F416721

General Info

Members Datasets Scaffolds Average Seq Length
346 221 345 300

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100023412|Ga0075428_1000234122
Length 332
Sequence MQLASSASETRAAAGESIGASELYSARIDQKMSDLPFGRPAEFEQRVNCAAPGAGIWFVVRGAELLVEMGPPDPRPSDDPRVRQRPSWARLPLQKNHNWLGEGALRTLYLGRLGGTDCWAAELAADAAAPAAGLSWEGLRALFSVLDDRHFALAGRALQLLEWDRTHQFCGRCGTRTEAHASERVRTCPACKLPAYPRVAPAVMALVKRERQLLLARSPHFPPGMYSALAGFAEPGESLEQCLAREVEEEVGVRISNTRYFDSQSWPFPHSLMIAFVCDWESGEIRPQAEEIEAANWFDVLQLPKLPSRISIARRLIDAISAQIRGEFANGR

Samples

Sample ID Description Type Environment
1 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
117 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
120 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
136 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
137 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
146 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
147 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
151 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
152 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
200 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
201 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.29
Rhizosphere 99.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10011247 3300005295 Bacteria 2069
2 Ga0070690_100001157 3300005330 Bacteria 13587
3 Ga0070690_100022006 3300005330 Bacteria 3898
4 Ga0068869_100001622 3300005334 Bacteria 13384
5 Ga0070666_10105536 3300005335 Bacteria 1946
6 Ga0070680_100005617 3300005336 Bacteria 9498
7 Ga0070680_100175412 3300005336 Bacteria 1804
8 Ga0070682_100004880 3300005337 Bacteria 7444
9 Ga0068868_100183236 3300005338 Bacteria 1738
10 Ga0070689_100002764 3300005340 Bacteria 11513
11 Ga0070691_10008355 3300005341 Bacteria 4741
12 Ga0070691_10025921 3300005341 Bacteria 2732
13 Ga0070687_100006386 3300005343 Bacteria 4827
14 Ga0070687_100102274 3300005343 Bacteria 1606
15 Ga0070692_10000341 3300005345 Bacteria 13580
16 Ga0070692_10045746 3300005345 Bacteria 2259
17 Ga0070673_100177616 3300005364 Bacteria 1821
18 Ga0070703_10006645 3300005406 Bacteria 3238
19 Ga0070710_10078149 3300005437 Bacteria 1925
20 Ga0070701_10001141 3300005438 Bacteria 9693
21 Ga0070711_100076378 3300005439 Bacteria 2375
22 Ga0070705_100001675 3300005440 Bacteria 11598
23 Ga0070705_100012474 3300005440 Bacteria 4321
24 Ga0070705_100080742 3300005440 Bacteria 1996
25 Ga0070705_100166828 3300005440 Bacteria 1478
26 Ga0070700_100000928 3300005441 Bacteria 14495
27 Ga0070694_100003407 3300005444 Bacteria 9529
28 Ga0070694_100013529 3300005444 Bacteria 5097
29 Ga0070694_100144575 3300005444 Bacteria 1731
30 Ga0070694_100302675 3300005444 Bacteria 1226
31 Ga0070678_100395712 3300005456 Bacteria 1199
32 Ga0070681_10021998 3300005458 Bacteria 6398
33 Ga0068867_100003213 3300005459 Bacteria 11518
34 Ga0070699_100412608 3300005518 Bacteria 1222
35 Ga0070679_100034682 3300005530 Bacteria 5002
36 Ga0070684_100174867 3300005535 Bacteria 1951
37 Ga0070697_100003682 3300005536 Bacteria 11788
38 Ga0070686_100003463 3300005544 Bacteria 8651
39 Ga0070686_100106545 3300005544 Bacteria 1902
40 Ga0070695_100000820 3300005545 Bacteria 16744
41 Ga0070695_100007473 3300005545 Bacteria 6472
42 Ga0070695_100026687 3300005545 Bacteria 3575
43 Ga0070696_100001264 3300005546 Bacteria 16422
44 Ga0070696_100002905 3300005546 Bacteria 11390
45 Ga0070696_100009349 3300005546 Bacteria 6562
46 Ga0070693_100000900 3300005547 Bacteria 13241
47 Ga0070693_100126985 3300005547 Bacteria 1589
48 Ga0070704_100003116 3300005549 Bacteria 9461
49 Ga0070704_100028143 3300005549 Bacteria 3735
50 Ga0070704_100118580 3300005549 Bacteria 2028
51 Ga0070704_100156542 3300005549 Bacteria 1797
52 Ga0068855_100006437 3300005563 Bacteria 14296
53 Ga0068854_100019844 3300005578 Bacteria 4537
54 Ga0068856_100097650 3300005614 Bacteria 2927
55 Ga0070702_100000546 3300005615 Bacteria 13658
56 Ga0068852_100010288 3300005616 Bacteria 6981
57 Ga0068859_100027170 3300005617 Bacteria 5742
58 Ga0068859_100068172 3300005617 Bacteria 3593
59 Ga0068864_100138828 3300005618 Bacteria 2191
60 Ga0068866_10000771 3300005718 Bacteria 14404
61 Ga0068861_100003717 3300005719 Bacteria 10182
62 Ga0068858_100038078 3300005842 Bacteria 4460
63 Ga0068858_100173566 3300005842 Bacteria 2034
64 Ga0068860_100010334 3300005843 Bacteria 9230
65 Ga0068862_100007785 3300005844 Bacteria 8858
66 Ga0081539_10000226 3300005985 Bacteria 132618
67 Ga0097621_100001880 3300006237 Bacteria 14378
68 Ga0097621_100003852 3300006237 Bacteria 10388
69 Ga0068871_100002226 3300006358 Bacteria 13179
70 Ga0068871_100004152 3300006358 Bacteria 10024
71 Ga0075428_100007527 3300006844 Bacteria 12072
72 Ga0075428_100023412 3300006844 Bacteria 6835
73 Ga0075428_100215729 3300006844 Bacteria 2073
74 Ga0075430_100000319 3300006846 Bacteria 34222
75 Ga0075430_100007367 3300006846 Bacteria 9295
76 Ga0075430_100009379 3300006846 Bacteria 8271
77 Ga0075430_100168018 3300006846 Bacteria 1825
78 Ga0075431_100017011 3300006847 Bacteria 7384
79 Ga0075431_100033056 3300006847 Bacteria 5330
80 Ga0075431_100058555 3300006847 Bacteria 3976
81 Ga0075433_10019400 3300006852 Bacteria 5666
82 Ga0075433_10027260 3300006852 Bacteria 4843
83 Ga0075434_100000003 3300006871 Bacteria 134839
84 Ga0075434_100008610 3300006871 Bacteria 9498
85 Ga0075434_100044940 3300006871 Bacteria 4381
86 Ga0075434_100225341 3300006871 Bacteria 1894
87 Ga0075434_100541888 3300006871 Bacteria 1184
88 Ga0075429_100000541 3300006880 Bacteria 28764
89 Ga0075429_100020748 3300006880 Bacteria 5702
90 Ga0075429_100035429 3300006880 Bacteria 4340
91 Ga0068865_100001117 3300006881 Bacteria 15501
92 Ga0075436_100000319 3300006914 Bacteria 30723
93 Ga0075436_100002850 3300006914 Bacteria 11844
94 Ga0075436_100163933 3300006914 Bacteria 1567
95 Ga0097620_100027170 3300006931 Bacteria 5742
96 Ga0097620_100051173 3300006931 Bacteria 4151
97 Ga0097620_100068175 3300006931 Bacteria 3593
98 Ga0075435_100000936 3300007076 Bacteria 18414
99 Ga0075435_100031722 3300007076 Bacteria 4166
100 Ga0075435_100063672 3300007076 Bacteria 2995
101 Ga0075435_100197543 3300007076 Bacteria 1704
102 Ga0099794_10002480 3300007265 Bacteria 6808
103 Ga0099794_10046375 3300007265 Bacteria 2082
104 Ga0099794_10132738 3300007265 Bacteria 1258
105 Ga0105240_10446726 3300009093 Bacteria 1448
106 Ga0105245_10005564 3300009098 Bacteria 11069
107 Ga0105245_10103308 3300009098 Bacteria 2640
108 Ga0114129_10020624 3300009147 Bacteria 9370
109 Ga0114129_10070185 3300009147 Bacteria 4884
110 Ga0105243_10001939 3300009148 Bacteria 17619
111 Ga0105242_10000677 3300009176 Bacteria 26743
112 Ga0105248_10126812 3300009177 Bacteria 2879
113 Ga0105249_10003305 3300009553 Bacteria 13970
114 Ga0157371_10288943 3300013102 Bacteria 1185
115 Ga0157369_10119525 3300013105 Bacteria 2796
116 Ga0157378_10003485 3300013297 Bacteria 13970
117 Ga0163162_10196864 3300013306 Bacteria 2144
118 Ga0157372_10119100 3300013307 Bacteria 3030
119 Ga0157380_10167482 3300014326 Bacteria 1916
120 Ga0157380_10730254 3300014326 Bacteria 999
121 Ga0157377_10041401 3300014745 Bacteria 2556
122 Ga0157379_10147815 3300014968 Bacteria 2119
123 Ga0157376_10005582 3300014969 Bacteria 8802
124 Ga0163161_10100884 3300017792 Bacteria 2149
125 Ga0207653_10004007 3300025885 Bacteria 4632
126 Ga0207642_10000358 3300025899 Bacteria 13689
127 Ga0207680_10141361 3300025903 Bacteria 1596
128 Ga0207707_10025321 3300025912 Bacteria 5190
129 Ga0207707_10091023 3300025912 Bacteria 2666
130 Ga0207663_10115712 3300025916 Bacteria 1827
131 Ga0207660_10005127 3300025917 Bacteria 8524
132 Ga0207660_10076330 3300025917 Bacteria 2450
133 Ga0207660_10175371 3300025917 Bacteria 1662
134 Ga0207660_10230640 3300025917 Bacteria 1456
135 Ga0207662_10000510 3300025918 Bacteria 17391
136 Ga0207652_10013047 3300025921 Bacteria 6725
137 Ga0207681_10000018 3300025923 Bacteria 278874
138 Ga0207681_10066523 3300025923 Bacteria 2495
139 Ga0207687_10001855 3300025927 Bacteria 14539
140 Ga0207687_10055000 3300025927 Bacteria 2787
141 Ga0207644_10190179 3300025931 Bacteria 1614
142 Ga0207686_10000783 3300025934 Bacteria 19543
143 Ga0207686_10004195 3300025934 Bacteria 7732
144 Ga0207709_10002715 3300025935 Bacteria 10936
145 Ga0207670_10054715 3300025936 Bacteria 2694
146 Ga0207670_10276323 3300025936 Bacteria 1308
147 Ga0207704_10002941 3300025938 Bacteria 7692
148 Ga0207704_10301868 3300025938 Unclassified 1227
149 Ga0207711_10063200 3300025941 Bacteria 3195
150 Ga0207711_10202400 3300025941 Bacteria 1812
151 Ga0207689_10002293 3300025942 Bacteria 17915
152 Ga0207667_10022946 3300025949 Bacteria 6880
153 Ga0207651_10199555 3300025960 Bacteria 1602
154 Ga0207712_10002280 3300025961 Bacteria 12458
155 Ga0207640_10014950 3300025981 Bacteria 4480
156 Ga0207703_10006334 3300026035 Bacteria 9461
157 Ga0207703_10047715 3300026035 Bacteria 3454
158 Ga0207708_10004095 3300026075 Bacteria 10727
159 Ga0207648_10001935 3300026089 Bacteria 22645
160 Ga0207676_10095558 3300026095 Bacteria 2451
161 Ga0207675_100006748 3300026118 Bacteria 10854
162 Ga0207683_10312242 3300026121 Bacteria 1439
163 Ga0207698_10013301 3300026142 Bacteria 5425
164 Ga0209969_1001584 3300027360 Bacteria 3140
165 Ga0209967_1000258 3300027364 Bacteria 7269
166 Ga0209999_1002002 3300027543 Bacteria 3554
167 Ga0209970_1009183 3300027614 Bacteria 1618
168 Ga0209983_1002270 3300027665 Bacteria 4221
169 Ga0209588_1038700 3300027671 Bacteria 1537
170 Ga0209588_1063567 3300027671 Bacteria 1193
171 Ga0209971_1001159 3300027682 Bacteria 6645
172 Ga0209966_1004970 3300027695 Bacteria 2271
173 Ga0207428_10001393 3300027907 Bacteria 25520
174 Ga0268265_10006484 3300028380 Bacteria 7930
175 Ga0268264_10006985 3300028381 Bacteria 9474
176 Ga0307408_100100921 3300031548 Bacteria 2199
177 Ga0316575_10005789 3300031665 Bacteria 4414
178 Ga0316575_10010522 3300031665 Bacteria 3402
179 Ga0316579_10010783 3300031691 Bacteria 3870
180 Ga0307415_100454745 3300032126 Bacteria 1108
181 Ga0316583_10027836 3300032133 Bacteria 2017
182 Ga0373948_0010029 3300034817 Bacteria 1645
183 Ga0373950_0006495 3300034818 Bacteria 1786
184 Ga0373958_0007095 3300034819 Bacteria 1772
185 Ga0373926_0016288 3300035083 Bacteria 2540
186 Ga0373929_0005102 3300035085 Bacteria 2360
187 Ga0373940_0006016 3300035088 Bacteria 2665
188 Ga0373944_0009432 3300035089 Bacteria 2647
189 Ga0373951_0011200 3300035091 Bacteria 2011
190 Ga0373923_0016669 3300035111 Bacteria 2797
191 Ga0373932_0001005 3300035112 Bacteria 8155
192 Ga0373939_0013247 3300035114 Bacteria 2118
193 Ga0373939_0015591 3300035114 Bacteria 1991
194 Ga0373945_0004452 3300035116 Bacteria 4453
195 Ga0373954_0000003 3300035118 Bacteria 137757
196 Ga0373956_0103598 3300035119 Bacteria 1322
197 Ga0373960_0028800 3300035121 Bacteria 1535
198 Ga0373960_0052928 3300035121 Bacteria 1210
199 Ga0373942_0011970 3300035207 Bacteria 2064
200 Ga0373961_0002613 3300035241 Bacteria 4634
201 Ga0316574_0104601 3300035398 Unclassified 1812
202 Ga0373931_0000240 3300035691 Bacteria 23366
203 Ga0373931_0017725 3300035691 Bacteria 3527
204 Ga0373931_0027859 3300035691 Bacteria 2888
205 Ga0373931_0063556 3300035691 Bacteria 1995
206 Ga0373931_0177136 3300035691 Bacteria 1260
207 Ga0373935_0085408 3300035692 Bacteria 2057
208 Ga0373935_0190636 3300035692 Bacteria 1412
209 Ga0373927_0212643 3300035695 Bacteria 1270
210 Ga0373933_0004738 3300035724 Bacteria 7435
211 Ga0373947_0032411 3300035725 Bacteria 3079
212 Ga0373937_0017645 3300036401 Bacteria 6366
213 Ga0373937_0018326 3300036401 Bacteria 6250
214 Ga0373937_0021985 3300036401 Bacteria 5728
215 Ga0373937_0045273 3300036401 Bacteria 4021
216 Ga0316582_0003721 3300036647 Bacteria 7551
217 Ga0316581_0017568 3300037588 Bacteria 2067
218 Ga0451807_2729594 3300041486 Bacteria 2255
219 Ga0439441_003430 3300042001 Bacteria 2337
220 Ga0439446_0043365 3300042156 Bacteria 1329
221 Ga0439435_0003877 3300042436 Bacteria 3164
222 Ga0439444_0003852 3300042437 Bacteria 2146
223 Ga0439459_0018326 3300042438 Bacteria 1315
224 Ga0439460_0000050 3300042461 Bacteria 17511
225 Ga0451577_0061533 3300042876 Bacteria 3348
226 Ga0466963_0161827 3300044694 Bacteria 1558
227 Ga0466968_0034928 3300044735 Bacteria 2101
228 Ga0451576_0009620 3300045051 Bacteria 11183
229 Ga0451576_0590411 3300045051 Bacteria 1167
230 Ga0466967_0049205 3300045976 Bacteria 3685
231 Ga0495629_0501805 3300046459 Bacteria 818
232 Ga0495639_0011830 3300046475 Bacteria 3763
233 Ga0495662_0105475 3300046476 Bacteria 1379
234 Ga0495584_0058631 3300046491 Bacteria 1937
235 Ga0495608_0000643 3300046511 Bacteria 24055
236 Ga0495618_0023774 3300046514 Bacteria 3792
237 Ga0495628_0002765 3300046516 Bacteria 15713
238 Ga0495628_0170104 3300046516 Bacteria 1653
239 Ga0495630_0350720 3300046517 Bacteria 1129
240 Ga0495630_0374368 3300046517 Bacteria 1090
241 Ga0495666_0129339 3300046526 Bacteria 1180
242 Ga0495642_0027048 3300046528 Bacteria 2281
243 Ga0495652_0104683 3300046529 Bacteria 2288
244 Ga0495665_0004585 3300046531 Bacteria 7461
245 Ga0495640_0002870 3300046533 Bacteria 13875
246 Ga0495640_0282076 3300046533 Bacteria 1034
247 Ga0495586_0000323 3300046535 Bacteria 30293
248 Ga0495586_0016362 3300046535 Bacteria 3945
249 Ga0495621_0018847 3300046539 Bacteria 2246
250 Ga0495645_0009807 3300046543 Bacteria 6701
251 Ga0495635_0073800 3300046663 Bacteria 2337
252 Ga0495635_0099224 3300046663 Bacteria 1990
253 Ga0495635_0099744 3300046663 Bacteria 1985
254 Ga0495599_0013647 3300046678 Bacteria 5021
255 Ga0495647_0001902 3300046681 Bacteria 6498
256 Ga0495658_0014201 3300046683 Bacteria 4064
257 Ga0495658_0028817 3300046683 Bacteria 3000
258 Ga0495669_0005684 3300046684 Bacteria 5202
259 Ga0495600_0068213 3300046809 Bacteria 2324
260 Ga0495604_0038317 3300047317 Bacteria 3771
261 Ga0495674_0301027 3300047319 Bacteria 1310
262 Ga0495680_0002278 3300047322 Bacteria 19760
263 Ga0501031_0287271 3300049568 Bacteria 1067
264 Ga0501032_0096720 3300049569 Bacteria 1957
265 Ga0501033_0002408 3300049570 Bacteria 15915
266 Ga0501036_0006130 3300049572 Bacteria 9754
267 Ga0501036_0029144 3300049572 Bacteria 4666
268 Ga0501036_0115142 3300049572 Bacteria 2272
269 Ga0501037_0015252 3300049573 Bacteria 5654
270 Ga0501038_0001672 3300049574 Bacteria 20558
271 Ga0501039_0000763 3300049575 Bacteria 23161
272 Ga0501039_0364412 3300049575 Bacteria 1135
273 Ga0501040_0006391 3300049576 Bacteria 7650
274 Ga0501040_0088021 3300049576 Bacteria 2156
275 Ga0501041_0000591 3300049577 Bacteria 18966
276 Ga0501041_0003508 3300049577 Bacteria 9028
277 Ga0501042_0010967 3300049578 Bacteria 6100
278 Ga0501046_0000247 3300049580 Bacteria 55379
279 Ga0501046_0037698 3300049580 Bacteria 3884
280 Ga0501048_0000787 3300049582 Bacteria 23234
281 Ga0501068_0030206 3300049584 Bacteria 3213
282 Ga0501070_0102708 3300049586 Bacteria 2364
283 Ga0501071_0008499 3300049587 Bacteria 6790
284 Ga0501071_0020662 3300049587 Bacteria 4579
285 Ga0501071_0059451 3300049587 Bacteria 2766
286 Ga0501071_0158229 3300049587 Bacteria 1692
287 Ga0501072_0000333 3300049588 Bacteria 33584
288 Ga0501072_0005156 3300049588 Bacteria 9939
289 Ga0501072_0032975 3300049588 Bacteria 4057
290 Ga0501072_0042304 3300049588 Bacteria 3579
291 Ga0501074_0010536 3300049590 Bacteria 6707
292 Ga0501074_0143402 3300049590 Bacteria 1708
293 Ga0501075_0000564 3300049591 Bacteria 22512
294 Ga0501075_0000988 3300049591 Bacteria 18130
295 Ga0501075_0139312 3300049591 Bacteria 1848
296 Ga0501076_0010610 3300049592 Bacteria 6841
297 Ga0501076_0159114 3300049592 Bacteria 1839
298 Ga0501077_0000223 3300049593 Bacteria 33258
299 Ga0501079_0000889 3300049741 Bacteria 20471
300 Ga0501079_0006894 3300049741 Bacteria 8559
301 Ga0501079_0082411 3300049741 Bacteria 2488
302 Ga0501080_0012659 3300049742 Bacteria 7735
303 Ga0501080_0039491 3300049742 Bacteria 4405
304 Ga0501081_0000241 3300049743 Bacteria 27997
305 Ga0501081_0289165 3300049743 Bacteria 1201
306 Ga0501035_0025309 3300049822 Bacteria 5441
307 Ga0501044_0057528 3300049823 Bacteria 3990
308 Ga0501044_0350393 3300049823 Bacteria 1396
309 Ga0501045_0020269 3300049824 Bacteria 4748
310 Ga0501045_0101995 3300049824 Bacteria 2125
311 nmdc:mga05p37_121382_c1 3300050507 Bacteria 3210
312 nmdc:mga05p37_1652_c1 3300050507 Bacteria 25883
313 nmdc:mga05p37_456721_c1 3300050507 Bacteria 1477
314 nmdc:mga09592_1651_c1 3300050508 Bacteria 17950
315 nmdc:mga09592_21100_c1 3300050508 Bacteria 5365
316 nmdc:mga09592_445363_c1 3300050508 Bacteria 1118
317 nmdc:mga0qj67_131556_c1 3300050509 Bacteria 2027
318 nmdc:mga0qj67_219724_c1 3300050509 Bacteria 1543
319 nmdc:mga0qj67_252_c1 3300050509 Bacteria 36647
320 nmdc:mga0qj67_4046_c1 3300050509 Bacteria 10621
321 nmdc:mga06r32_20000_c1 3300050510 Bacteria 6155
322 nmdc:mga06r32_237264_c1 3300050510 Bacteria 1811
323 nmdc:mga08y16_2538_c1 3300050511 Bacteria 18780
324 nmdc:mga0n895_110282_c1 3300050512 Bacteria 2768
325 nmdc:mga0n895_47646_c1 3300050512 Bacteria 4191
326 nmdc:mga0n895_88417_c1 3300050512 Bacteria 3098
327 nmdc:mga0rr50_34288_c1 3300050513 Bacteria 3634
328 nmdc:mga0rr50_3788_c1 3300050513 Bacteria 8777
329 nmdc:mga0rr50_52832_c1 3300050513 Bacteria 3021
330 nmdc:mga08x19_1680_c1 3300050514 Bacteria 13598
331 nmdc:mga08x19_2316_c1 3300050514 Bacteria 11548
332 nmdc:mga08x19_27148_c1 3300050514 Bacteria 3579
333 nmdc:mga08x19_49485_c1 3300050514 Bacteria 2695
334 nmdc:mga08x19_86610_c1 3300050514 Bacteria 2063
335 nmdc:mga08x19_9651_c1 3300050514 Bacteria 5779
336 nmdc:mga0a205_13510_c1 3300050515 Bacteria 7606
337 nmdc:mga0a205_23804_c1 3300050515 Bacteria 5812
338 nmdc:mga0a205_281378_c1 3300050515 Bacteria 1539
339 Ga0495601_0158887 3300053077 Bacteria 1477
340 Ga0501084_0002318 3300054114 Bacteria 15291
341 Ga0501084_0136341 3300054114 Bacteria 2066
342 Ga0501082_0346403 3300060353 Bacteria 1295
343 Ga0530510_0000412 3300061734 Bacteria 27774
344 Ga0530510_0001978 3300061734 Bacteria 14042
345 Ga0530510_0100503 3300061734 Bacteria 2114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0501805 Ga0495629_0501805_54_767 237
2 3300046533 Ga0495640_0282076 Ga0495640_0282076_274_987 237
3 3300025923 Ga0207681_10000018 Ga0207681_10000018164 250
4 3300005336 Ga0070680_100175412 Ga0070680_1001754122 258
5 iso_pu_bacteria 2881714928 2881715755 261
6 3300035691 Ga0373931_0177136 Ga0373931_0177136_31_897 283
7 3300046517 Ga0495630_0374368 Ga0495630_0374368_14_874 286
8 3300005549 Ga0070704_100118580 Ga0070704_1001185802 287
9 3300006847 Ga0075431_100058555 Ga0075431_1000585553 290
10 3300006880 Ga0075429_100035429 Ga0075429_1000354294 290
11 3300027614 Ga0209970_1009183 Ga0209970_10091832 290
12 3300027665 Ga0209983_1002270 Ga0209983_10022702 290
13 3300027682 Ga0209971_1001159 Ga0209971_10011593 290
14 3300042001 Ga0439441_003430 Ga0439441_003430_1395_2267 290
15 3300042437 Ga0439444_0003852 Ga0439444_0003852_649_1521 290
16 3300050508 nmdc:mga09592_445363_c1 nmdc:mga09592_445363_c1_155_1027 290
17 3300050509 nmdc:mga0qj67_219724_c1 nmdc:mga0qj67_219724_c1_517_1389 290
18 3300005440 Ga0070705_100080742 Ga0070705_1000807422 292
19 3300006846 Ga0075430_100009379 Ga0075430_1000093795 292
20 3300006914 Ga0075436_100002850 Ga0075436_1000028508 292
21 3300025916 Ga0207663_10115712 Ga0207663_101157122 292
22 3300046539 Ga0495621_0018847 Ga0495621_0018847_554_1444 292
23 3300049587 Ga0501071_0059451 Ga0501071_0059451_1437_2321 292
24 3300049588 Ga0501072_0042304 Ga0501072_0042304_1033_1917 292
25 3300049591 Ga0501075_0139312 Ga0501075_0139312_71_955 292
26 3300049592 Ga0501076_0159114 Ga0501076_0159114_867_1751 292
27 3300049741 Ga0501079_0082411 Ga0501079_0082411_186_1070 292
28 3300049742 Ga0501080_0012659 Ga0501080_0012659_4049_4933 292
29 3300050509 nmdc:mga0qj67_4046_c1 nmdc:mga0qj67_4046_c1_6812_7711 292
30 3300050514 nmdc:mga08x19_2316_c1 nmdc:mga08x19_2316_c1_6519_7409 292
31 3300005437 Ga0070710_10078149 Ga0070710_100781492 293
32 3300007265 Ga0099794_10132738 Ga0099794_101327382 293
33 3300005330 Ga0070690_100022006 Ga0070690_1000220063 294
34 3300005439 Ga0070711_100076378 Ga0070711_1000763782 294
35 3300005535 Ga0070684_100174867 Ga0070684_1001748672 294
36 3300005544 Ga0070686_100106545 Ga0070686_1001065452 294
37 3300006237 Ga0097621_100001880 Ga0097621_10000188010 294
38 3300006358 Ga0068871_100002226 Ga0068871_1000022265 294
39 3300006871 Ga0075434_100541888 Ga0075434_1005418882 294
40 3300009177 Ga0105248_10126812 Ga0105248_101268122 294
41 3300025931 Ga0207644_10190179 Ga0207644_101901792 294
42 3300025941 Ga0207711_10063200 Ga0207711_100632001 294
43 3300035119 Ga0373956_0103598 Ga0373956_0103598_191_1102 294
44 3300035121 Ga0373960_0052928 Ga0373960_0052928_215_1105 294
45 3300035691 Ga0373931_0027859 Ga0373931_0027859_515_1405 294
46 3300035692 Ga0373935_0190636 Ga0373935_0190636_189_1079 294
47 3300035695 Ga0373927_0212643 Ga0373927_0212643_46_936 294
48 3300035724 Ga0373933_0004738 Ga0373933_0004738_1648_2538 294
49 3300036401 Ga0373937_0018326 Ga0373937_0018326_2858_3748 294
50 3300041486 Ga0451807_2729594 Ga0451807_2729594_1016_1906 294
51 3300046516 Ga0495628_0170104 Ga0495628_0170104_538_1428 294
52 3300046663 Ga0495635_0099744 Ga0495635_0099744_1062_1952 294
53 3300005338 Ga0068868_100183236 Ga0068868_1001832361 295
54 3300005341 Ga0070691_10025921 Ga0070691_100259212 295
55 3300005343 Ga0070687_100102274 Ga0070687_1001022742 295
56 3300005545 Ga0070695_100026687 Ga0070695_1000266872 295
57 3300005547 Ga0070693_100126985 Ga0070693_1001269852 295
58 3300006844 Ga0075428_100215729 Ga0075428_1002157292 295
59 3300006846 Ga0075430_100000319 Ga0075430_10000031921 295
60 3300006846 Ga0075430_100168018 Ga0075430_1001680182 295
61 3300006847 Ga0075431_100017011 Ga0075431_1000170117 295
62 3300006852 Ga0075433_10019400 Ga0075433_100194003 295
63 3300006871 Ga0075434_100008610 Ga0075434_1000086107 295
64 3300007076 Ga0075435_100063672 Ga0075435_1000636722 295
65 3300007076 Ga0075435_100197543 Ga0075435_1001975432 295
66 3300025917 Ga0207660_10175371 Ga0207660_101753712 295
67 3300025936 Ga0207670_10276323 Ga0207670_102763232 295
68 3300025938 Ga0207704_10301868 Ga0207704_103018681 295
69 3300027360 Ga0209969_1001584 Ga0209969_10015842 295
70 3300027364 Ga0209967_1000258 Ga0209967_10002583 295
71 3300027543 Ga0209999_1002002 Ga0209999_10020023 295
72 3300027695 Ga0209966_1004970 Ga0209966_10049702 295
73 3300031548 Ga0307408_100100921 Ga0307408_1001009212 295
74 3300031665 Ga0316575_10005789 Ga0316575_100057892 295
75 3300032126 Ga0307415_100454745 Ga0307415_1004547451 295
76 3300035398 Ga0316574_0104601 Ga0316574_0104601_75_977 295
77 3300036401 Ga0373937_0021985 Ga0373937_0021985_632_1519 295
78 3300036401 Ga0373937_0045273 Ga0373937_0045273_992_1888 295
79 3300042156 Ga0439446_0043365 Ga0439446_0043365_54_944 295
80 3300042436 Ga0439435_0003877 Ga0439435_0003877_1197_2096 295
81 3300042461 Ga0439460_0000050 Ga0439460_0000050_9772_10671 295
82 3300045051 Ga0451576_0590411 Ga0451576_0590411_244_1140 295
83 3300046476 Ga0495662_0105475 Ga0495662_0105475_307_1194 295
84 3300046511 Ga0495608_0000643 Ga0495608_0000643_22160_23047 295
85 3300046514 Ga0495618_0023774 Ga0495618_0023774_967_1854 295
86 3300046516 Ga0495628_0002765 Ga0495628_0002765_6440_7327 295
87 3300046529 Ga0495652_0104683 Ga0495652_0104683_1203_2090 295
88 3300046533 Ga0495640_0002870 Ga0495640_0002870_2504_3391 295
89 3300046535 Ga0495586_0000323 Ga0495586_0000323_7752_8639 295
90 3300046543 Ga0495645_0009807 Ga0495645_0009807_4867_5754 295
91 3300046663 Ga0495635_0073800 Ga0495635_0073800_399_1286 295
92 3300046663 Ga0495635_0099224 Ga0495635_0099224_848_1735 295
93 3300046678 Ga0495599_0013647 Ga0495599_0013647_3948_4835 295
94 3300046683 Ga0495658_0028817 Ga0495658_0028817_855_1742 295
95 3300046809 Ga0495600_0068213 Ga0495600_0068213_1210_2097 295
96 3300047317 Ga0495604_0038317 Ga0495604_0038317_1406_2293 295
97 3300047319 Ga0495674_0301027 Ga0495674_0301027_80_967 295
98 3300047322 Ga0495680_0002278 Ga0495680_0002278_14970_15857 295
99 3300049572 Ga0501036_0115142 Ga0501036_0115142_1264_2157 295
100 3300049743 Ga0501081_0289165 Ga0501081_0289165_156_1052 295
101 3300050507 nmdc:mga05p37_456721_c1 nmdc:mga05p37_456721_c1_150_1046 295
102 3300050509 nmdc:mga0qj67_252_c1 nmdc:mga0qj67_252_c1_15975_16862 295
103 3300050512 nmdc:mga0n895_47646_c1 nmdc:mga0n895_47646_c1_2335_3222 295
104 3300050513 nmdc:mga0rr50_52832_c1 nmdc:mga0rr50_52832_c1_825_1724 295
105 3300050515 nmdc:mga0a205_13510_c1 nmdc:mga0a205_13510_c1_1764_2663 295
106 3300053077 Ga0495601_0158887 Ga0495601_0158887_418_1305 295
107 3300014326 Ga0157380_10730254 Ga0157380_107302541 296
108 3300031665 Ga0316575_10010522 Ga0316575_100105223 296
109 3300031691 Ga0316579_10010783 Ga0316579_100107833 296
110 3300032133 Ga0316583_10027836 Ga0316583_100278362 296
111 3300035118 Ga0373954_0000003 Ga0373954_0000003_55187_56089 296
112 3300036401 Ga0373937_0017645 Ga0373937_0017645_4178_5080 296
113 3300036647 Ga0316582_0003721 Ga0316582_0003721_2389_3291 296
114 3300037588 Ga0316581_0017568 Ga0316581_0017568_817_1719 296
115 3300049572 Ga0501036_0029144 Ga0501036_0029144_3468_4373 296
116 3300005440 Ga0070705_100012474 Ga0070705_1000124741 297
117 3300005545 Ga0070695_100007473 Ga0070695_1000074734 297
118 3300005546 Ga0070696_100009349 Ga0070696_1000093492 297
119 3300005985 Ga0081539_10000226 Ga0081539_100002263 297
120 3300006871 Ga0075434_100225341 Ga0075434_1002253412 297
121 3300007265 Ga0099794_10046375 Ga0099794_100463752 297
122 3300013105 Ga0157369_10119525 Ga0157369_101195253 297
123 3300013307 Ga0157372_10119100 Ga0157372_101191002 297
124 3300027671 Ga0209588_1038700 Ga0209588_10387001 297
125 3300035207 Ga0373942_0011970 Ga0373942_0011970_670_1572 297
126 3300042438 Ga0439459_0018326 Ga0439459_0018326_156_1052 297
127 3300044735 Ga0466968_0034928 Ga0466968_0034928_213_1121 297
128 3300046491 Ga0495584_0058631 Ga0495584_0058631_386_1282 297
129 3300046528 Ga0495642_0027048 Ga0495642_0027048_487_1383 297
130 3300046684 Ga0495669_0005684 Ga0495669_0005684_2921_3817 297
131 3300049587 Ga0501071_0158229 Ga0501071_0158229_107_1000 297
132 3300050514 nmdc:mga08x19_27148_c1 nmdc:mga08x19_27148_c1_2046_2954 297
133 3300050514 nmdc:mga08x19_86610_c1 nmdc:mga08x19_86610_c1_492_1400 297
134 3300050514 nmdc:mga08x19_9651_c1 nmdc:mga08x19_9651_c1_4656_5564 297
135 3300060353 Ga0501082_0346403 Ga0501082_0346403_148_1041 297
136 3300061734 Ga0530510_0100503 Ga0530510_0100503_460_1353 297
137 3300005444 Ga0070694_100144575 Ga0070694_1001445752 298
138 3300005444 Ga0070694_100302675 Ga0070694_1003026751 298
139 3300005458 Ga0070681_10021998 Ga0070681_100219982 298
140 3300006844 Ga0075428_100023412 Ga0075428_1000234122 298
141 3300006847 Ga0075431_100033056 Ga0075431_1000330563 298
142 3300006871 Ga0075434_100000003 Ga0075434_10000000357 298
143 3300006880 Ga0075429_100020748 Ga0075429_1000207482 298
144 3300006914 Ga0075436_100163933 Ga0075436_1001639332 298
145 3300006931 Ga0097620_100051173 Ga0097620_1000511732 298
146 3300007076 Ga0075435_100031722 Ga0075435_1000317222 298
147 3300007265 Ga0099794_10002480 Ga0099794_100024804 298
148 3300009098 Ga0105245_10103308 Ga0105245_101033082 298
149 3300009147 Ga0114129_10070185 Ga0114129_100701854 298
150 3300009176 Ga0105242_10000677 Ga0105242_100006778 298
151 3300025912 Ga0207707_10025321 Ga0207707_100253214 298
152 3300025917 Ga0207660_10230640 Ga0207660_102306402 298
153 3300025927 Ga0207687_10055000 Ga0207687_100550002 298
154 3300025934 Ga0207686_10000783 Ga0207686_1000078320 298
155 3300027671 Ga0209588_1063567 Ga0209588_10635672 298
156 3300035114 Ga0373939_0015591 Ga0373939_0015591_930_1841 298
157 3300035691 Ga0373931_0017725 Ga0373931_0017725_1730_2665 298
158 3300044694 Ga0466963_0161827 Ga0466963_0161827_202_1125 298
159 3300045976 Ga0466967_0049205 Ga0466967_0049205_1988_2911 298
160 3300050507 nmdc:mga05p37_121382_c1 nmdc:mga05p37_121382_c1_1637_2542 298
161 3300050508 nmdc:mga09592_21100_c1 nmdc:mga09592_21100_c1_3636_4541 298
162 3300050510 nmdc:mga06r32_20000_c1 nmdc:mga06r32_20000_c1_3930_4835 298
163 3300050512 nmdc:mga0n895_110282_c1 nmdc:mga0n895_110282_c1_473_1372 298
164 3300050513 nmdc:mga0rr50_34288_c1 nmdc:mga0rr50_34288_c1_1350_2249 298
165 3300050514 nmdc:mga08x19_49485_c1 nmdc:mga08x19_49485_c1_202_1101 298
166 3300050515 nmdc:mga0a205_281378_c1 nmdc:mga0a205_281378_c1_448_1347 298
167 3300054114 Ga0501084_0136341 Ga0501084_0136341_694_1605 298
168 3300005518 Ga0070699_100412608 Ga0070699_1004126081 299
169 3300005536 Ga0070697_100003682 Ga0070697_1000036825 299
170 3300049575 Ga0501039_0364412 Ga0501039_0364412_55_957 299
171 3300049576 Ga0501040_0088021 Ga0501040_0088021_606_1520 299
172 3300049577 Ga0501041_0003508 Ga0501041_0003508_6231_7145 299
173 3300049580 Ga0501046_0037698 Ga0501046_0037698_2431_3345 299
174 3300049587 Ga0501071_0020662 Ga0501071_0020662_3616_4530 299
175 3300049588 Ga0501072_0005156 Ga0501072_0005156_5098_6012 299
176 3300049590 Ga0501074_0143402 Ga0501074_0143402_109_1023 299
177 3300049591 Ga0501075_0000988 Ga0501075_0000988_1221_2135 299
178 3300049592 Ga0501076_0010610 Ga0501076_0010610_460_1374 299
179 3300049741 Ga0501079_0006894 Ga0501079_0006894_6878_7792 299
180 3300049742 Ga0501080_0039491 Ga0501080_0039491_3200_4114 299
181 3300049823 Ga0501044_0350393 Ga0501044_0350393_358_1272 299
182 3300061734 Ga0530510_0001978 Ga0530510_0001978_6429_7343 299
183 3300005345 Ga0070692_10045746 Ga0070692_100457462 300
184 3300005440 Ga0070705_100166828 Ga0070705_1001668281 300
185 3300005444 Ga0070694_100013529 Ga0070694_1000135294 300
186 3300005549 Ga0070704_100028143 Ga0070704_1000281432 300
187 3300006846 Ga0075430_100007367 Ga0075430_1000073674 300
188 3300025917 Ga0207660_10076330 Ga0207660_100763302 300
189 3300049569 Ga0501032_0096720 Ga0501032_0096720_53_958 300
190 3300049570 Ga0501033_0002408 Ga0501033_0002408_4934_5839 300
191 3300049572 Ga0501036_0006130 Ga0501036_0006130_2219_3124 300
192 3300049573 Ga0501037_0015252 Ga0501037_0015252_1685_2590 300
193 3300049574 Ga0501038_0001672 Ga0501038_0001672_9432_10337 300
194 3300049575 Ga0501039_0000763 Ga0501039_0000763_4672_5577 300
195 3300049576 Ga0501040_0006391 Ga0501040_0006391_3274_4179 300
196 3300049577 Ga0501041_0000591 Ga0501041_0000591_17172_18077 300
197 3300049578 Ga0501042_0010967 Ga0501042_0010967_2349_3254 300
198 3300049580 Ga0501046_0000247 Ga0501046_0000247_33275_34180 300
199 3300049582 Ga0501048_0000787 Ga0501048_0000787_17138_18043 300
200 3300049584 Ga0501068_0030206 Ga0501068_0030206_1572_2477 300
201 3300049586 Ga0501070_0102708 Ga0501070_0102708_468_1373 300
202 3300049587 Ga0501071_0008499 Ga0501071_0008499_4193_5098 300
203 3300049588 Ga0501072_0000333 Ga0501072_0000333_2301_3206 300
204 3300049590 Ga0501074_0010536 Ga0501074_0010536_2229_3134 300
205 3300049591 Ga0501075_0000564 Ga0501075_0000564_17244_18149 300
206 3300049593 Ga0501077_0000223 Ga0501077_0000223_25943_26848 300
207 3300049741 Ga0501079_0000889 Ga0501079_0000889_2349_3254 300
208 3300049743 Ga0501081_0000241 Ga0501081_0000241_4679_5584 300
209 3300049822 Ga0501035_0025309 Ga0501035_0025309_1378_2283 300
210 3300049823 Ga0501044_0057528 Ga0501044_0057528_1904_2809 300
211 3300049824 Ga0501045_0020269 Ga0501045_0020269_2777_3682 300
212 3300050509 nmdc:mga0qj67_131556_c1 nmdc:mga0qj67_131556_c1_500_1405 300
213 3300054114 Ga0501084_0002318 Ga0501084_0002318_42_947 300
214 3300061734 Ga0530510_0000412 Ga0530510_0000412_1925_2830 300
215 3300005295 Ga0065707_10011247 Ga0065707_100112472 301
216 3300005330 Ga0070690_100001157 Ga0070690_10000115712 301
217 3300005334 Ga0068869_100001622 Ga0068869_10000162212 301
218 3300005335 Ga0070666_10105536 Ga0070666_101055362 301
219 3300005336 Ga0070680_100005617 Ga0070680_1000056176 301
220 3300005337 Ga0070682_100004880 Ga0070682_1000048805 301
221 3300005340 Ga0070689_100002764 Ga0070689_1000027644 301
222 3300005341 Ga0070691_10008355 Ga0070691_100083552 301
223 3300005343 Ga0070687_100006386 Ga0070687_1000063862 301
224 3300005345 Ga0070692_10000341 Ga0070692_1000034112 301
225 3300005364 Ga0070673_100177616 Ga0070673_1001776162 301
226 3300005406 Ga0070703_10006645 Ga0070703_100066452 301
227 3300005438 Ga0070701_10001141 Ga0070701_100011414 301
228 3300005440 Ga0070705_100001675 Ga0070705_1000016758 301
229 3300005441 Ga0070700_100000928 Ga0070700_1000009283 301
230 3300005444 Ga0070694_100003407 Ga0070694_1000034075 301
231 3300005456 Ga0070678_100395712 Ga0070678_1003957121 301
232 3300005459 Ga0068867_100003213 Ga0068867_1000032134 301
233 3300005530 Ga0070679_100034682 Ga0070679_1000346822 301
234 3300005544 Ga0070686_100003463 Ga0070686_1000034633 301
235 3300005545 Ga0070695_100000820 Ga0070695_10000082013 301
236 3300005546 Ga0070696_100001264 Ga0070696_1000012647 301
237 3300005546 Ga0070696_100002905 Ga0070696_1000029054 301
238 3300005547 Ga0070693_100000900 Ga0070693_1000009003 301
239 3300005549 Ga0070704_100003116 Ga0070704_1000031163 301
240 3300005549 Ga0070704_100156542 Ga0070704_1001565422 301
241 3300005563 Ga0068855_100006437 Ga0068855_1000064373 301
242 3300005578 Ga0068854_100019844 Ga0068854_1000198443 301
243 3300005614 Ga0068856_100097650 Ga0068856_1000976502 301
244 3300005615 Ga0070702_100000546 Ga0070702_1000005463 301
245 3300005616 Ga0068852_100010288 Ga0068852_1000102886 301
246 3300005617 Ga0068859_100027170 Ga0068859_1000271704 301
247 3300005617 Ga0068859_100068172 Ga0068859_1000681722 301
248 3300005618 Ga0068864_100138828 Ga0068864_1001388282 301
249 3300005718 Ga0068866_10000771 Ga0068866_100007714 301
250 3300005719 Ga0068861_100003717 Ga0068861_1000037179 301
251 3300005842 Ga0068858_100038078 Ga0068858_1000380782 301
252 3300005842 Ga0068858_100173566 Ga0068858_1001735662 301
253 3300005843 Ga0068860_100010334 Ga0068860_1000103343 301
254 3300005844 Ga0068862_100007785 Ga0068862_1000077859 301
255 3300006237 Ga0097621_100003852 Ga0097621_1000038528 301
256 3300006358 Ga0068871_100004152 Ga0068871_1000041522 301
257 3300006844 Ga0075428_100007527 Ga0075428_10000752712 301
258 3300006852 Ga0075433_10027260 Ga0075433_100272604 301
259 3300006871 Ga0075434_100044940 Ga0075434_1000449403 301
260 3300006880 Ga0075429_100000541 Ga0075429_10000054124 301
261 3300006881 Ga0068865_100001117 Ga0068865_10000111712 301
262 3300006914 Ga0075436_100000319 Ga0075436_10000031928 301
263 3300006931 Ga0097620_100027170 Ga0097620_1000271704 301
264 3300006931 Ga0097620_100068175 Ga0097620_1000681752 301
265 3300007076 Ga0075435_100000936 Ga0075435_1000009363 301
266 3300009093 Ga0105240_10446726 Ga0105240_104467262 301
267 3300009098 Ga0105245_10005564 Ga0105245_100055644 301
268 3300009147 Ga0114129_10020624 Ga0114129_100206242 301
269 3300009148 Ga0105243_10001939 Ga0105243_1000193912 301
270 3300009553 Ga0105249_10003305 Ga0105249_100033054 301
271 3300013102 Ga0157371_10288943 Ga0157371_102889432 301
272 3300013297 Ga0157378_10003485 Ga0157378_1000348512 301
273 3300013306 Ga0163162_10196864 Ga0163162_101968641 301
274 3300014326 Ga0157380_10167482 Ga0157380_101674822 301
275 3300014745 Ga0157377_10041401 Ga0157377_100414012 301
276 3300014968 Ga0157379_10147815 Ga0157379_101478152 301
277 3300014969 Ga0157376_10005582 Ga0157376_100055825 301
278 3300017792 Ga0163161_10100884 Ga0163161_101008842 301
279 3300025885 Ga0207653_10004007 Ga0207653_100040072 301
280 3300025899 Ga0207642_10000358 Ga0207642_100003583 301
281 3300025903 Ga0207680_10141361 Ga0207680_101413612 301
282 3300025912 Ga0207707_10091023 Ga0207707_100910232 301
283 3300025917 Ga0207660_10005127 Ga0207660_100051275 301
284 3300025918 Ga0207662_10000510 Ga0207662_100005107 301
285 3300025921 Ga0207652_10013047 Ga0207652_100130473 301
286 3300025923 Ga0207681_10066523 Ga0207681_100665232 301
287 3300025927 Ga0207687_10001855 Ga0207687_100018554 301
288 3300025934 Ga0207686_10004195 Ga0207686_100041955 301
289 3300025935 Ga0207709_10002715 Ga0207709_100027159 301
290 3300025936 Ga0207670_10054715 Ga0207670_100547152 301
291 3300025938 Ga0207704_10002941 Ga0207704_100029414 301
292 3300025941 Ga0207711_10202400 Ga0207711_102024002 301
293 3300025942 Ga0207689_10002293 Ga0207689_1000229312 301
294 3300025949 Ga0207667_10022946 Ga0207667_100229463 301
295 3300025960 Ga0207651_10199555 Ga0207651_101995552 301
296 3300025961 Ga0207712_10002280 Ga0207712_1000228010 301
297 3300025981 Ga0207640_10014950 Ga0207640_100149502 301
298 3300026035 Ga0207703_10006334 Ga0207703_100063348 301
299 3300026035 Ga0207703_10047715 Ga0207703_100477152 301
300 3300026075 Ga0207708_10004095 Ga0207708_100040958 301
301 3300026089 Ga0207648_10001935 Ga0207648_100019358 301
302 3300026095 Ga0207676_10095558 Ga0207676_100955582 301
303 3300026118 Ga0207675_100006748 Ga0207675_1000067488 301
304 3300026121 Ga0207683_10312242 Ga0207683_103122422 301
305 3300026142 Ga0207698_10013301 Ga0207698_100133014 301
306 3300027907 Ga0207428_10001393 Ga0207428_100013937 301
307 3300028380 Ga0268265_10006484 Ga0268265_100064844 301
308 3300028381 Ga0268264_10006985 Ga0268264_100069854 301
309 3300034817 Ga0373948_0010029 Ga0373948_0010029_51_956 301
310 3300034818 Ga0373950_0006495 Ga0373950_0006495_394_1299 301
311 3300034819 Ga0373958_0007095 Ga0373958_0007095_666_1571 301
312 3300035083 Ga0373926_0016288 Ga0373926_0016288_864_1769 301
313 3300035085 Ga0373929_0005102 Ga0373929_0005102_540_1445 301
314 3300035088 Ga0373940_0006016 Ga0373940_0006016_1219_2124 301
315 3300035089 Ga0373944_0009432 Ga0373944_0009432_607_1512 301
316 3300035091 Ga0373951_0011200 Ga0373951_0011200_706_1611 301
317 3300035111 Ga0373923_0016669 Ga0373923_0016669_1442_2347 301
318 3300035112 Ga0373932_0001005 Ga0373932_0001005_1257_2162 301
319 3300035114 Ga0373939_0013247 Ga0373939_0013247_702_1607 301
320 3300035116 Ga0373945_0004452 Ga0373945_0004452_1811_2716 301
321 3300035121 Ga0373960_0028800 Ga0373960_0028800_45_962 301
322 3300035241 Ga0373961_0002613 Ga0373961_0002613_2038_2943 301
323 3300035691 Ga0373931_0000240 Ga0373931_0000240_5677_6582 301
324 3300035691 Ga0373931_0063556 Ga0373931_0063556_612_1517 301
325 3300035692 Ga0373935_0085408 Ga0373935_0085408_925_1830 301
326 3300035725 Ga0373947_0032411 Ga0373947_0032411_2070_2975 301
327 3300042876 Ga0451577_0061533 Ga0451577_0061533_2228_3133 301
328 3300045051 Ga0451576_0009620 Ga0451576_0009620_5341_6246 301
329 3300046475 Ga0495639_0011830 Ga0495639_0011830_434_1339 301
330 3300046517 Ga0495630_0350720 Ga0495630_0350720_158_1063 301
331 3300046526 Ga0495666_0129339 Ga0495666_0129339_54_959 301
332 3300046531 Ga0495665_0004585 Ga0495665_0004585_3130_4035 301
333 3300046535 Ga0495586_0016362 Ga0495586_0016362_1570_2475 301
334 3300046681 Ga0495647_0001902 Ga0495647_0001902_3979_4884 301
335 3300046683 Ga0495658_0014201 Ga0495658_0014201_321_1226 301
336 3300049568 Ga0501031_0287271 Ga0501031_0287271_99_1016 301
337 3300049588 Ga0501072_0032975 Ga0501072_0032975_2988_3893 301
338 3300049824 Ga0501045_0101995 Ga0501045_0101995_904_1821 301
339 3300050507 nmdc:mga05p37_1652_c1 nmdc:mga05p37_1652_c1_778_1683 301
340 3300050508 nmdc:mga09592_1651_c1 nmdc:mga09592_1651_c1_5697_6602 301
341 3300050510 nmdc:mga06r32_237264_c1 nmdc:mga06r32_237264_c1_264_1169 301
342 3300050511 nmdc:mga08y16_2538_c1 nmdc:mga08y16_2538_c1_2147_3052 301
343 3300050512 nmdc:mga0n895_88417_c1 nmdc:mga0n895_88417_c1_466_1383 301
344 3300050513 nmdc:mga0rr50_3788_c1 nmdc:mga0rr50_3788_c1_4709_5626 301
345 3300050514 nmdc:mga08x19_1680_c1 nmdc:mga08x19_1680_c1_6997_7914 301
346 3300050515 nmdc:mga0a205_23804_c1 nmdc:mga0a205_23804_c1_1703_2620 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09297

zf-NADH-PPase

NADH pyrophosphatase zinc ribbon domain

165

196

0.95

PF09296

NUDIX-like

NADH pyrophosphatase-like rudimentary NUDIX domain

54

163

0.86

PF00293

NUDIX

NUDIX domain

198

320

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gb5-assembly1.cif.gz_B crystal structure of nadh pyrophosphatase (ec 3.6.1.22) (1790429) from escherichia coli k12 at 2.30 a resolution 0.8374 14 294
5isy-assembly1.cif.gz_C crystal structure of nudix family protein with nad 0.834 13 289
3oga-assembly1.cif.gz_B 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 0.8286 165 287
5isy-assembly1.cif.gz_A crystal structure of nudix family protein with nad 0.8279 13 291
5isy-assembly1.cif.gz_C crystal structure of nudix family protein with nad 0.8278 13 289
ID Description Score Start End Superfamily
af_A0A0R4ISD4_291_431_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9649 165 288 3.90.79.10
2gb5A02 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.961 165 289 3.90.79.10
af_Q94A82_242_424_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.929 165 288 3.90.79.10
af_P9WIX5_169_312_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9285 165 289 3.90.79.10
af_Q9Y7J0_225_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9192 166 290 3.90.79.10
ID Description Score Start End GO Terms
AF-D4BL18-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9829 194 294 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872
AF-A0A351DPT9-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9752 168 292 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
AF-K2BJK1-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9695 183 290 GO:0000210
GO:0035529
AF-A0A351DPT9-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9601 168 292 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
AF-A0A356BHT4-F1-model_v4 NAD(+) diphosphatase (EC 3.6.1.22) 0.9561 162 291 GO:0005829
GO:0006734
GO:0006742
GO:0019677
GO:0035529
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.25 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map