense C5 Isolate Nodule
27 2791355266 Rhizobium sp. L43 Isolate Nodule
28 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
29 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
30 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
31 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
32 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
33 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
34 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
35 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
36 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
37 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
38 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
39 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
40 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
41 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
42 2844163670 Ensifer sp. 1H6 Isolate Unclassified
43 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
44 2854911287 Brucella lupini LUP21 Isolate Unclassified
45 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
46 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
47 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
48 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
49 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
50 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
51 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
52 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
53 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
54 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
55 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
56 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
57 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
58 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
59 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
60 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
61 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
62 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
63 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
64 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
65 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
66 2936381700 Rhizobium chutanense C16 Isolate Unclassified
67 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
68 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
69 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
70 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
71 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
76 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
77 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
78 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
79 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
80 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
85 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
86 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
87 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
90 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
93 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
94 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
95 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
98 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
102 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
112 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
113 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
114 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
115 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
118 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
119 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
120 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
135 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
136 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
137 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
138 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
175 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
181 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
182 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
183 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
184 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
192 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
193 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
196 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
202 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
215 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
216 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
220 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
221 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
222 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
248 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
249 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
250 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
251 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
252 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
253 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
254 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
260 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
261 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
262 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
263 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
264 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
265 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
266 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
267 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
268 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
269 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.01
Metatranscriptomes 0.58
Isolates 23.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.45
Nodule 13.87
Rhizoplane 4.34
Rhizosphere 45.09
Stem 0
Stem Tuber 0
Unclassified 22.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000002 3300002987 Bacteria 289163
2 JGI25151J46595_10037770 3300003187 Bacteria 1807
3 rootH1_10123121 3300003316 Bacteria 1262
4 JGI25160J50197_1000001 3300003354 Bacteria 782301
5 JGI25160J50197_1000008 3300003354 Bacteria 289163
6 JGI25161J50226_1000001 3300003374 Bacteria 655036
7 JGI25161J50226_1001600 3300003374 Bacteria 6603
8 Ga0006562J51391_1004592 3300003578 Bacteria 2330
9 Ga0006562J51391_1004595 3300003578 Bacteria 2598
10 Ga0055526_1000738 3300003771 Bacteria 24652
11 Ga0055526_1003643 3300003771 Bacteria 9648
12 Ga0055524_1000570 3300003775 Bacteria 27529
13 Ga0055524_1039788 3300003775 Bacteria 1209
14 Ga0055536_1010378 3300003781 Bacteria 3705
15 Ga0055528_1000707 3300003790 Bacteria 23679
16 Ga0055540_1035761 3300003792 Bacteria 1108
17 Ga0055543_1000027 3300004625 Bacteria 136033
18 Ga0055543_1000216 3300004625 Bacteria 46311
19 Ga0065165_1000008 3300005262 Bacteria 334429
20 Ga0065165_1000015 3300005262 Bacteria 289201
21 Ga0070676_10461303 3300005328 Bacteria 895
22 Ga0070690_100265045 3300005330 Bacteria 1220
23 Ga0070690_100452343 3300005330 Unclassified 952
24 Ga0068869_100455780 3300005334 Bacteria 1061
25 Ga0070680_100001676 3300005336 Bacteria 16218
26 Ga0070660_100024452 3300005339 Bacteria 4479
27 Ga0070691_10012501 3300005341 Bacteria 3888
28 Ga0070668_100099650 3300005347 Bacteria 2301
29 Ga0070668_100214946 3300005347 Bacteria 1583
30 Ga0070671_100345249 3300005355 Bacteria 1270
31 Ga0070703_10010975 3300005406 Bacteria 2557
32 Ga0070705_100000695 3300005440 Bacteria 19155
33 Ga0070694_100000318 3300005444 Bacteria 25957
34 Ga0070708_100237260 3300005445 Bacteria 1712
35 Ga0070663_100014718 3300005455 Bacteria 5028
36 Ga0070663_100179665 3300005455 Bacteria 1640
37 Ga0070681_10099136 3300005458 Bacteria 2860
38 Ga0070699_100000325 3300005518 Bacteria 46074
39 Ga0070679_100151915 3300005530 Bacteria 2292
40 Ga0068853_100091247 3300005539 Bacteria 2679
41 Ga0068853_100481860 3300005539 Bacteria 1169
42 Ga0070695_100000191 3300005545 Bacteria 29742
43 Ga0070696_100001835 3300005546 Bacteria 13953
44 Ga0070693_100213838 3300005547 Bacteria 1259
45 Ga0070665_100330828 3300005548 Bacteria 1528
46 Ga0070704_100004609 3300005549 Bacteria 7969
47 Ga0068855_100110483 3300005563 Bacteria 3156
48 Ga0068855_100218111 3300005563 Bacteria 2141
49 Ga0070664_100281380 3300005564 Bacteria 1500
50 Ga0068857_100005695 3300005577 Bacteria 10652
51 Ga0068857_100649468 3300005577 Bacteria 1000
52 Ga0068859_100057388 3300005617 Bacteria 3922
53 Ga0068861_100188796 3300005719 Bacteria 1721
54 Ga0068863_100130250 3300005841 Bacteria 2402
55 Ga0068858_100192906 3300005842 Bacteria 1925
56 Ga0068860_100000210 3300005843 Bacteria 91495
57 Ga0068860_100069715 3300005843 Bacteria 3342
58 Ga0068860_100469490 3300005843 Bacteria 1253
59 Ga0068862_100004575 3300005844 Bacteria 11664
60 Ga0081455_10040768 3300005937 Bacteria 4091
61 Ga0075364_10015660 3300006051 Bacteria 4706
62 Ga0070712_100727474 3300006175 Bacteria 848
63 Ga0075430_100010896 3300006846 Bacteria 7702
64 Ga0075430_100062685 3300006846 Bacteria 3122
65 Ga0075431_100009339 3300006847 Bacteria 9844
66 Ga0075431_100262481 3300006847 Bacteria 1752
67 Ga0068865_100069118 3300006881 Bacteria 2498
68 Ga0097620_100057388 3300006931 Bacteria 3922
69 Ga0105247_10015020 3300009101 Bacteria 4643
70 Ga0114129_10179928 3300009147 Bacteria 2878
71 Ga0105243_10065395 3300009148 Bacteria 2921
72 Ga0105237_10052071 3300009545 Bacteria 4110
73 Ga0105237_10062066 3300009545 Bacteria 3736
74 Ga0105237_10495706 3300009545 Bacteria 1228
75 Ga0105249_10003888 3300009553 Bacteria 12905
76 Ga0157370_10222128 3300013104 Bacteria 1750
77 Ga0171463_1001 3300013249 Bacteria 1406070
78 Ga0157374_10656852 3300013296 Bacteria 1060
79 Ga0163162_10455308 3300013306 Bacteria 1411
80 Ga0157375_10037790 3300013308 Bacteria 4629
81 Ga0163163_10319968 3300014325 Bacteria 1605
82 Ga0157376_10165800 3300014969 Unclassified 2007
83 Ga0183363_1082 3300015690 Bacteria 28896
84 Ga0214544_1000017 3300021320 Bacteria 193638
85 Ga0214542_1018163 3300021321 Bacteria 6061
86 Ga0214543_1000003 3300021327 Bacteria 692327
87 Ga0209436_100920 3300025208 Bacteria 11631
88 Ga0209563_105310 3300025230 Bacteria 2353
89 Ga0209673_1000025 3300025273 Bacteria 404572
90 Ga0209673_1016727 3300025273 Bacteria 2729
91 Ga0209130_1000003 3300025284 Bacteria 677988
92 Ga0209130_1000007 3300025284 Bacteria 591584
93 Ga0209130_1013211 3300025284 Bacteria 2124
94 Ga0209676_1019549 3300025292 Bacteria 2328
95 Ga0209025_1000943 3300025294 Bacteria 44218
96 Ga0209025_1049479 3300025294 Bacteria 1691
97 Ga0209564_1000330 3300025295 Bacteria 92033
98 Ga0209564_1000672 3300025295 Bacteria 50497
99 Ga0209050_1016394 3300025298 Bacteria 3034
100 Ga0209256_1000445 3300025299 Bacteria 63065
101 Ga0209256_1000914 3300025299 Bacteria 36121
102 Ga0209256_1002049 3300025299 Bacteria 17886
103 Ga0207426_1000011 3300025302 Bacteria 791203
104 Ga0207426_1000064 3300025302 Bacteria 358276
105 Ga0209257_1001197 3300025304 Bacteria 32625
106 Ga0207653_10007392 3300025885 Bacteria 3424
107 Ga0207643_10071889 3300025908 Bacteria 1992
108 Ga0207705_10020189 3300025909 Bacteria 4766
109 Ga0207707_10262337 3300025912 Bacteria 1499
110 Ga0207671_10066371 3300025914 Bacteria 2685
111 Ga0207660_10002979 3300025917 Bacteria 11085
112 Ga0207657_10021924 3300025919 Bacteria 5998
113 Ga0207652_10100699 3300025921 Bacteria 2551
114 Ga0207694_10637045 3300025924 Bacteria 898
115 Ga0207689_10137413 3300025942 Bacteria 2013
116 Ga0207679_10132332 3300025945 Bacteria 2003
117 Ga0207667_10020598 3300025949 Bacteria 7328
118 Ga0207667_10409767 3300025949 Bacteria 1380
119 Ga0207712_10006766 3300025961 Bacteria 7227
120 Ga0207668_10192874 3300025972 Bacteria 1616
121 Ga0207677_10163785 3300026023 Bacteria 1731
122 Ga0207639_10076079 3300026041 Bacteria 2642
123 Ga0207639_10094766 3300026041 Bacteria 2397
124 Ga0207639_10370097 3300026041 Bacteria 1284
125 Ga0207678_10006166 3300026067 Bacteria 10660
126 Ga0207678_10362478 3300026067 Bacteria 1251
127 Ga0207708_10571691 3300026075 Bacteria 955
128 Ga0207676_10028605 3300026095 Bacteria 4165
129 Ga0207674_10629378 3300026116 Bacteria 1036
130 Ga0207683_10154566 3300026121 Bacteria 2072
131 Ga0268265_10006734 3300028380 Bacteria 7777
132 Ga0268264_10000233 3300028381 Bacteria 106118
133 Ga0268264_10025232 3300028381 Bacteria 4856
134 Ga0307513_10235565 3300031456 Bacteria 1640
135 Ga0307509_10013280 3300031507 Bacteria 9762
136 Ga0307514_10123702 3300031649 Bacteria 1798
137 Ga0307516_10015237 3300031730 Bacteria 8099
138 Ga0307406_10005188 3300031901 Bacteria 7115
139 Ga0307507_10115817 3300033179 Bacteria 2167
140 Ga0373927_0000419 3300035695 Bacteria 32608
141 Ga0373927_0026661 3300035695 Bacteria 3777
142 Ga0373925_0013435 3300037068 Bacteria 5926
143 Ga0373925_0035593 3300037068 Bacteria 3674
144 Ga0395905_0000788 3300037471 Bacteria 41696
145 Ga0395905_0019959 3300037471 Bacteria 6351
146 Ga0395905_0136298 3300037471 Bacteria 2309
147 Ga0400483_258307 3300039062 Bacteria 4283
148 Ga0439436_0013269 3300041404 Bacteria 2493
149 Ga0439447_019692 3300041407 Bacteria 1797
150 Ga0439465_0002707 3300041413 Bacteria 5792
151 Ga0466972_0001603 3300044658 Bacteria 11060
152 Ga0466957_0090946 3300044842 Bacteria 1912
153 Ga0451576_0849810 3300045051 Bacteria 958
154 Ga0466967_0690322 3300045976 Bacteria 1011
155 Ga0495638_0122099 3300046460 Bacteria 1538
156 Ga0495664_0033131 3300046477 Bacteria 3036
157 Ga0495583_0003748 3300046506 Bacteria 11302
158 Ga0495606_0002753 3300046507 Bacteria 19716
159 Ga0495606_0162534 3300046507 Bacteria 1302
160 Ga0495620_0086539 3300046515 Bacteria 1262
161 Ga0495643_0081392 3300046522 Bacteria 1684
162 Ga0495622_0008356 3300046557 Bacteria 4794
163 Ga0495622_0098684 3300046557 Bacteria 1339
164 Ga0495656_0022417 3300046615 Bacteria 2473
165 Ga0495668_0275411 3300046616 Bacteria 922
166 Ga0495625_0124530 3300046660 Bacteria 1751
167 Ga0495625_0303854 3300046660 Bacteria 1020
168 Ga0495661_0068065 3300046665 Bacteria 2090
169 Ga0495588_0050582 3300046674 Bacteria 2138
170 Ga0495671_0071878 3300046692 Bacteria 1699
171 Ga0495672_0026891 3300047320 Bacteria 3664
172 Ga0495676_0054562 3300047321 Bacteria 3176
173 Ga0496100_0084113 3300048903 Bacteria 2156
174 Ga0496101_0088016 3300048904 Bacteria 2306
175 Ga0496101_0302099 3300048904 Bacteria 1254
176 Ga0496104_0080696 3300048907 Bacteria 3102
177 Ga0496105_0028032 3300048908 Bacteria 4605
178 Ga0496105_0559798 3300048908 Bacteria 891
179 Ga0496106_0001108 3300048909 Bacteria 19932
180 Ga0496106_0001152 3300048909 Bacteria 19595
181 Ga0496108_0182228 3300048911 Bacteria 1819
182 Ga0496109_0199133 3300048912 Bacteria 1883
183 Ga0496114_0063158 3300048917 Bacteria 3100
184 Ga0496114_0157580 3300048917 Bacteria 1972
185 Ga0496114_0164207 3300048917 Unclassified 1933
186 Ga0496115_0030235 3300048918 Bacteria 4260
187 Ga0496116_0022826 3300048919 Bacteria 4676
188 Ga0496116_0154728 3300048919 Bacteria 1267
189 Ga0496117_0015458 3300048920 Bacteria 6506
190 Ga0496117_0020448 3300048920 Bacteria 5395
191 Ga0496117_0025317 3300048920 Bacteria 4668
192 Ga0496117_0063190 3300048920 Bacteria 2532
193 Ga0496118_0004636 3300048921 Bacteria 16127
194 Ga0496118_0025136 3300048921 Bacteria 5117
195 Ga0496118_0027341 3300048921 Bacteria 4830
196 Ga0496118_0163968 3300048921 Bacteria 1369
197 Ga0496119_0009801 3300048922 Bacteria 8150
198 Ga0496119_0041203 3300048922 Bacteria 2944
199 Ga0496119_0046592 3300048922 Bacteria 2706
200 Ga0496119_0046892 3300048922 Bacteria 2693
201 Ga0496119_0116831 3300048922 Bacteria 1471
202 Ga0496120_0058772 3300048923 Bacteria 2158
203 Ga0496120_0109037 3300048923 Bacteria 1449
204 Ga0496121_0000003 3300048924 Bacteria 1191431
205 Ga0496121_0000994 3300048924 Bacteria 50714
206 Ga0496121_0015887 3300048924 Bacteria 7822
207 Ga0496121_0020642 3300048924 Bacteria 6505
208 Ga0496121_0038632 3300048924 Bacteria 4220
209 Ga0496121_0161895 3300048924 Bacteria 1635
210 Ga0496121_0164699 3300048924 Bacteria 1617
211 Ga0496122_0093691 3300048925 Bacteria 2036
212 Ga0496123_0037700 3300048926 Bacteria 3410
213 Ga0496124_0002590 3300048927 Bacteria 23408
214 Ga0496124_0006920 3300048927 Bacteria 12188
215 Ga0496124_0178486 3300048927 Bacteria 1637
216 Ga0496124_0236481 3300048927 Bacteria 1361
217 Ga0496124_0309583 3300048927 Bacteria 1136
218 Ga0496125_0000136 3300048928 Bacteria 160544
219 Ga0496125_0001144 3300048928 Bacteria 40287
220 Ga0496125_0146191 3300048928 Bacteria 1633
221 Ga0496126_0010739 3300048929 Bacteria 9562
222 Ga0496126_0063322 3300048929 Bacteria 3315
223 Ga0496126_0073948 3300048929 Bacteria 3028
224 Ga0496126_0127236 3300048929 Bacteria 2204
225 Ga0495682_0056906 3300049460 Bacteria 1417
226 Ga0501033_0002870 3300049570 Bacteria 14437
227 Ga0501033_0310743 3300049570 Bacteria 1108
228 Ga0501034_0507265 3300049571 Bacteria 1119
229 Ga0501036_0149039 3300049572 Bacteria 1973
230 Ga0501037_0186264 3300049573 Bacteria 1471
231 Ga0501038_0251666 3300049574 Bacteria 1399
232 Ga0501039_0694138 3300049575 Bacteria 796
233 Ga0501040_0234980 3300049576 Bacteria 1306
234 Ga0501042_0261642 3300049578 Bacteria 1249
235 Ga0501043_0188990 3300049579 Bacteria 1602
236 Ga0501046_0158801 3300049580 Bacteria 1702
237 Ga0501046_0168780 3300049580 Bacteria 1643
238 Ga0501047_0055211 3300049581 Bacteria 3841
239 Ga0501070_0076118 3300049586 Bacteria 2778
240 Ga0501075_0200759 3300049591 Bacteria 1521
241 Ga0501076_0291638 3300049592 Bacteria 1337
242 Ga0501080_0184084 3300049742 Bacteria 1921
243 Ga0501035_0006588 3300049822 Bacteria 10874
244 Ga0501035_0019948 3300049822 Bacteria 6158
245 Ga0501045_0163541 3300049824 Bacteria 1657
246 nmdc:mga00v17_92464_c1 3300050491 Bacteria 1175
247 nmdc:mga05p37_94992_c1 3300050507 Bacteria 3673
248 nmdc:mga0qj67_114032_c1 3300050509 Bacteria 2183
249 nmdc:mga06r32_14842_c1 3300050510 Bacteria 7067
250 nmdc:mga08y16_383978_c1 3300050511 Bacteria 1439
251 Ga0495619_0021277 3300053085 Bacteria 4138
252 Ga0500644_0007474 3300053088 Bacteria 2847
253 Ga0500566_0139487 3300053094 Bacteria 1288
254 Ga0500608_011146 3300053122 Bacteria 3892
255 Ga0500559_0015773 3300053136 Bacteria 3191
256 Ga0500573_0117580 3300053140 Bacteria 1482
257 Ga0500603_054531 3300053150 Bacteria 1103
258 Ga0500622_0000821 3300053156 Bacteria 26574
259 Ga0500634_0027421 3300053161 Bacteria 3103
260 Ga0500636_0003370 3300053177 Bacteria 8989
261 Ga0500636_0082871 3300053177 Bacteria 1846
262 Ga0500636_0137843 3300053177 Bacteria 1353
263 Ga0500636_0188848 3300053177 Bacteria 1099
264 Ga0501084_0371574 3300054114 Bacteria 1208
265 Ga0501082_0665353 3300060353 Bacteria 911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046522 Ga0495643_0081392 Ga0495643_0081392_639_1346 229
2 3300048908 Ga0496105_0559798 Ga0496105_0559798_22_714 230
3 3300005539 Ga0068853_100091247 Ga0068853_1000912471 232
4 3300026041 Ga0207639_10076079 Ga0207639_100760794 232
5 3300005339 Ga0070660_100024452 Ga0070660_1000244524 233
6 3300005563 Ga0068855_100110483 Ga0068855_1001104831 233
7 3300009545 Ga0105237_10495706 Ga0105237_104957061 233
8 3300025909 Ga0207705_10020189 Ga0207705_100201894 233
9 3300025919 Ga0207657_10021924 Ga0207657_100219243 233
10 3300025924 Ga0207694_10637045 Ga0207694_106370451 233
11 3300025949 Ga0207667_10020598 Ga0207667_1002059812 233
12 3300026067 Ga0207678_10362478 Ga0207678_103624783 233
13 3300045976 Ga0466967_0690322 Ga0466967_0690322_50_766 233
14 3300049570 Ga0501033_0310743 Ga0501033_0310743_236_952 233
15 3300049571 Ga0501034_0507265 Ga0501034_0507265_263_979 233
16 3300049572 Ga0501036_0149039 Ga0501036_0149039_1204_1920 233
17 3300049573 Ga0501037_0186264 Ga0501037_0186264_449_1165 233
18 3300049574 Ga0501038_0251666 Ga0501038_0251666_270_986 233
19 3300049579 Ga0501043_0188990 Ga0501043_0188990_650_1366 233
20 3300049581 Ga0501047_0055211 Ga0501047_0055211_2874_3590 233
21 3300049586 Ga0501070_0076118 Ga0501070_0076118_1983_2699 233
22 3300049742 Ga0501080_0184084 Ga0501080_0184084_465_1181 233
23 3300049822 Ga0501035_0019948 Ga0501035_0019948_510_1226 233
24 iso_pu_bacteria 2977232053 2977235651 235
25 3300005334 Ga0068869_100455780 Ga0068869_1004557801 237
26 3300005336 Ga0070680_100001676 Ga0070680_1000016766 237
27 3300005341 Ga0070691_10012501 Ga0070691_100125013 237
28 3300005347 Ga0070668_100214946 Ga0070668_1002149462 237
29 3300005406 Ga0070703_10010975 Ga0070703_100109753 237
30 3300005440 Ga0070705_100000695 Ga0070705_10000069532 237
31 3300005444 Ga0070694_100000318 Ga0070694_10000031832 237
32 3300005445 Ga0070708_100237260 Ga0070708_1002372602 237
33 3300005455 Ga0070663_100014718 Ga0070663_1000147184 237
34 3300005458 Ga0070681_10099136 Ga0070681_100991362 237
35 3300005518 Ga0070699_100000325 Ga0070699_10000032533 237
36 3300005530 Ga0070679_100151915 Ga0070679_1001519152 237
37 3300005545 Ga0070695_100000191 Ga0070695_10000019114 237
38 3300005546 Ga0070696_100001835 Ga0070696_10000183519 237
39 3300005547 Ga0070693_100213838 Ga0070693_1002138381 237
40 3300005549 Ga0070704_100004609 Ga0070704_1000046096 237
41 3300005577 Ga0068857_100005695 Ga0068857_1000056952 237
42 3300005617 Ga0068859_100057388 Ga0068859_1000573883 237
43 3300005719 Ga0068861_100188796 Ga0068861_1001887962 237
44 3300005842 Ga0068858_100192906 Ga0068858_1001929062 237
45 3300005843 Ga0068860_100069715 Ga0068860_1000697153 237
46 3300005844 Ga0068862_100004575 Ga0068862_1000045757 237
47 3300006847 Ga0075431_100262481 Ga0075431_1002624812 237
48 3300006931 Ga0097620_100057388 Ga0097620_1000573883 237
49 3300009148 Ga0105243_10065395 Ga0105243_100653952 237
50 3300009553 Ga0105249_10003888 Ga0105249_100038886 237
51 3300025885 Ga0207653_10007392 Ga0207653_100073922 237
52 3300025908 Ga0207643_10071889 Ga0207643_100718892 237
53 3300025912 Ga0207707_10262337 Ga0207707_102623372 237
54 3300025917 Ga0207660_10002979 Ga0207660_100029792 237
55 3300025921 Ga0207652_10100699 Ga0207652_101006992 237
56 3300025942 Ga0207689_10137413 Ga0207689_101374131 237
57 3300025961 Ga0207712_10006766 Ga0207712_100067665 237
58 3300025972 Ga0207668_10192874 Ga0207668_101928742 237
59 3300026067 Ga0207678_10006166 Ga0207678_100061663 237
60 3300026075 Ga0207708_10571691 Ga0207708_105716911 237
61 3300026095 Ga0207676_10028605 Ga0207676_100286054 237
62 3300028380 Ga0268265_10006734 Ga0268265_100067344 237
63 3300028381 Ga0268264_10025232 Ga0268264_100252324 237
64 3300048907 Ga0496104_0080696 Ga0496104_0080696_1023_1763 237
65 3300048909 Ga0496106_0001108 Ga0496106_0001108_16441_17181 237
66 3300048911 Ga0496108_0182228 Ga0496108_0182228_326_1066 237
67 3300048912 Ga0496109_0199133 Ga0496109_0199133_790_1530 237
68 3300048918 Ga0496115_0030235 Ga0496115_0030235_1289_2029 237
69 3300049575 Ga0501039_0694138 Ga0501039_0694138_40_765 237
70 3300049576 Ga0501040_0234980 Ga0501040_0234980_415_1140 237
71 3300049578 Ga0501042_0261642 Ga0501042_0261642_180_905 237
72 3300049580 Ga0501046_0158801 Ga0501046_0158801_673_1398 237
73 3300049580 Ga0501046_0168780 Ga0501046_0168780_900_1625 237
74 3300049591 Ga0501075_0200759 Ga0501075_0200759_598_1338 237
75 3300049592 Ga0501076_0291638 Ga0501076_0291638_100_825 237
76 3300049824 Ga0501045_0163541 Ga0501045_0163541_552_1277 237
77 3300054114 Ga0501084_0371574 Ga0501084_0371574_291_1016 237
78 3300060353 Ga0501082_0665353 Ga0501082_0665353_148_873 237
79 3300047321 Ga0495676_0054562 Ga0495676_0054562_1927_2664 239
80 iso_pu_bacteria 2738541317 2738944137 239
81 iso_pu_bacteria 2913308742 2913308756 239
82 iso_pu_bacteria 2879099564 2879109061 240
83 iso_pu_bacteria 2932784394 2932785626 240
84 iso_pu_bacteria 2932809354 2932813787 240
85 iso_pu_bacteria 2932818245 2932822244 240
86 iso_pu_bacteria 2932828146 2932830690 240
87 iso_pu_bacteria 2935684952 2935690470 240
88 iso_pu_bacteria 2935713505 2935717834 240
89 iso_pu_bacteria 2935722832 2935727016 240
90 iso_pu_bacteria 2935732158 2935735786 240
91 iso_pu_bacteria 2935741537 2935744943 240
92 iso_pu_bacteria 2935750917 2935755479 240
93 iso_pu_bacteria 2935760218 2935762009 240
94 iso_pu_bacteria 2935810662 2935811432 240
95 iso_pu_bacteria 2936037263 2936038014 240
96 iso_pu_bacteria 2940556831 2940561240 240
97 iso_pu_bacteria 8016511872 8016516720 240
98 iso_pu_bacteria 8017057580 8017059840 240
99 iso_pu_bacteria 8054558443 8054559078 240
100 iso_pu_bacteria 8055742211 8055749415 240
101 3300053122 Ga0500608_011146 Ga0500608_011146_485_1258 241
102 iso_pu_bacteria 2508501122 2509108631 242
103 iso_pu_bacteria 2509276019 2509374347 242
104 iso_pu_bacteria 2513237103 2513707908 242
105 iso_pu_bacteria 2513237159 2514001081 242
106 iso_pu_bacteria 2558860100 2558863374 242
107 iso_pu_bacteria 2582581299 2585228575 242
108 iso_pu_bacteria 2599185352 2600192079 242
109 iso_pu_bacteria 2643221557 2643807087 242
110 iso_pu_bacteria 2643221610 2644069646 242
111 iso_pu_bacteria 2643221618 2644108878 242
112 iso_pu_bacteria 2643221626 2644151400 242
113 iso_pu_bacteria 2643221655 2644311534 242
114 iso_pu_bacteria 2643221659 2644329793 242
115 iso_pu_bacteria 2643221668 2644380469 242
116 iso_pu_bacteria 2643221675 2644420800 242
117 iso_pu_bacteria 2643221680 2644454325 242
118 iso_pu_bacteria 2643221698 2644546466 242
119 iso_pu_bacteria 2643221712 2644617333 242
120 iso_pu_bacteria 2643221723 2644675453 242
121 iso_pu_bacteria 2643221726 2644689662 242
122 iso_pu_bacteria 2657244999 2657683155 242
123 iso_pu_bacteria 2751185821 2753460953 242
124 iso_pu_bacteria 2791355082 2792584270 242
125 iso_pu_bacteria 2791355263 2793339555 242
126 iso_pu_bacteria 2791355266 2793362489 242
127 iso_pu_bacteria 2802429268 2804751456 242
128 iso_pu_bacteria 2838680041 2838683162 242
129 iso_pu_bacteria 2838694306 2838697894 242
130 iso_pu_bacteria 2838707686 2838711009 242
131 iso_pu_bacteria 2842077413 2842079184 242
132 iso_pu_bacteria 2842118031 2842118305 242
133 iso_pu_bacteria 2842217011 2842218234 242
134 iso_pu_bacteria 2842237096 2842240219 242
135 iso_pu_bacteria 2842291075 2842292846 242
136 iso_pu_bacteria 2842370503 2842373792 242
137 iso_pu_bacteria 2842377471 2842379243 242
138 iso_pu_bacteria 2842384541 2842384816 242
139 iso_pu_bacteria 2842395702 2842400055 242
140 iso_pu_bacteria 2842521101 2842526225 242
141 iso_pu_bacteria 2844163670 2844168398 242
142 iso_pu_bacteria 2850079185 2850080589 242
143 iso_pu_bacteria 2891048133 2891051198 242
144 iso_pu_bacteria 2896384573 2896386750 242
145 iso_pu_bacteria 2913295892 2913297292 242
146 iso_pu_bacteria 2920822456 2920823955 242
147 iso_pu_bacteria 2929138655 2929141073 242
148 iso_pu_bacteria 2935894831 2935896721 242
149 iso_pu_bacteria 2936381700 2936388140 242
150 iso_pu_bacteria 2941499720 2941500097 242
151 iso_pu_bacteria 2995392953 2995396535 242
152 iso_pu_bacteria 639633055 639649458 242
153 iso_pu_bacteria 8005658619 8005658812 242
154 iso_pu_bacteria 8018150411 8018151285 242
155 iso_pu_bacteria 8024486573 8024488317 242
156 iso_pu_bacteria 8049293176 8049294108 242
157 iso_pu_bacteria 8055431914 8055432355 242
158 iso_pu_bacteria 8057575449 8057576688 242
159 3300003316 rootH1_10123121 rootH1_101231212 243
160 3300005328 Ga0070676_10461303 Ga0070676_104613031 244
161 3300005330 Ga0070690_100265045 Ga0070690_1002650452 244
162 3300005347 Ga0070668_100099650 Ga0070668_1000996502 244
163 3300005355 Ga0070671_100345249 Ga0070671_1003452492 244
164 3300005455 Ga0070663_100179665 Ga0070663_1001796651 244
165 3300005539 Ga0068853_100481860 Ga0068853_1004818602 244
166 3300005548 Ga0070665_100330828 Ga0070665_1003308282 244
167 3300005563 Ga0068855_100218111 Ga0068855_1002181112 244
168 3300005564 Ga0070664_100281380 Ga0070664_1002813801 244
169 3300005577 Ga0068857_100649468 Ga0068857_1006494681 244
170 3300005841 Ga0068863_100130250 Ga0068863_1001302503 244
171 3300005843 Ga0068860_100000210 Ga0068860_10000021047 244
172 3300005843 Ga0068860_100469490 Ga0068860_1004694902 244
173 3300006175 Ga0070712_100727474 Ga0070712_1007274741 244
174 3300006846 Ga0075430_100062685 Ga0075430_1000626852 244
175 3300006881 Ga0068865_100069118 Ga0068865_1000691182 244
176 3300009101 Ga0105247_10015020 Ga0105247_100150202 244
177 3300009545 Ga0105237_10052071 Ga0105237_100520712 244
178 3300009545 Ga0105237_10062066 Ga0105237_100620663 244
179 3300013104 Ga0157370_10222128 Ga0157370_102221283 244
180 3300013296 Ga0157374_10656852 Ga0157374_106568521 244
181 3300013306 Ga0163162_10455308 Ga0163162_104553082 244
182 3300013308 Ga0157375_10037790 Ga0157375_100377905 244
183 3300014325 Ga0163163_10319968 Ga0163163_103199682 244
184 3300014969 Ga0157376_10165800 Ga0157376_101658001 244
185 3300025914 Ga0207671_10066371 Ga0207671_100663711 244
186 3300025945 Ga0207679_10132332 Ga0207679_101323322 244
187 3300025949 Ga0207667_10409767 Ga0207667_104097671 244
188 3300026023 Ga0207677_10163785 Ga0207677_101637852 244
189 3300026041 Ga0207639_10370097 Ga0207639_103700971 244
190 3300026116 Ga0207674_10629378 Ga0207674_106293781 244
191 3300026121 Ga0207683_10154566 Ga0207683_101545661 244
192 3300028381 Ga0268264_10000233 Ga0268264_1000023364 244
193 3300031507 Ga0307509_10013280 Ga0307509_100132802 244
194 3300031730 Ga0307516_10015237 Ga0307516_100152374 244
195 3300033179 Ga0307507_10115817 Ga0307507_101158172 244
196 3300035695 Ga0373927_0026661 Ga0373927_0026661_403_1137 244
197 3300037068 Ga0373925_0035593 Ga0373925_0035593_2308_3042 244
198 3300037471 Ga0395905_0136298 Ga0395905_0136298_317_1063 244
199 3300044658 Ga0466972_0001603 Ga0466972_0001603_7025_7771 244
200 3300046477 Ga0495664_0033131 Ga0495664_0033131_1377_2111 244
201 3300046507 Ga0495606_0002753 Ga0495606_0002753_2394_3128 244
202 3300046507 Ga0495606_0162534 Ga0495606_0162534_183_935 244
203 3300046515 Ga0495620_0086539 Ga0495620_0086539_59_796 244
204 3300046557 Ga0495622_0008356 Ga0495622_0008356_1135_1887 244
205 3300046557 Ga0495622_0098684 Ga0495622_0098684_337_1071 244
206 3300046615 Ga0495656_0022417 Ga0495656_0022417_158_892 244
207 3300046616 Ga0495668_0275411 Ga0495668_0275411_139_891 244
208 3300046660 Ga0495625_0124530 Ga0495625_0124530_626_1378 244
209 3300046665 Ga0495661_0068065 Ga0495661_0068065_962_1714 244
210 3300046674 Ga0495588_0050582 Ga0495588_0050582_1019_1771 244
211 3300046692 Ga0495671_0071878 Ga0495671_0071878_342_1094 244
212 3300048903 Ga0496100_0084113 Ga0496100_0084113_587_1339 244
213 3300048904 Ga0496101_0088016 Ga0496101_0088016_137_889 244
214 3300048904 Ga0496101_0302099 Ga0496101_0302099_466_1200 244
215 3300048908 Ga0496105_0028032 Ga0496105_0028032_1144_1896 244
216 3300048909 Ga0496106_0001152 Ga0496106_0001152_15860_16594 244
217 3300048917 Ga0496114_0063158 Ga0496114_0063158_337_1089 244
218 3300048917 Ga0496114_0157580 Ga0496114_0157580_426_1160 244
219 3300048917 Ga0496114_0164207 Ga0496114_0164207_1135_1896 244
220 3300048920 Ga0496117_0015458 Ga0496117_0015458_2516_3250 244
221 3300048924 Ga0496121_0000994 Ga0496121_0000994_22278_23012 244
222 3300048924 Ga0496121_0038632 Ga0496121_0038632_3312_4064 244
223 3300048927 Ga0496124_0002590 Ga0496124_0002590_15047_15781 244
224 3300048927 Ga0496124_0178486 Ga0496124_0178486_114_866 244
225 3300048929 Ga0496126_0010739 Ga0496126_0010739_53_787 244
226 3300050491 nmdc:mga00v17_92464_c1 nmdc:mga00v17_92464_c1_159_953 244
227 3300050509 nmdc:mga0qj67_114032_c1 nmdc:mga0qj67_114032_c1_1243_1977 244
228 3300053085 Ga0495619_0021277 Ga0495619_0021277_2079_2813 244
229 3300053094 Ga0500566_0139487 Ga0500566_0139487_433_1167 244
230 3300053140 Ga0500573_0117580 Ga0500573_0117580_199_933 244
231 3300053150 Ga0500603_054531 Ga0500603_054531_181_915 244
232 3300053177 Ga0500636_0082871 Ga0500636_0082871_291_1025 244
233 3300006846 Ga0075430_100010896 Ga0075430_1000108965 245
234 3300006847 Ga0075431_100009339 Ga0075431_1000093395 245
235 3300009147 Ga0114129_10179928 Ga0114129_101799282 245
236 3300025273 Ga0209673_1016727 Ga0209673_10167275 245
237 3300025284 Ga0209130_1013211 Ga0209130_10132112 245
238 3300035695 Ga0373927_0000419 Ga0373927_0000419_13710_14447 245
239 3300037068 Ga0373925_0013435 Ga0373925_0013435_4835_5572 245
240 3300037471 Ga0395905_0000788 Ga0395905_0000788_23772_24509 245
241 3300037471 Ga0395905_0019959 Ga0395905_0019959_117_854 245
242 3300046460 Ga0495638_0122099 Ga0495638_0122099_99_836 245
243 3300048924 Ga0496121_0164699 Ga0496121_0164699_422_1159 245
244 3300050507 nmdc:mga05p37_94992_c1 nmdc:mga05p37_94992_c1_417_1157 245
245 3300050510 nmdc:mga06r32_14842_c1 nmdc:mga06r32_14842_c1_4401_5141 245
246 3300053088 Ga0500644_0007474 Ga0500644_0007474_107_844 245
247 3300053136 Ga0500559_0015773 Ga0500559_0015773_753_1490 245
248 3300053156 Ga0500622_0000821 Ga0500622_0000821_15617_16354 245
249 iso_pu_bacteria 2758568016 2758641007 245
250 iso_pu_bacteria 2854911287 2854914353 245
251 3300002987 JGI25159J45721_1000002 JGI25159J45721_1000002119 246
252 3300003187 JGI25151J46595_10037770 JGI25151J46595_100377701 246
253 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001335 246
254 3300003354 JGI25160J50197_1000008 JGI25160J50197_1000008119 246
255 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001425 246
256 3300003374 JGI25161J50226_1001600 JGI25161J50226_10016005 246
257 3300003578 Ga0006562J51391_1004592 Ga0006562J51391_10045923 246
258 3300003578 Ga0006562J51391_1004595 Ga0006562J51391_10045953 246
259 3300003771 Ga0055526_1000738 Ga0055526_100073813 246
260 3300003771 Ga0055526_1003643 Ga0055526_10036434 246
261 3300003775 Ga0055524_1000570 Ga0055524_10005703 246
262 3300003775 Ga0055524_1039788 Ga0055524_10397882 246
263 3300003781 Ga0055536_1010378 Ga0055536_10103784 246
264 3300003790 Ga0055528_1000707 Ga0055528_10007074 246
265 3300003792 Ga0055540_1035761 Ga0055540_10357611 246
266 3300004625 Ga0055543_1000027 Ga0055543_100002714 246
267 3300004625 Ga0055543_1000216 Ga0055543_100021612 246
268 3300005262 Ga0065165_1000008 Ga0065165_1000008120 246
269 3300005262 Ga0065165_1000015 Ga0065165_1000015120 246
270 3300005330 Ga0070690_100452343 Ga0070690_1004523431 246
271 3300005937 Ga0081455_10040768 Ga0081455_100407683 246
272 3300006051 Ga0075364_10015660 Ga0075364_100156602 246
273 3300013249 Ga0171463_1001 Ga0171463_1001110 246
274 3300015690 Ga0183363_1082 Ga0183363_108213 246
275 3300021320 Ga0214544_1000017 Ga0214544_100001735 246
276 3300021321 Ga0214542_1018163 Ga0214542_10181634 246
277 3300021327 Ga0214543_1000003 Ga0214543_1000003589 246
278 3300025208 Ga0209436_100920 Ga0209436_1009203 246
279 3300025230 Ga0209563_105310 Ga0209563_1053105 246
280 3300025273 Ga0209673_1000025 Ga0209673_1000025150 246
281 3300025284 Ga0209130_1000003 Ga0209130_1000003440 246
282 3300025284 Ga0209130_1000007 Ga0209130_1000007183 246
283 3300025292 Ga0209676_1019549 Ga0209676_10195493 246
284 3300025294 Ga0209025_1000943 Ga0209025_100094325 246
285 3300025294 Ga0209025_1049479 Ga0209025_10494792 246
286 3300025295 Ga0209564_1000330 Ga0209564_100033066 246
287 3300025295 Ga0209564_1000672 Ga0209564_100067221 246
288 3300025298 Ga0209050_1016394 Ga0209050_10163942 246
289 3300025299 Ga0209256_1000445 Ga0209256_100044554 246
290 3300025299 Ga0209256_1000914 Ga0209256_100091410 246
291 3300025299 Ga0209256_1002049 Ga0209256_10020493 246
292 3300025302 Ga0207426_1000011 Ga0207426_1000011336 246
293 3300025302 Ga0207426_1000064 Ga0207426_1000064183 246
294 3300025304 Ga0209257_1001197 Ga0209257_10011973 246
295 3300026041 Ga0207639_10094766 Ga0207639_100947662 246
296 3300031456 Ga0307513_10235565 Ga0307513_102355651 246
297 3300031649 Ga0307514_10123702 Ga0307514_101237022 246
298 3300031901 Ga0307406_10005188 Ga0307406_100051888 246
299 3300039062 Ga0400483_258307 Ga0400483_258307_1996_2736 246
300 3300041404 Ga0439436_0013269 Ga0439436_0013269_140_883 246
301 3300041407 Ga0439447_019692 Ga0439447_019692_250_993 246
302 3300041413 Ga0439465_0002707 Ga0439465_0002707_539_1282 246
303 3300044842 Ga0466957_0090946 Ga0466957_0090946_1129_1869 246
304 3300045051 Ga0451576_0849810 Ga0451576_0849810_52_792 246
305 3300046506 Ga0495583_0003748 Ga0495583_0003748_5435_6175 246
306 3300046660 Ga0495625_0303854 Ga0495625_0303854_36_776 246
307 3300047320 Ga0495672_0026891 Ga0495672_0026891_1258_2058 246
308 3300048919 Ga0496116_0022826 Ga0496116_0022826_995_1735 246
309 3300048919 Ga0496116_0154728 Ga0496116_0154728_22_762 246
310 3300048920 Ga0496117_0020448 Ga0496117_0020448_1470_2210 246
311 3300048920 Ga0496117_0025317 Ga0496117_0025317_2206_2946 246
312 3300048920 Ga0496117_0063190 Ga0496117_0063190_1125_1865 246
313 3300048921 Ga0496118_0004636 Ga0496118_0004636_12641_13381 246
314 3300048921 Ga0496118_0025136 Ga0496118_0025136_2588_3340 246
315 3300048921 Ga0496118_0027341 Ga0496118_0027341_1079_1819 246
316 3300048921 Ga0496118_0163968 Ga0496118_0163968_548_1288 246
317 3300048922 Ga0496119_0009801 Ga0496119_0009801_2156_2914 246
318 3300048922 Ga0496119_0041203 Ga0496119_0041203_1411_2151 246
319 3300048922 Ga0496119_0046592 Ga0496119_0046592_1552_2292 246
320 3300048922 Ga0496119_0046892 Ga0496119_0046892_45_785 246
321 3300048922 Ga0496119_0116831 Ga0496119_0116831_666_1406 246
322 3300048923 Ga0496120_0058772 Ga0496120_0058772_199_939 246
323 3300048923 Ga0496120_0109037 Ga0496120_0109037_567_1307 246
324 3300048924 Ga0496121_0000003 Ga0496121_0000003_616366_617106 246
325 3300048924 Ga0496121_0015887 Ga0496121_0015887_3699_4439 246
326 3300048924 Ga0496121_0020642 Ga0496121_0020642_2809_3549 246
327 3300048924 Ga0496121_0161895 Ga0496121_0161895_496_1236 246
328 3300048925 Ga0496122_0093691 Ga0496122_0093691_911_1651 246
329 3300048926 Ga0496123_0037700 Ga0496123_0037700_791_1531 246
330 3300048927 Ga0496124_0006920 Ga0496124_0006920_10178_10918 246
331 3300048927 Ga0496124_0236481 Ga0496124_0236481_432_1172 246
332 3300048927 Ga0496124_0309583 Ga0496124_0309583_190_930 246
333 3300048928 Ga0496125_0000136 Ga0496125_0000136_75514_76254 246
334 3300048928 Ga0496125_0001144 Ga0496125_0001144_15791_16531 246
335 3300048928 Ga0496125_0146191 Ga0496125_0146191_202_960 246
336 3300048929 Ga0496126_0063322 Ga0496126_0063322_316_1056 246
337 3300048929 Ga0496126_0073948 Ga0496126_0073948_769_1527 246
338 3300048929 Ga0496126_0127236 Ga0496126_0127236_433_1173 246
339 3300049460 Ga0495682_0056906 Ga0495682_0056906_109_849 246
340 3300049570 Ga0501033_0002870 Ga0501033_0002870_8384_9124 246
341 3300049822 Ga0501035_0006588 Ga0501035_0006588_7358_8098 246
342 3300050511 nmdc:mga08y16_383978_c1 nmdc:mga08y16_383978_c1_352_1128 246
343 3300053161 Ga0500634_0027421 Ga0500634_0027421_601_1341 246
344 3300053177 Ga0500636_0003370 Ga0500636_0003370_6377_7117 246
345 3300053177 Ga0500636_0137843 Ga0500636_0137843_218_958 246
346 3300053177 Ga0500636_0188848 Ga0500636_0188848_15_755 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

42

233

0.8

PF00149

Metallophos

Calcineurin-like phosphoesterase

42

198

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dm3-assembly1.cif.gz_A crystal structure of the sh2 domain from ravo (lpg1129) from legionella pneumophila, apoprotein 0.8109 197 220
2gju-assembly1.cif.gz_B crystal structure of hypothetical protein ph1004 from pyrococcus horikoshii ot3 0.7823 2 244
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.776 1 241
1nnw-assembly1.cif.gz_A hypothetical protein from pyrococcus furiosus pfu-1218608 0.7748 1 244
2dfj-assembly1.cif.gz_B crystal structure of the diadenosine tetraphosphate hydrolase from shigella flexneri 2a 0.7706 3 113
ID Description Score Start End Superfamily
af_Q9VSQ5_245_342_2.170.140.10 Mainly Beta;Beta Complex;Antimicrobial Protein, Tachycitin; Chain A;Chitin binding domain 0.7809 199 218 2.170.140.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.776 1 241 3.60.21.10
af_A4HXD2_23_308_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7737 32 113 3.60.21.10
3qfnB00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7588 1 241 3.60.21.10
af_Q58322_5_243_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7575 3 244 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A1G5VR41-F1-model_v4 deleted 0.9992 1 246
AF-S5RZK7-F1-model_v4 deleted 0.9927 1 246
AF-A0A4Z1Q0Q9-F1-model_v4 deleted 0.9914 1 246
AF-B9AY42-F1-model_v4 deleted 0.9893 1 243
AF-K0VXQ5-F1-model_v4 Metallophosphoesterase 0.9892 85 246

Feature Viewer

pLDDT pTM Quality
97 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map