F416718

General Info

Members Datasets Scaffolds Average Seq Length
346 190 692 121

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10233058|Ga0075370_102330582
Length 137
Sequence VTSAAELVHGSSRISRTMPTLIPQPTVIAAAGNKPKRIEEYAGHVNSGHTGVSVARMVSPEGWVEPGQRPEFEEITVVLKGLVRVEHEGGVIDVRGGQAIVAAPGEWVRYSSPEPGGAEYVAICLPAFSPATVHRDA

Samples

Sample ID Description Type Environment
1 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
127 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
162 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.23
Nodule 0
Rhizoplane 1.73
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 10.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075370_10233058 3300006353 Unclassified 1089
2 Ga0065712_10001492 3300005290 Bacteria 6511
3 Ga0065712_10125404 3300005290 Bacteria 1613
4 Ga0065715_10238779 3300005293 Bacteria 1207
5 Ga0065715_10451006 3300005293 Unclassified 822
6 Ga0065715_10838876 3300005293 Bacteria 563
7 Ga0070676_10360961 3300005328 Bacteria 1001
8 Ga0070683_100210518 3300005329 Bacteria 1847
9 Ga0070677_10042951 3300005333 Bacteria 1793
10 Ga0068869_100112916 3300005334 Bacteria 2069
11 Ga0070682_100175391 3300005337 Bacteria 1493
12 Ga0070689_100878715 3300005340 Bacteria 792
13 Ga0070687_100598293 3300005343 Unclassified 757
14 Ga0070692_10880050 3300005345 Bacteria 618
15 Ga0070668_102138991 3300005347 Bacteria 517
16 Ga0070675_100716750 3300005354 Bacteria 912
17 Ga0070674_100643621 3300005356 Unclassified 900
18 Ga0070674_100929660 3300005356 Bacteria 759
19 Ga0070688_100238644 3300005365 Bacteria 1289
20 Ga0070659_100550354 3300005366 Bacteria 988
21 Ga0070667_101977500 3300005367 Bacteria 549
22 Ga0070709_10050904 3300005434 Bacteria 2597
23 Ga0070714_102335585 3300005435 Bacteria 520
24 Ga0070710_10103685 3300005437 Bacteria 1698
25 Ga0070705_100494350 3300005440 Bacteria 927
26 Ga0070700_100651014 3300005441 Bacteria 832
27 Ga0070708_100127098 3300005445 Bacteria 2357
28 Ga0070678_100288139 3300005456 Bacteria 1391
29 Ga0070662_100033665 3300005457 Bacteria 3610
30 Ga0070681_10221706 3300005458 Bacteria 1806
31 Ga0068867_100151721 3300005459 Bacteria 1821
32 Ga0068867_100615524 3300005459 Bacteria 949
33 Ga0070685_10774735 3300005466 Bacteria 705
34 Ga0070698_100247036 3300005471 Bacteria 1717
35 Ga0070679_100468843 3300005530 Bacteria 1204
36 Ga0068853_101585838 3300005539 Bacteria 634
37 Ga0070672_100493036 3300005543 Bacteria 1059
38 Ga0070686_100796473 3300005544 Bacteria 761
39 Ga0070665_100051825 3300005548 Bacteria 4115
40 Ga0070665_100393326 3300005548 Bacteria 1394
41 Ga0070665_101281110 3300005548 Bacteria 743
42 Ga0070665_102114783 3300005548 Bacteria 567
43 Ga0068855_100453436 3300005563 Bacteria 1399
44 Ga0070664_100472845 3300005564 Bacteria 1153
45 Ga0070664_101371962 3300005564 Bacteria 668
46 Ga0070664_101475558 3300005564 Bacteria 643
47 Ga0068857_100138332 3300005577 Bacteria 2200
48 Ga0068857_100327182 3300005577 Bacteria 1416
49 Ga0068859_100385200 3300005617 Bacteria 1498
50 Ga0068861_100125027 3300005719 Bacteria 2080
51 Ga0068861_100769308 3300005719 Bacteria 901
52 Ga0068858_100691888 3300005842 Bacteria 992
53 Ga0068860_100589913 3300005843 Unclassified 1116
54 Ga0070717_10996521 3300006028 Bacteria 763
55 Ga0075368_10236098 3300006042 Bacteria 779
56 Ga0075363_100011147 3300006048 Bacteria 4296
57 Ga0075364_10070561 3300006051 Bacteria 2300
58 Ga0075364_10340228 3300006051 Unclassified 1022
59 Ga0075362_10117404 3300006177 Bacteria 1257
60 Ga0075367_10045652 3300006178 Bacteria 2571
61 Ga0075367_10057078 3300006178 Unclassified 2321
62 Ga0075367_10074337 3300006178 Bacteria 2049
63 Ga0075366_10154487 3300006195 Bacteria 1390
64 Ga0075366_10254536 3300006195 Unclassified 1071
65 Ga0075370_10082417 3300006353 Bacteria 1850
66 Ga0075428_100001564 3300006844 Bacteria 24545
67 Ga0075430_100013086 3300006846 Bacteria 7071
68 Ga0075431_100000898 3300006847 Bacteria 26211
69 Ga0075433_10112594 3300006852 Bacteria 2414
70 Ga0075429_100007189 3300006880 Bacteria 9660
71 Ga0068865_100171249 3300006881 Bacteria 1665
72 Ga0097620_100385219 3300006931 Bacteria 1498
73 Ga0105240_10542033 3300009093 Bacteria 1288
74 Ga0111539_10047462 3300009094 Bacteria 5131
75 Ga0111539_11488933 3300009094 Bacteria 785
76 Ga0105247_10016803 3300009101 Bacteria 4387
77 Ga0105247_10530646 3300009101 Bacteria 862
78 Ga0114129_10154252 3300009147 Unclassified 3142
79 Ga0105242_10239850 3300009176 Bacteria 1629
80 Ga0105242_12351608 3300009176 Bacteria 580
81 Ga0105248_11386836 3300009177 Bacteria 795
82 Ga0105248_12029265 3300009177 Bacteria 653
83 Ga0105237_10079053 3300009545 Bacteria 3279
84 Ga0105237_11045025 3300009545 Bacteria 824
85 Ga0105238_10484186 3300009551 Bacteria 1237
86 Ga0105249_11585477 3300009553 Bacteria 727
87 Ga0105249_11874415 3300009553 Unclassified 672
88 Ga0105249_12921321 3300009553 Bacteria 549
89 Ga0157375_12122110 3300013308 Bacteria 669
90 Ga0157375_12411661 3300013308 Bacteria 628
91 Ga0157380_10005148 3300014326 Bacteria 9137
92 Ga0157380_10583421 3300014326 Bacteria 1103
93 Ga0207697_10125690 3300025315 Bacteria 1106
94 Ga0207692_10083631 3300025898 Bacteria 1713
95 Ga0207710_10040850 3300025900 Bacteria 2056
96 Ga0207699_10138832 3300025906 Bacteria 1595
97 Ga0207707_10060366 3300025912 Bacteria 3299
98 Ga0207671_10808138 3300025914 Bacteria 743
99 Ga0207650_10413982 3300025925 Bacteria 1117
100 Ga0207659_10141881 3300025926 Bacteria 1866
101 Ga0207664_10940399 3300025929 Bacteria 775
102 Ga0207686_10150233 3300025934 Bacteria 1621
103 Ga0207670_10565509 3300025936 Bacteria 930
104 Ga0207669_10920659 3300025937 Bacteria 731
105 Ga0207704_10128060 3300025938 Bacteria 1752
106 Ga0207691_10429645 3300025940 Bacteria 1125
107 Ga0207689_10287017 3300025942 Bacteria 1363
108 Ga0207661_10119168 3300025944 Bacteria 2245
109 Ga0207679_10671869 3300025945 Bacteria 938
110 Ga0207712_11373006 3300025961 Bacteria 632
111 Ga0207712_11652310 3300025961 Unclassified 574
112 Ga0207712_12059853 3300025961 Bacteria 511
113 Ga0207658_11948315 3300025986 Bacteria 535
114 Ga0207648_10055012 3300026089 Bacteria 3475
115 Ga0207648_10467667 3300026089 Bacteria 1150
116 Ga0207674_10384342 3300026116 Bacteria 1357
117 Ga0207674_11963330 3300026116 Bacteria 551
118 Ga0207675_100115301 3300026118 Bacteria 2538
119 Ga0207675_100545660 3300026118 Bacteria 1158
120 Ga0207675_100605038 3300026118 Bacteria 1099
121 Ga0207683_10112638 3300026121 Bacteria 2436
122 Ga0207683_10358617 3300026121 Bacteria 1339
123 Ga0207698_12528712 3300026142 Bacteria 523
124 Ga0209813_10196538 3300027866 Unclassified 745
125 Ga0207428_10108851 3300027907 Bacteria 2134
126 Ga0207428_10664996 3300027907 Bacteria 747
127 Ga0268266_10049037 3300028379 Bacteria 3620
128 Ga0268266_10380768 3300028379 Bacteria 1331
129 Ga0268266_10427147 3300028379 Bacteria 1256
130 Ga0268266_10697690 3300028379 Bacteria 978
131 Ga0268265_10113217 3300028380 Bacteria 2220
132 Ga0265319_1000043 3300028563 Bacteria 109696
133 Ga0265318_10001709 3300028577 Bacteria 12570
134 Ga0265324_10084411 3300029957 Bacteria 1080
135 Ga0265330_10000749 3300031235 Bacteria 20440
136 Ga0265320_10021114 3300031240 Bacteria 3512
137 Ga0307408_100331285 3300031548 Bacteria 1286
138 Ga0307408_100726923 3300031548 Unclassified 895
139 Ga0265313_10142570 3300031595 Bacteria 1029
140 Ga0265314_10005666 3300031711 Bacteria 11218
141 Ga0307405_11335913 3300031731 Bacteria 625
142 Ga0307410_11194707 3300031852 Bacteria 662
143 Ga0307416_101192832 3300032002 Bacteria 867
144 Ga0307415_100646080 3300032126 Bacteria 948
145 Ga0307415_101713794 3300032126 Bacteria 606
146 Ga0373934_0000487 3300035086 Bacteria 13925
147 Ga0373923_0114957 3300035111 Bacteria 1198
148 Ga0373954_0162442 3300035118 Bacteria 1093
149 Ga0373956_0000801 3300035119 Bacteria 13080
150 Ga0373956_0089944 3300035119 Bacteria 1416
151 Ga0373955_0001488 3300035172 Bacteria 9969
152 Ga0373955_0315908 3300035172 Unclassified 943
153 Ga0373935_0488191 3300035692 Bacteria 893
154 Ga0373933_0023896 3300035724 Bacteria 3496
155 Ga0373937_0000056 3300036401 Bacteria 100023
156 Ga0373937_0081112 3300036401 Bacteria 3001
157 Ga0373937_0391195 3300036401 Unclassified 1319
158 Ga0373937_0457885 3300036401 Bacteria 1212
159 Ga0373937_0855205 3300036401 Bacteria 858
160 Ga0451807_2762636 3300041486 Bacteria 1280
161 Ga0439445_0037777 3300042004 Bacteria 1275
162 Ga0439450_003989 3300042008 Bacteria 2487
163 Ga0451577_0011367 3300042876 Bacteria 8426
164 Ga0453684_0416086 3300044712 Unclassified 1502
165 Ga0451576_2671922 3300045051 Bacteria 508
166 Ga0495592_0288271 3300046454 Bacteria 1071
167 Ga0495629_0332062 3300046459 Bacteria 1039
168 Ga0495651_0186436 3300046462 Bacteria 1464
169 Ga0495618_0783407 3300046514 Bacteria 556
170 Ga0495587_0659392 3300046536 Unclassified 575
171 Ga0495634_0662986 3300046642 Archaea 602
172 Ga0495635_0138761 3300046663 Bacteria 1656
173 Ga0495674_0084653 3300047319 Bacteria 2717
174 Ga0495672_0385644 3300047320 Bacteria 643
175 Ga0495680_0073135 3300047322 Bacteria 2606
176 Ga0495680_1055739 3300047322 Unclassified 516
177 Ga0496102_0827147 3300048905 Bacteria 848
178 Ga0496104_0804982 3300048907 Bacteria 846
179 Ga0496109_0572075 3300048912 Bacteria 1065
180 Ga0496110_0147475 3300048913 Bacteria 2129
181 Ga0496112_0375316 3300048915 Bacteria 1363
182 Ga0501031_0012384 3300049568 Bacteria 5562
183 Ga0501031_0015468 3300049568 Bacteria 4954
184 Ga0501031_0086315 3300049568 Bacteria 2046
185 Ga0501031_0096005 3300049568 Bacteria 1934
186 Ga0501031_0115577 3300049568 Bacteria 1753
187 Ga0501031_0167159 3300049568 Bacteria 1437
188 Ga0501031_0631250 3300049568 Unclassified 689
189 Ga0501032_0004477 3300049569 Bacteria 10521
190 Ga0501032_0056337 3300049569 Bacteria 2642
191 Ga0501032_0124209 3300049569 Bacteria 1705
192 Ga0501032_0240430 3300049569 Bacteria 1176
193 Ga0501032_0243927 3300049569 Bacteria 1167
194 Ga0501032_0409577 3300049569 Bacteria 870
195 Ga0501033_0002048 3300049570 Bacteria 17526
196 Ga0501033_0013664 3300049570 Bacteria 6178
197 Ga0501033_0226497 3300049570 Bacteria 1329
198 Ga0501033_0508873 3300049570 Unclassified 832
199 Ga0501034_0006322 3300049571 Bacteria 12752
200 Ga0501034_0120958 3300049571 Bacteria 2604
201 Ga0501034_0236626 3300049571 Bacteria 1773
202 Ga0501034_0321046 3300049571 Bacteria 1481
203 Ga0501034_0342961 3300049571 Bacteria 1423
204 Ga0501036_0011564 3300049572 Bacteria 7314
205 Ga0501036_0014372 3300049572 Bacteria 6591
206 Ga0501036_0016874 3300049572 Bacteria 6100
207 Ga0501036_0050556 3300049572 Bacteria 3519
208 Ga0501036_0225920 3300049572 Bacteria 1571
209 Ga0501036_0636315 3300049572 Bacteria 883
210 Ga0501037_0047477 3300049573 Bacteria 3147
211 Ga0501037_0126526 3300049573 Bacteria 1834
212 Ga0501037_0151086 3300049573 Bacteria 1660
213 Ga0501037_0160560 3300049573 Bacteria 1602
214 Ga0501037_0201487 3300049573 Bacteria 1406
215 Ga0501037_0576434 3300049573 Bacteria 757
216 Ga0501038_0004094 3300049574 Bacteria 13564
217 Ga0501038_0059152 3300049574 Bacteria 3283
218 Ga0501038_0112370 3300049574 Bacteria 2255
219 Ga0501038_0202654 3300049574 Bacteria 1591
220 Ga0501038_0437579 3300049574 Bacteria 1007
221 Ga0501039_0006016 3300049575 Bacteria 9204
222 Ga0501039_0092573 3300049575 Bacteria 2356
223 Ga0501039_0207739 3300049575 Bacteria 1539
224 Ga0501039_0823529 3300049575 Bacteria 724
225 Ga0501040_0642330 3300049576 Bacteria 767
226 Ga0501040_1140715 3300049576 Bacteria 565
227 Ga0501041_0494097 3300049577 Bacteria 778
228 Ga0501042_0924596 3300049578 Bacteria 635
229 Ga0501043_0000450 3300049579 Bacteria 36897
230 Ga0501043_0010014 3300049579 Bacteria 7434
231 Ga0501043_0074778 3300049579 Bacteria 2661
232 Ga0501043_0078839 3300049579 Bacteria 2588
233 Ga0501043_0129350 3300049579 Bacteria 1979
234 Ga0501046_0001281 3300049580 Bacteria 24347
235 Ga0501046_0012951 3300049580 Bacteria 7086
236 Ga0501046_0017674 3300049580 Bacteria 5946
237 Ga0501046_0026967 3300049580 Bacteria 4691
238 Ga0501046_0077299 3300049580 Bacteria 2577
239 Ga0501046_0159793 3300049580 Bacteria 1696
240 Ga0501047_0000920 3300049581 Bacteria 30124
241 Ga0501047_0001160 3300049581 Bacteria 26092
242 Ga0501047_0057997 3300049581 Bacteria 3741
243 Ga0501047_0094091 3300049581 Bacteria 2875
244 Ga0501047_0615792 3300049581 Bacteria 906
245 Ga0501047_0919200 3300049581 Bacteria 688
246 Ga0501048_0004597 3300049582 Bacteria 10503
247 Ga0501048_0051915 3300049582 Bacteria 2917
248 Ga0501048_0072945 3300049582 Bacteria 2423
249 Ga0501048_0179982 3300049582 Bacteria 1498
250 Ga0501048_0524546 3300049582 Bacteria 849
251 Ga0501067_0024308 3300049583 Bacteria 3361
252 Ga0501067_0045083 3300049583 Bacteria 2449
253 Ga0501067_0057941 3300049583 Bacteria 2145
254 Ga0501067_0073288 3300049583 Bacteria 1897
255 Ga0501067_0093784 3300049583 Bacteria 1666
256 Ga0501067_0515185 3300049583 Bacteria 669
257 Ga0501068_0024734 3300049584 Bacteria 3528
258 Ga0501068_0064988 3300049584 Bacteria 2220
259 Ga0501068_0150938 3300049584 Bacteria 1460
260 Ga0501068_0392443 3300049584 Bacteria 894
261 Ga0501069_0078466 3300049585 Bacteria 1857
262 Ga0501069_0091864 3300049585 Bacteria 1717
263 Ga0501069_0976344 3300049585 Unclassified 517
264 Ga0501070_0043605 3300049586 Bacteria 3732
265 Ga0501070_0112832 3300049586 Bacteria 2246
266 Ga0501070_0167612 3300049586 Bacteria 1810
267 Ga0501070_0353176 3300049586 Unclassified 1193
268 Ga0501070_0938419 3300049586 Unclassified 673
269 Ga0501071_0049844 3300049587 Bacteria 3015
270 Ga0501071_1126133 3300049587 Bacteria 606
271 Ga0501072_0646812 3300049588 Bacteria 832
272 Ga0501073_0000328 3300049589 Bacteria 31945
273 Ga0501073_0019395 3300049589 Bacteria 4910
274 Ga0501073_0035013 3300049589 Bacteria 3570
275 Ga0501073_0093217 3300049589 Bacteria 2092
276 Ga0501073_0268420 3300049589 Bacteria 1177
277 Ga0501073_0368375 3300049589 Bacteria 992
278 Ga0501074_0026057 3300049590 Bacteria 4240
279 Ga0501074_0221012 3300049590 Bacteria 1349
280 Ga0501074_0477121 3300049590 Bacteria 884
281 Ga0501074_1335979 3300049590 Bacteria 502
282 Ga0501075_0095247 3300049591 Bacteria 2259
283 Ga0501076_0003848 3300049592 Bacteria 10565
284 Ga0501076_0040037 3300049592 Bacteria 3682
285 Ga0501076_0681507 3300049592 Bacteria 848
286 Ga0501076_1699751 3300049592 Bacteria 518
287 Ga0501076_1734834 3300049592 Unclassified 512
288 Ga0501077_0262068 3300049593 Bacteria 1099
289 Ga0501221_158381 3300049704 Bacteria 605
290 Ga0501079_0066727 3300049741 Bacteria 2776
291 Ga0501079_0252832 3300049741 Bacteria 1377
292 Ga0501079_1103119 3300049741 Unclassified 625
293 Ga0501080_0000360 3300049742 Bacteria 35117
294 Ga0501080_0073983 3300049742 Bacteria 3169
295 Ga0501080_0156424 3300049742 Bacteria 2105
296 Ga0501080_0199348 3300049742 Bacteria 1838
297 Ga0501080_0237310 3300049742 Bacteria 1665
298 Ga0501080_0685679 3300049742 Unclassified 904
299 Ga0501081_0214836 3300049743 Bacteria 1398
300 Ga0501083_0038668 3300049744 Bacteria 3242
301 Ga0501083_0170720 3300049744 Bacteria 1421
302 Ga0501083_0411894 3300049744 Bacteria 879
303 Ga0501035_0001691 3300049822 Bacteria 22319
304 Ga0501035_0007379 3300049822 Bacteria 10277
305 Ga0501035_0021358 3300049822 Bacteria 5950
306 Ga0501035_0045077 3300049822 Bacteria 3968
307 Ga0501044_0006910 3300049823 Bacteria 12494
308 Ga0501044_0171709 3300049823 Bacteria 2139
309 Ga0501045_0020662 3300049824 Bacteria 4704
310 Ga0501045_0167959 3300049824 Bacteria 1634
311 Ga0501045_0456769 3300049824 Bacteria 949
312 Ga0501045_0466181 3300049824 Unclassified 939
313 nmdc:mga00v17_303117_c1 3300050491 Unclassified 1038
314 nmdc:mga0yw44_1095451_c1 3300050492 Bacteria 538
315 nmdc:mga0yw44_505082_c1 3300050492 Bacteria 820
316 nmdc:mga0k408_337511_c1 3300050493 Unclassified 899
317 nmdc:mga0k408_35796_c1 3300050493 Bacteria 2847
318 nmdc:mga0k408_411211_c1 3300050493 Unclassified 805
319 nmdc:mga06z11_25754_c1 3300050494 Bacteria 2792
320 nmdc:mga06z11_55219_c1 3300050494 Unclassified 2050
321 nmdc:mga04h51_186448_c1 3300050495 Unclassified 810
322 nmdc:mga07m45_255994_c1 3300050496 Unclassified 1018
323 nmdc:mga05p37_114170_c1 3300050507 Unclassified 3320
324 nmdc:mga09592_354_c1 3300050508 Bacteria 33681
325 nmdc:mga0qj67_31389_c1 3300050509 Bacteria 4138
326 nmdc:mga0qj67_59406_c1 3300050509 Unclassified 3032
327 nmdc:mga06r32_215_c1 3300050510 Bacteria 46648
328 nmdc:mga06r32_34247_c1 3300050510 Unclassified 4788
329 nmdc:mga08y16_1062021_c1 3300050511 Bacteria 787
330 nmdc:mga0n895_1188703_c1 3300050512 Bacteria 737
331 Ga0495601_0015027 3300053077 Bacteria 4676
332 Ga0495595_0039778 3300053084 Bacteria 2147
333 Ga0495595_0117777 3300053084 Bacteria 1292
334 Ga0495619_0136883 3300053085 Bacteria 1685
335 Ga0500568_0002127 3300053139 Bacteria 11957
336 Ga0500611_006553 3300053727 Unclassified 1702
337 Ga0501084_0032770 3300054114 Bacteria 4347
338 Ga0501084_0047920 3300054114 Bacteria 3578
339 Ga0501084_0262106 3300054114 Bacteria 1459
340 Ga0501084_0281537 3300054114 Bacteria 1404
341 Ga0590077_089416 3300059426 Unclassified 714
342 Ga0501082_0002529 3300060353 Bacteria 16013
343 Ga0501082_0031839 3300060353 Bacteria 4548
344 Ga0501082_0034751 3300060353 Bacteria 4345
345 Ga0501082_0594147 3300060353 Bacteria 968
346 Ga0530510_0228541 3300061734 Bacteria 1384
347 Ga0075370_10233058
348 Ga0065712_10001492
349 Ga0065712_10125404
350 Ga0065715_10238779
351 Ga0065715_10451006
352 Ga0065715_10838876
353 Ga0070676_10360961
354 Ga0070683_100210518
355 Ga0070677_10042951
356 Ga0068869_100112916
357 Ga0070682_100175391
358 Ga0070689_100878715
359 Ga0070687_100598293
360 Ga0070692_10880050
361 Ga0070668_102138991
362 Ga0070675_100716750
363 Ga0070674_100643621
364 Ga0070674_100929660
365 Ga0070688_100238644
366 Ga0070659_100550354
367 Ga0070667_101977500
368 Ga0070709_10050904
369 Ga0070714_102335585
370 Ga0070710_10103685
371 Ga0070705_100494350
372 Ga0070700_100651014
373 Ga0070708_100127098
374 Ga0070678_100288139
375 Ga0070662_100033665
376 Ga0070681_10221706
377 Ga0068867_100151721
378 Ga0068867_100615524
379 Ga0070685_10774735
380 Ga0070698_100247036
381 Ga0070679_100468843
382 Ga0068853_101585838
383 Ga0070672_100493036
384 Ga0070686_100796473
385 Ga0070665_100051825
386 Ga0070665_100393326
387 Ga0070665_101281110
388 Ga0070665_102114783
389 Ga0068855_100453436
390 Ga0070664_100472845
391 Ga0070664_101371962
392 Ga0070664_101475558
393 Ga0068857_100138332
394 Ga0068857_100327182
395 Ga0068859_100385200
396 Ga0068861_100125027
397 Ga0068861_100769308
398 Ga0068858_100691888
399 Ga0068860_100589913
400 Ga0070717_10996521
401 Ga0075368_10236098
402 Ga0075363_100011147
403 Ga0075364_10070561
404 Ga0075364_10340228
405 Ga0075362_10117404
406 Ga0075367_10045652
407 Ga0075367_10057078
408 Ga0075367_10074337
409 Ga0075366_10154487
410 Ga0075366_10254536
411 Ga0075370_10082417
412 Ga0075428_100001564
413 Ga0075430_100013086
414 Ga0075431_100000898
415 Ga0075433_10112594
416 Ga0075429_100007189
417 Ga0068865_100171249
418 Ga0097620_100385219
419 Ga0105240_10542033
420 Ga0111539_10047462
421 Ga0111539_11488933
422 Ga0105247_10016803
423 Ga0105247_10530646
424 Ga0114129_10154252
425 Ga0105242_10239850
426 Ga0105242_12351608
427 Ga0105248_11386836
428 Ga0105248_12029265
429 Ga0105237_10079053
430 Ga0105237_11045025
431 Ga0105238_10484186
432 Ga0105249_11585477
433 Ga0105249_11874415
434 Ga0105249_12921321
435 Ga0157375_12122110
436 Ga0157375_12411661
437 Ga0157380_10005148
438 Ga0157380_10583421
439 Ga0207697_10125690
440 Ga0207692_10083631
441 Ga0207710_10040850
442 Ga0207699_10138832
443 Ga0207707_10060366
444 Ga0207671_10808138
445 Ga0207650_10413982
446 Ga0207659_10141881
447 Ga0207664_10940399
448 Ga0207686_10150233
449 Ga0207670_10565509
450 Ga0207669_10920659
451 Ga0207704_10128060
452 Ga0207691_10429645
453 Ga0207689_10287017
454 Ga0207661_10119168
455 Ga0207679_10671869
456 Ga0207712_11373006
457 Ga0207712_11652310
458 Ga0207712_12059853
459 Ga0207658_11948315
460 Ga0207648_10055012
461 Ga0207648_10467667
462 Ga0207674_10384342
463 Ga0207674_11963330
464 Ga0207675_100115301
465 Ga0207675_100545660
466 Ga0207675_100605038
467 Ga0207683_10112638
468 Ga0207683_10358617
469 Ga0207698_12528712
470 Ga0209813_10196538
471 Ga0207428_10108851
472 Ga0207428_10664996
473 Ga0268266_10049037
474 Ga0268266_10380768
475 Ga0268266_10427147
476 Ga0268266_10697690
477 Ga0268265_10113217
478 Ga0265319_1000043
479 Ga0265318_10001709
480 Ga0265324_10084411
481 Ga0265330_10000749
482 Ga0265320_10021114
483 Ga0307408_100331285
484 Ga0307408_100726923
485 Ga0265313_10142570
486 Ga0265314_10005666
487 Ga0307405_11335913
488 Ga0307410_11194707
489 Ga0307416_101192832
490 Ga0307415_100646080
491 Ga0307415_101713794
492 Ga0373934_0000487
493 Ga0373923_0114957
494 Ga0373954_0162442
495 Ga0373956_0000801
496 Ga0373956_0089944
497 Ga0373955_0001488
498 Ga0373955_0315908
499 Ga0373935_0488191
500 Ga0373933_0023896
501 Ga0373937_0000056
502 Ga0373937_0081112
503 Ga0373937_0391195
504 Ga0373937_0457885
505 Ga0373937_0855205
506 Ga0451807_2762636
507 Ga0439445_0037777
508 Ga0439450_003989
509 Ga0451577_0011367
510 Ga0453684_0416086
511 Ga0451576_2671922
512 Ga0495592_0288271
513 Ga0495629_0332062
514 Ga0495651_0186436
515 Ga0495618_0783407
516 Ga0495587_0659392
517 Ga0495634_0662986
518 Ga0495635_0138761
519 Ga0495674_0084653
520 Ga0495672_0385644
521 Ga0495680_0073135
522 Ga0495680_1055739
523 Ga0496102_0827147
524 Ga0496104_0804982
525 Ga0496109_0572075
526 Ga0496110_0147475
527 Ga0496112_0375316
528 Ga0501031_0012384
529 Ga0501031_0015468
530 Ga0501031_0086315
531 Ga0501031_0096005
532 Ga0501031_0115577
533 Ga0501031_0167159
534 Ga0501031_0631250
535 Ga0501032_0004477
536 Ga0501032_0056337
537 Ga0501032_0124209
538 Ga0501032_0240430
539 Ga0501032_0243927
540 Ga0501032_0409577
541 Ga0501033_0002048
542 Ga0501033_0013664
543 Ga0501033_0226497
544 Ga0501033_0508873
545 Ga0501034_0006322
546 Ga0501034_0120958
547 Ga0501034_0236626
548 Ga0501034_0321046
549 Ga0501034_0342961
550 Ga0501036_0011564
551 Ga0501036_0014372
552 Ga0501036_0016874
553 Ga0501036_0050556
554 Ga0501036_0225920
555 Ga0501036_0636315
556 Ga0501037_0047477
557 Ga0501037_0126526
558 Ga0501037_0151086
559 Ga0501037_0160560
560 Ga0501037_0201487
561 Ga0501037_0576434
562 Ga0501038_0004094
563 Ga0501038_0059152
564 Ga0501038_0112370
565 Ga0501038_0202654
566 Ga0501038_0437579
567 Ga0501039_0006016
568 Ga0501039_0092573
569 Ga0501039_0207739
570 Ga0501039_0823529
571 Ga0501040_0642330
572 Ga0501040_1140715
573 Ga0501041_0494097
574 Ga0501042_0924596
575 Ga0501043_0000450
576 Ga0501043_0010014
577 Ga0501043_0074778
578 Ga0501043_0078839
579 Ga0501043_0129350
580 Ga0501046_0001281
581 Ga0501046_0012951
582 Ga0501046_0017674
583 Ga0501046_0026967
584 Ga0501046_0077299
585 Ga0501046_0159793
586 Ga0501047_0000920
587 Ga0501047_0001160
588 Ga0501047_0057997
589 Ga0501047_0094091
590 Ga0501047_0615792
591 Ga0501047_0919200
592 Ga0501048_0004597
593 Ga0501048_0051915
594 Ga0501048_0072945
595 Ga0501048_0179982
596 Ga0501048_0524546
597 Ga0501067_0024308
598 Ga0501067_0045083
599 Ga0501067_0057941
600 Ga0501067_0073288
601 Ga0501067_0093784
602 Ga0501067_0515185
603 Ga0501068_0024734
604 Ga0501068_0064988
605 Ga0501068_0150938
606 Ga0501068_0392443
607 Ga0501069_0078466
608 Ga0501069_0091864
609 Ga0501069_0976344
610 Ga0501070_0043605
611 Ga0501070_0112832
612 Ga0501070_0167612
613 Ga0501070_0353176
614 Ga0501070_0938419
615 Ga0501071_0049844
616 Ga0501071_1126133
617 Ga0501072_0646812
618 Ga0501073_0000328
619 Ga0501073_0019395
620 Ga0501073_0035013
621 Ga0501073_0093217
622 Ga0501073_0268420
623 Ga0501073_0368375
624 Ga0501074_0026057
625 Ga0501074_0221012
626 Ga0501074_0477121
627 Ga0501074_1335979
628 Ga0501075_0095247
629 Ga0501076_0003848
630 Ga0501076_0040037
631 Ga0501076_0681507
632 Ga0501076_1699751
633 Ga0501076_1734834
634 Ga0501077_0262068
635 Ga0501221_158381
636 Ga0501079_0066727
637 Ga0501079_0252832
638 Ga0501079_1103119
639 Ga0501080_0000360
640 Ga0501080_0073983
641 Ga0501080_0156424
642 Ga0501080_0199348
643 Ga0501080_0237310
644 Ga0501080_0685679
645 Ga0501081_0214836
646 Ga0501083_0038668
647 Ga0501083_0170720
648 Ga0501083_0411894
649 Ga0501035_0001691
650 Ga0501035_0007379
651 Ga0501035_0021358
652 Ga0501035_0045077
653 Ga0501044_0006910
654 Ga0501044_0171709
655 Ga0501045_0020662
656 Ga0501045_0167959
657 Ga0501045_0456769
658 Ga0501045_0466181
659 nmdc:mga00v17_303117_c1
660 nmdc:mga0yw44_1095451_c1
661 nmdc:mga0yw44_505082_c1
662 nmdc:mga0k408_337511_c1
663 nmdc:mga0k408_35796_c1
664 nmdc:mga0k408_411211_c1
665 nmdc:mga06z11_25754_c1
666 nmdc:mga06z11_55219_c1
667 nmdc:mga04h51_186448_c1
668 nmdc:mga07m45_255994_c1
669 nmdc:mga05p37_114170_c1
670 nmdc:mga09592_354_c1
671 nmdc:mga0qj67_31389_c1
672 nmdc:mga0qj67_59406_c1
673 nmdc:mga06r32_215_c1
674 nmdc:mga06r32_34247_c1
675 nmdc:mga08y16_1062021_c1
676 nmdc:mga0n895_1188703_c1
677 Ga0495601_0015027
678 Ga0495595_0039778
679 Ga0495595_0117777
680 Ga0495619_0136883
681 Ga0500568_0002127
682 Ga0500611_006553
683 Ga0501084_0032770
684 Ga0501084_0047920
685 Ga0501084_0262106
686 Ga0501084_0281537
687 Ga0590077_089416
688 Ga0501082_0002529
689 Ga0501082_0031839
690 Ga0501082_0034751
691 Ga0501082_0594147
692 Ga0530510_0228541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

59

136

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e2g-assembly2.cif.gz_C crystal structure of cupin fold protein sthe2323 from sphaerobacter thermophilus 0.9378 19 111
3rns-assembly1.cif.gz_A cupin 2 conserved barrel domain protein from leptotrichia buccalis 0.9344 19 108
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9251 33 109
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9191 33 108
1yhf-assembly1.cif.gz_A crystal structure of conserved spy1581 protein of unknown function from streptococcus pyogenes 0.9104 19 112
ID Description Score Start End Superfamily
4e2gD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9432 34 112 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9375 33 120 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9349 34 108 2.60.120.10
2dctB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9249 33 109 2.60.120.10
af_P91416_1_157_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9237 50 106 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A812XGP2-F1-model_v4 deleted 1.001 1 118
AF-Q2IDL1-F1-model_v4 Cupin domain protein 1 1 120
AF-A0A6P0P3D4-F1-model_v4 Cupin domain-containing protein 0.9991 1 120
AF-A0A3B8YZF2-F1-model_v4 Cupin 0.9989 1 119
AF-A0A2U3L9B5-F1-model_v4 Cupin 2, conserved barrel domain protein 0.9971 1 120

Map