F416672

General Info

Members Datasets Scaffolds Average Seq Length
346 235 328 394

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10019286|Ga0070681_100192864
Length 387
Sequence MAILTDTLALPFFNDDHRRFAEALENWADAKLPPLPHSDVDAACRARVKAMGEAGLLKTVVPQAYGGLYPTLDVRTLCLAREILAFRDGLADFAFAMQGLGTGSITLFGSESLKRRYLPAEXXSDVAALAMTATPDGDAHVRLDGEKTWISNGGIADHYVVFARTGEAPGAKGLSAFVVDAETPGFSVAERIEVIAPHPLARLKFDSVRVPVLNRLGRAGDGFKVAMATLDIFRATVGAAALGFARRALHETLRHTSGRKLFGGSLADLQMTQAAIADGATDVDAAALLVYRAAWTKDVGATGTGTARVTREAAMAKMFATEAAQRVIDRAVQLHGGLGITKGVKVEELYREIRALRIYEGATEVQKIVIAREALKTRASKRAEAAE

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2643221733 Bosea sp. Root381 Isolate Unclassified
4 2643221734 Bosea sp. Root670 Isolate Unclassified
5 2643221736 Bosea sp. Root483D1 Isolate Unclassified
6 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
7 2818991467 Bosea vestrisii 3192 Isolate Unclassified
8 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
9 2841760612 Bosea sp. Tri-49 Isolate Nodule
10 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
11 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
12 2844104063 Bosea sp. Tri-39 Isolate Nodule
13 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
14 2851182111 Bosea sp. Tri-44 Isolate Nodule
15 2851246043 Bosea sp. Tri-54 Isolate Nodule
16 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
17 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
156 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
235 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.8
Metatranscriptomes 0
Isolates 5.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.58
Nodule 2.89
Rhizoplane 13.29
Rhizosphere 66.47
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000047 3300003187 Bacteria 166938
2 JGI25151J46595_10000086 3300003187 Bacteria 126250
3 JGI25406J46586_10029250 3300003203 Bacteria 2088
4 JGI25160J50197_1011575 3300003354 Bacteria 3117
5 Ga0055526_1000102 3300003771 Bacteria 74957
6 Ga0055526_1002158 3300003771 Bacteria 13484
7 Ga0055524_1000150 3300003775 Bacteria 82444
8 Ga0065165_1000089 3300005262 Bacteria 150859
9 Ga0068868_100003937 3300005338 Bacteria 10376
10 Ga0070689_100035781 3300005340 Bacteria 3795
11 Ga0070687_100008696 3300005343 Bacteria 4312
12 Ga0070661_100146820 3300005344 Bacteria 1781
13 Ga0070668_100081980 3300005347 Bacteria 2529
14 Ga0070669_100123375 3300005353 Bacteria 1979
15 Ga0070675_100059023 3300005354 Bacteria 3164
16 Ga0070675_100169348 3300005354 Bacteria 1883
17 Ga0070674_100020513 3300005356 Bacteria 4225
18 Ga0070674_100069229 3300005356 Bacteria 2489
19 Ga0070673_100033012 3300005364 Bacteria 3903
20 Ga0070688_100028453 3300005365 Bacteria 3336
21 Ga0070659_100251859 3300005366 Bacteria 1464
22 Ga0070667_100042698 3300005367 Bacteria 3804
23 Ga0070710_10045417 3300005437 Bacteria 2442
24 Ga0070710_10049948 3300005437 Bacteria 2342
25 Ga0070701_10049553 3300005438 Bacteria 2172
26 Ga0070711_100011073 3300005439 Bacteria 5596
27 Ga0070711_100016247 3300005439 Bacteria 4724
28 Ga0070700_100025790 3300005441 Bacteria 3464
29 Ga0070663_100012742 3300005455 Bacteria 5331
30 Ga0070678_100003998 3300005456 Bacteria 8293
31 Ga0070678_100284938 3300005456 Bacteria 1398
32 Ga0070662_100014358 3300005457 Bacteria 5289
33 Ga0070681_10019286 3300005458 Bacteria 6823
34 Ga0068867_100033141 3300005459 Bacteria 3739
35 Ga0068867_100133937 3300005459 Bacteria 1929
36 Ga0070699_100049587 3300005518 Bacteria 3634
37 Ga0070679_100018063 3300005530 Bacteria 6836
38 Ga0070672_100077231 3300005543 Bacteria 2662
39 Ga0070693_100105837 3300005547 Bacteria 1721
40 Ga0070665_100138676 3300005548 Bacteria 2435
41 Ga0070664_100097888 3300005564 Bacteria 2548
42 Ga0070664_100271567 3300005564 Bacteria 1527
43 Ga0068854_100096046 3300005578 Bacteria 2213
44 Ga0068859_100048621 3300005617 Bacteria 4260
45 Ga0068859_100559839 3300005617 Bacteria 1237
46 Ga0068866_10010634 3300005718 Bacteria 3952
47 Ga0068870_10008552 3300005840 Bacteria 4610
48 Ga0068863_100032038 3300005841 Bacteria 5013
49 Ga0068860_100094144 3300005843 Bacteria 2855
50 Ga0068862_100218256 3300005844 Bacteria 1725
51 Ga0081455_10001118 3300005937 Bacteria 33528
52 Ga0081455_10031417 3300005937 Bacteria 4806
53 Ga0081538_10019766 3300005981 Bacteria 4986
54 Ga0081540_1000085 3300005983 Bacteria 99716
55 Ga0081540_1021237 3300005983 Bacteria 3875
56 Ga0081539_10000785 3300005985 Bacteria 61844
57 Ga0070717_10046060 3300006028 Bacteria 3567
58 Ga0070717_10073182 3300006028 Bacteria 2863
59 Ga0075365_10020266 3300006038 Bacteria 4120
60 Ga0075368_10037642 3300006042 Bacteria 1892
61 Ga0075363_100037489 3300006048 Bacteria 2546
62 Ga0070712_100001310 3300006175 Bacteria 15063
63 Ga0070712_100089088 3300006175 Bacteria 2256
64 Ga0070712_100205775 3300006175 Bacteria 1549
65 Ga0075362_10058619 3300006177 Bacteria 1737
66 Ga0075367_10031643 3300006178 Bacteria 3039
67 Ga0075367_10050493 3300006178 Bacteria 2456
68 Ga0075367_10057325 3300006178 Bacteria 2316
69 Ga0075366_10002937 3300006195 Bacteria 8864
70 Ga0075366_10124034 3300006195 Bacteria 1557
71 Ga0097621_100326542 3300006237 Bacteria 1360
72 Ga0075370_10032898 3300006353 Bacteria 2901
73 Ga0075370_10081883 3300006353 Bacteria 1855
74 Ga0075431_100265027 3300006847 Bacteria 1743
75 Ga0075431_100355286 3300006847 Bacteria 1472
76 Ga0075434_100087424 3300006871 Bacteria 3118
77 Ga0075429_100122175 3300006880 Bacteria 2276
78 Ga0075429_100199047 3300006880 Bacteria 1755
79 Ga0068865_100127277 3300006881 Bacteria 1903
80 Ga0097620_100048615 3300006931 Bacteria 4260
81 Ga0097620_100559865 3300006931 Bacteria 1237
82 Ga0111539_10077487 3300009094 Bacteria 3913
83 Ga0111539_10082393 3300009094 Bacteria 3784
84 Ga0111539_10316276 3300009094 Bacteria 1817
85 Ga0105245_10228879 3300009098 Bacteria 1797
86 Ga0105247_10056456 3300009101 Bacteria 2425
87 Ga0114129_10117327 3300009147 Bacteria 3668
88 Ga0105248_10202722 3300009177 Bacteria 2235
89 Ga0105249_10259541 3300009553 Bacteria 1726
90 Ga0105239_10095094 3300010375 Bacteria 3292
91 Ga0105246_10092806 3300011119 Bacteria 2180
92 Ga0171462_1011 3300013250 Bacteria 229282
93 Ga0157375_10147388 3300013308 Bacteria 2485
94 Ga0163163_10238446 3300014325 Bacteria 1868
95 Ga0157380_10301855 3300014326 Bacteria 1475
96 Ga0157380_10375553 3300014326 Bacteria 1340
97 Ga0157377_10037953 3300014745 Bacteria 2657
98 Ga0157376_10380775 3300014969 Bacteria 1359
99 Ga0213872_10010935 3300021361 Bacteria 4306
100 Ga0213876_10093380 3300021384 Bacteria 1594
101 Ga0209130_1000087 3300025284 Bacteria 155407
102 Ga0209130_1003103 3300025284 Bacteria 7411
103 Ga0209675_1001089 3300025291 Bacteria 16710
104 Ga0209025_1000016 3300025294 Bacteria 770739
105 Ga0209025_1002055 3300025294 Bacteria 22908
106 Ga0209025_1039064 3300025294 Bacteria 2077
107 Ga0209564_1000023 3300025295 Bacteria 555102
108 Ga0209564_1000035 3300025295 Bacteria 442446
109 Ga0209758_1000158 3300025297 Bacteria 156129
110 Ga0209256_1000025 3300025299 Bacteria 442449
111 Ga0209256_1000330 3300025299 Bacteria 79958
112 Ga0207426_1000287 3300025302 Bacteria 100566
113 Ga0207656_10012246 3300025321 Bacteria 3258
114 Ga0207682_10009365 3300025893 Bacteria 3867
115 Ga0207710_10018385 3300025900 Bacteria 2972
116 Ga0207710_10044831 3300025900 Bacteria 1971
117 Ga0207688_10003505 3300025901 Bacteria 8561
118 Ga0207688_10089348 3300025901 Bacteria 1767
119 Ga0207685_10015941 3300025905 Bacteria 2393
120 Ga0207645_10073030 3300025907 Bacteria 2196
121 Ga0207643_10003204 3300025908 Bacteria 8814
122 Ga0207643_10091393 3300025908 Bacteria 1775
123 Ga0207707_10018281 3300025912 Bacteria 6112
124 Ga0207693_10002808 3300025915 Bacteria 15091
125 Ga0207693_10173196 3300025915 Bacteria 1699
126 Ga0207693_10183717 3300025915 Bacteria 1646
127 Ga0207693_10189081 3300025915 Bacteria 1621
128 Ga0207663_10063884 3300025916 Bacteria 2346
129 Ga0207663_10127146 3300025916 Bacteria 1755
130 Ga0207663_10148525 3300025916 Bacteria 1641
131 Ga0207662_10052752 3300025918 Bacteria 2421
132 Ga0207662_10057227 3300025918 Bacteria 2330
133 Ga0207657_10008203 3300025919 Bacteria 10643
134 Ga0207649_10031778 3300025920 Bacteria 3141
135 Ga0207650_10038255 3300025925 Bacteria 3502
136 Ga0207659_10106998 3300025926 Bacteria 2119
137 Ga0207700_10026457 3300025928 Bacteria 4044
138 Ga0207644_10016494 3300025931 Bacteria 4971
139 Ga0207706_10018002 3300025933 Bacteria 6357
140 Ga0207706_10176960 3300025933 Bacteria 1874
141 Ga0207709_10029580 3300025935 Bacteria 3179
142 Ga0207670_10018962 3300025936 Bacteria 4194
143 Ga0207670_10133950 3300025936 Bacteria 1819
144 Ga0207669_10007280 3300025937 Bacteria 5104
145 Ga0207669_10012086 3300025937 Bacteria 4231
146 Ga0207665_10001028 3300025939 Bacteria 18828
147 Ga0207691_10013936 3300025940 Bacteria 7670
148 Ga0207691_10027477 3300025940 Bacteria 5334
149 Ga0207691_10097197 3300025940 Bacteria 2632
150 Ga0207691_10175221 3300025940 Bacteria 1876
151 Ga0207689_10019224 3300025942 Bacteria 5758
152 Ga0207689_10063968 3300025942 Bacteria 3027
153 Ga0207679_10071622 3300025945 Bacteria 2615
154 Ga0207679_10215291 3300025945 Bacteria 1613
155 Ga0207679_10235655 3300025945 Bacteria 1548
156 Ga0207651_10043859 3300025960 Bacteria 2988
157 Ga0207668_10022676 3300025972 Bacteria 4024
158 Ga0207668_10336718 3300025972 Bacteria 1257
159 Ga0207640_10120493 3300025981 Bacteria 1878
160 Ga0207678_10027199 3300026067 Bacteria 4988
161 Ga0207708_10107263 3300026075 Bacteria 2166
162 Ga0207708_10167345 3300026075 Bacteria 1739
163 Ga0207641_10023689 3300026088 Bacteria 5058
164 Ga0207648_10032361 3300026089 Bacteria 4618
165 Ga0207648_10051502 3300026089 Bacteria 3599
166 Ga0207648_10174596 3300026089 Bacteria 1900
167 Ga0207676_10015791 3300026095 Bacteria 5459
168 Ga0207676_10020617 3300026095 Bacteria 4825
169 Ga0207674_10049301 3300026116 Bacteria 4307
170 Ga0207675_100020523 3300026118 Bacteria 6159
171 Ga0207683_10013274 3300026121 Bacteria 7023
172 Ga0207698_10141886 3300026142 Bacteria 2071
173 Ga0209813_10009107 3300027866 Bacteria 2529
174 Ga0268266_10179591 3300028379 Bacteria 1926
175 Ga0268264_10160607 3300028381 Bacteria 2024
176 Ga0265318_10029594 3300028577 Bacteria 2135
177 Ga0265332_10001225 3300031238 Bacteria 14836
178 Ga0265325_10074654 3300031241 Bacteria 1695
179 Ga0265340_10000669 3300031247 Bacteria 19187
180 Ga0265339_10000253 3300031249 Bacteria 42950
181 Ga0265331_10043963 3300031250 Bacteria 2161
182 Ga0265316_10193037 3300031344 Bacteria 1512
183 Ga0265314_10021311 3300031711 Bacteria 4986
184 Ga0265314_10117508 3300031711 Bacteria 1680
185 Ga0265342_10000039 3300031712 Bacteria 140091
186 Ga0373936_0057919 3300035113 Bacteria 1577
187 Ga0373945_0022786 3300035116 Bacteria 2160
188 Ga0373935_0030396 3300035692 Bacteria 3348
189 Ga0373947_0121356 3300035725 Bacteria 1660
190 Ga0373925_0028528 3300037068 Bacteria 4090
191 Ga0373925_0084812 3300037068 Bacteria 2414
192 Ga0436365_0203272 3300039437 Bacteria 1393
193 Ga0436365_0264371 3300039437 Bacteria 4240
194 Ga0439453_0007268 3300041408 Bacteria 1752
195 Ga0439446_0011728 3300042156 Bacteria 2384
196 Ga0439460_0023888 3300042461 Bacteria 1689
197 Ga0495590_0050564 3300046457 Bacteria 1451
198 Ga0495638_0004143 3300046460 Bacteria 11070
199 Ga0495638_0017807 3300046460 Bacteria 4729
200 Ga0495582_0028936 3300046473 Bacteria 3042
201 Ga0495594_0013437 3300046499 Bacteria 4277
202 Ga0495643_0083535 3300046522 Bacteria 1658
203 Ga0495652_0045418 3300046529 Bacteria 3777
204 Ga0495640_0025518 3300046533 Bacteria 4285
205 Ga0495668_0045012 3300046616 Bacteria 2453
206 Ga0495634_0029404 3300046642 Bacteria 3804
207 Ga0495647_0019621 3300046681 Bacteria 2418
208 Ga0495669_0044009 3300046684 Bacteria 1988
209 Ga0495581_0079804 3300047315 Bacteria 1894
210 Ga0495604_0166342 3300047317 Bacteria 1555
211 Ga0495674_0003335 3300047319 Bacteria 15593
212 Ga0495674_0260100 3300047319 Bacteria 1426
213 Ga0495672_0107369 3300047320 Bacteria 1504
214 Ga0495676_0240239 3300047321 Bacteria 1240
215 Ga0495680_0197273 3300047322 Bacteria 1446
216 Ga0495626_0091522 3300048091 Bacteria 1337
217 Ga0496100_0025718 3300048903 Bacteria 3601
218 Ga0496100_0175007 3300048903 Bacteria 1548
219 Ga0496101_0002302 3300048904 Bacteria 11681
220 Ga0496101_0090362 3300048904 Bacteria 2277
221 Ga0496102_0015422 3300048905 Bacteria 6656
222 Ga0496102_0033040 3300048905 Bacteria 4648
223 Ga0496102_0060893 3300048905 Bacteria 3453
224 Ga0496103_0004970 3300048906 Bacteria 8024
225 Ga0496103_0028678 3300048906 Bacteria 3379
226 Ga0496104_0001459 3300048907 Bacteria 20443
227 Ga0496105_0020603 3300048908 Bacteria 5330
228 Ga0496105_0021253 3300048908 Bacteria 5251
229 Ga0496106_0022989 3300048909 Bacteria 4630
230 Ga0496106_0025029 3300048909 Bacteria 4440
231 Ga0496106_0173609 3300048909 Bacteria 1709
232 Ga0496107_0009730 3300048910 Bacteria 6667
233 Ga0496107_0034648 3300048910 Bacteria 3616
234 Ga0496108_0004926 3300048911 Bacteria 10785
235 Ga0496108_0008116 3300048911 Bacteria 8514
236 Ga0496108_0041117 3300048911 Bacteria 3857
237 Ga0496109_0005534 3300048912 Bacteria 10581
238 Ga0496109_0017030 3300048912 Bacteria 6360
239 Ga0496109_0042653 3300048912 Bacteria 4110
240 Ga0496109_0133374 3300048912 Bacteria 2319
241 Ga0496109_0375958 3300048912 Bacteria 1342
242 Ga0496110_0003213 3300048913 Bacteria 12442
243 Ga0496110_0008208 3300048913 Bacteria 8392
244 Ga0496110_0012479 3300048913 Bacteria 6987
245 Ga0496110_0013740 3300048913 Bacteria 6709
246 Ga0496110_0092763 3300048913 Bacteria 2702
247 Ga0496111_0000245 3300048914 Bacteria 26053
248 Ga0496111_0010631 3300048914 Bacteria 6185
249 Ga0496111_0021560 3300048914 Bacteria 4501
250 Ga0496112_0005390 3300048915 Bacteria 11055
251 Ga0496112_0010464 3300048915 Bacteria 8414
252 Ga0496112_0017506 3300048915 Bacteria 6734
253 Ga0496112_0057342 3300048915 Bacteria 3834
254 Ga0496112_0296054 3300048915 Bacteria 1564
255 Ga0496112_0317194 3300048915 Bacteria 1503
256 Ga0496113_0058585 3300048916 Bacteria 2898
257 Ga0496113_0067023 3300048916 Bacteria 2720
258 Ga0496114_0016642 3300048917 Bacteria 5929
259 Ga0496114_0080177 3300048917 Bacteria 2757
260 Ga0496115_0048717 3300048918 Bacteria 3389
261 Ga0496115_0073010 3300048918 Bacteria 2784
262 Ga0496115_0165731 3300048918 Bacteria 1827
263 Ga0496122_0040220 3300048925 Bacteria 3719
264 Ga0496123_0027160 3300048926 Bacteria 4269
265 Ga0496123_0029552 3300048926 Bacteria 4030
266 Ga0496123_0044466 3300048926 Bacteria 3037
267 Ga0501031_0168144 3300049568 Bacteria 1433
268 Ga0501033_0045380 3300049570 Bacteria 3271
269 Ga0501034_0066501 3300049571 Bacteria 3617
270 Ga0501034_0123208 3300049571 Bacteria 2578
271 Ga0501038_0374571 3300049574 Bacteria 1105
272 Ga0501039_0247576 3300049575 Bacteria 1402
273 Ga0501042_0036032 3300049578 Bacteria 3510
274 Ga0501043_0005145 3300049579 Bacteria 10585
275 Ga0501047_0068103 3300049581 Bacteria 3429
276 Ga0501047_0152424 3300049581 Bacteria 2187
277 Ga0501047_0203959 3300049581 Bacteria 1837
278 Ga0501048_0263402 3300049582 Bacteria 1225
279 Ga0501069_0012701 3300049585 Bacteria 4482
280 Ga0501073_0009744 3300049589 Bacteria 7073
281 Ga0501074_0001813 3300049590 Bacteria 14621
282 Ga0501079_0015756 3300049741 Bacteria 5775
283 Ga0501079_0037938 3300049741 Bacteria 3716
284 Ga0501079_0301853 3300049741 Bacteria 1253
285 Ga0501080_0043043 3300049742 Bacteria 4204
286 Ga0501080_0137517 3300049742 Bacteria 2260
287 Ga0501081_0008996 3300049743 Bacteria 6493
288 Ga0501081_0215505 3300049743 Bacteria 1395
289 Ga0501083_0072755 3300049744 Bacteria 2285
290 Ga0501035_0046032 3300049822 Bacteria 3923
291 Ga0501035_0107412 3300049822 Bacteria 2447
292 Ga0501044_0000961 3300049823 Bacteria 34651
293 Ga0501044_0024495 3300049823 Bacteria 6404
294 Ga0501044_0068398 3300049823 Bacteria 3617
295 Ga0501044_0112995 3300049823 Bacteria 2723
296 Ga0501045_0003920 3300049824 Bacteria 10251
297 nmdc:mga0yw44_20492_c1 3300050492 Bacteria 3670
298 nmdc:mga0yw44_67754_c1 3300050492 Bacteria 2207
299 nmdc:mga0k408_1926_c2 3300050493 Bacteria 9273
300 nmdc:mga0k408_20096_c1 3300050493 Bacteria 3737
301 nmdc:mga06z11_22749_c1 3300050494 Bacteria 2933
302 nmdc:mga05p37_6151_c1 3300050507 Bacteria 14127
303 nmdc:mga09592_212161_c1 3300050508 Bacteria 1677
304 nmdc:mga09592_77043_c1 3300050508 Bacteria 2836
305 nmdc:mga06r32_171552_c1 3300050510 Bacteria 2153
306 nmdc:mga06r32_312596_c1 3300050510 Bacteria 1557
307 nmdc:mga08y16_102127_c1 3300050511 Bacteria 2985
308 nmdc:mga0rr50_112733_c1 3300050513 Bacteria 2154
309 Ga0495601_0000446 3300053077 Bacteria 21617
310 Ga0495595_0010687 3300053084 Bacteria 3822
311 Ga0495619_0015026 3300053085 Bacteria 4893
312 Ga0500646_0022858 3300053090 Bacteria 1674
313 Ga0500641_0008166 3300053096 Bacteria 3731
314 Ga0500641_0010047 3300053096 Bacteria 3412
315 Ga0500593_004997 3300053117 Bacteria 5185
316 Ga0500595_002894 3300053119 Bacteria 8228
317 Ga0500595_004596 3300053119 Bacteria 6159
318 Ga0500652_000004 3300053131 Bacteria 173428
319 Ga0500588_0035249 3300053146 Bacteria 1472
320 Ga0500616_0009002 3300053153 Bacteria 6115
321 Ga0500616_0090395 3300053153 Bacteria 1517
322 Ga0500636_0025376 3300053177 Bacteria 3502
323 Ga0501084_0051851 3300054114 Bacteria 3434
324 Ga0501082_0013268 3300060353 Bacteria 7086
325 Ga0501082_0111212 3300060353 Bacteria 2371
326 Ga0501082_0172452 3300060353 Bacteria 1881
327 Ga0530510_0035386 3300061734 Bacteria 3599
328 Ga0530510_0216946 3300061734 Bacteria 1422

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053153 Ga0500616_0090395 Ga0500616_0090395_12_1064 335
2 3300049574 Ga0501038_0374571 Ga0501038_0374571_46_1083 340
3 3300060353 Ga0501082_0111212 Ga0501082_0111212_1285_2343 342
4 3300047321 Ga0495676_0240239 Ga0495676_0240239_163_1215 345
5 3300047320 Ga0495672_0107369 Ga0495672_0107369_31_1116 354
6 3300049571 Ga0501034_0123208 Ga0501034_0123208_18_1085 355
7 3300048091 Ga0495626_0091522 Ga0495626_0091522_237_1319 357
8 3300005437 Ga0070710_10045417 Ga0070710_100454172 360
9 3300005439 Ga0070711_100016247 Ga0070711_1000162472 360
10 3300006175 Ga0070712_100001310 Ga0070712_1000013106 360
11 3300025915 Ga0207693_10002808 Ga0207693_100028088 360
12 3300048903 Ga0496100_0025718 Ga0496100_0025718_1974_3161 362
13 3300048912 Ga0496109_0375958 Ga0496109_0375958_145_1332 362
14 3300048915 Ga0496112_0296054 Ga0496112_0296054_220_1407 362
15 3300006175 Ga0070712_100205775 Ga0070712_1002057752 365
16 3300021384 Ga0213876_10093380 Ga0213876_100933802 365
17 3300025915 Ga0207693_10189081 Ga0207693_101890812 365
18 3300039437 Ga0436365_0264371 Ga0436365_0264371_876_2063 365
19 3300053084 Ga0495595_0010687 Ga0495595_0010687_539_1741 367
20 3300053085 Ga0495619_0015026 Ga0495619_0015026_1642_2844 367
21 3300049582 Ga0501048_0263402 Ga0501048_0263402_30_1208 369
22 3300025916 Ga0207663_10127146 Ga0207663_101271462 371
23 3300035692 Ga0373935_0030396 Ga0373935_0030396_1511_2698 371
24 3300037068 Ga0373925_0028528 Ga0373925_0028528_2672_3859 371
25 3300046533 Ga0495640_0025518 Ga0495640_0025518_1268_2455 371
26 3300046642 Ga0495634_0029404 Ga0495634_0029404_953_2140 371
27 3300047319 Ga0495674_0003335 Ga0495674_0003335_6080_7267 371
28 3300053077 Ga0495601_0000446 Ga0495601_0000446_15395_16582 371
29 3300003771 Ga0055526_1000102 Ga0055526_10001023 374
30 3300025295 Ga0209564_1000023 Ga0209564_100002353 374
31 3300005458 Ga0070681_10019286 Ga0070681_100192864 375
32 3300005530 Ga0070679_100018063 Ga0070679_1000180632 375
33 3300025912 Ga0207707_10018281 Ga0207707_100182815 375
34 3300006038 Ga0075365_10020266 Ga0075365_100202662 381
35 3300006871 Ga0075434_100087424 Ga0075434_1000874242 382
36 iso_pu_bacteria 2844533157 2844533804 382
37 3300003354 JGI25160J50197_1011575 JGI25160J50197_10115752 383
38 3300025284 Ga0209130_1003103 Ga0209130_10031034 383
39 3300025302 Ga0207426_1000287 Ga0207426_100028765 383
40 3300046457 Ga0495590_0050564 Ga0495590_0050564_55_1224 383
41 3300048926 Ga0496123_0044466 Ga0496123_0044466_1636_2829 383
42 3300049568 Ga0501031_0168144 Ga0501031_0168144_243_1415 385
43 3300049741 Ga0501079_0015756 Ga0501079_0015756_1156_2349 385
44 3300049743 Ga0501081_0008996 Ga0501081_0008996_4291_5484 385
45 3300060353 Ga0501082_0013268 Ga0501082_0013268_2554_3747 385
46 3300005983 Ga0081540_1000085 Ga0081540_100008564 386
47 3300039437 Ga0436365_0203272 Ga0436365_0203272_25_1188 386
48 3300049823 Ga0501044_0112995 Ga0501044_0112995_1468_2667 386
49 3300009094 Ga0111539_10077487 Ga0111539_100774872 387
50 3300009094 Ga0111539_10082393 Ga0111539_100823931 387
51 3300013250 Ga0171462_1011 Ga0171462_101154 387
52 iso_pu_bacteria 2841760612 2841762015 387
53 iso_pu_bacteria 2844104063 2844105040 387
54 iso_pu_bacteria 2851182111 2851183475 387
55 iso_pu_bacteria 2851246043 2851248028 387
56 iso_pu_bacteria 8057529695 8057529819 387
57 3300006880 Ga0075429_100199047 Ga0075429_1001990472 388
58 3300049744 Ga0501083_0072755 Ga0501083_0072755_209_1390 388
59 3300050510 nmdc:mga06r32_171552_c1 nmdc:mga06r32_171552_c1_88_1272 388
60 iso_pu_bacteria 2508501050 2508729085 388
61 iso_pu_bacteria 2508501114 2509078108 388
62 iso_pu_bacteria 2775506901 2776258955 388
63 iso_pu_bacteria 2835312727 2835312737 388
64 3300005340 Ga0070689_100035781 Ga0070689_1000357812 389
65 3300005354 Ga0070675_100059023 Ga0070675_1000590232 389
66 3300005356 Ga0070674_100020513 Ga0070674_1000205133 389
67 3300005365 Ga0070688_100028453 Ga0070688_1000284533 389
68 3300005366 Ga0070659_100251859 Ga0070659_1002518592 389
69 3300005456 Ga0070678_100003998 Ga0070678_1000039986 389
70 3300005459 Ga0068867_100033141 Ga0068867_1000331412 389
71 3300005459 Ga0068867_100133937 Ga0068867_1001339372 389
72 3300005547 Ga0070693_100105837 Ga0070693_1001058372 389
73 3300005617 Ga0068859_100559839 Ga0068859_1005598391 389
74 3300005981 Ga0081538_10019766 Ga0081538_100197662 389
75 3300006177 Ga0075362_10058619 Ga0075362_100586192 389
76 3300006195 Ga0075366_10002937 Ga0075366_100029375 389
77 3300006237 Ga0097621_100326542 Ga0097621_1003265421 389
78 3300006931 Ga0097620_100559865 Ga0097620_1005598651 389
79 3300009101 Ga0105247_10056456 Ga0105247_100564562 389
80 3300009177 Ga0105248_10202722 Ga0105248_102027222 389
81 3300011119 Ga0105246_10092806 Ga0105246_100928062 389
82 3300014326 Ga0157380_10301855 Ga0157380_103018552 389
83 3300025297 Ga0209758_1000158 Ga0209758_100015899 389
84 3300025893 Ga0207682_10009365 Ga0207682_100093654 389
85 3300025900 Ga0207710_10018385 Ga0207710_100183852 389
86 3300025905 Ga0207685_10015941 Ga0207685_100159412 389
87 3300025908 Ga0207643_10091393 Ga0207643_100913932 389
88 3300025918 Ga0207662_10052752 Ga0207662_100527522 389
89 3300025925 Ga0207650_10038255 Ga0207650_100382553 389
90 3300025931 Ga0207644_10016494 Ga0207644_100164945 389
91 3300025936 Ga0207670_10018962 Ga0207670_100189625 389
92 3300025937 Ga0207669_10007280 Ga0207669_100072804 389
93 3300025940 Ga0207691_10013936 Ga0207691_100139362 389
94 3300025942 Ga0207689_10063968 Ga0207689_100639682 389
95 3300025960 Ga0207651_10043859 Ga0207651_100438592 389
96 3300025972 Ga0207668_10022676 Ga0207668_100226762 389
97 3300026075 Ga0207708_10107263 Ga0207708_101072633 389
98 3300026075 Ga0207708_10167345 Ga0207708_101673452 389
99 3300026089 Ga0207648_10051502 Ga0207648_100515021 389
100 3300026089 Ga0207648_10174596 Ga0207648_101745962 389
101 3300026095 Ga0207676_10015791 Ga0207676_100157914 389
102 3300028381 Ga0268264_10160607 Ga0268264_101606072 389
103 3300035116 Ga0373945_0022786 Ga0373945_0022786_431_1618 389
104 3300047319 Ga0495674_0260100 Ga0495674_0260100_104_1291 389
105 3300048904 Ga0496101_0090362 Ga0496101_0090362_967_2154 389
106 3300048909 Ga0496106_0173609 Ga0496106_0173609_414_1601 389
107 3300048913 Ga0496110_0092763 Ga0496110_0092763_1486_2673 389
108 3300048915 Ga0496112_0317194 Ga0496112_0317194_194_1381 389
109 3300048918 Ga0496115_0048717 Ga0496115_0048717_2100_3287 389
110 3300050493 nmdc:mga0k408_1926_c2 nmdc:mga0k408_1926_c2_2658_3845 389
111 iso_pu_bacteria 2884298095 2884300090 389
112 3300003203 JGI25406J46586_10029250 JGI25406J46586_100292502 390
113 3300005338 Ga0068868_100003937 Ga0068868_10000393710 390
114 3300005343 Ga0070687_100008696 Ga0070687_1000086961 390
115 3300005344 Ga0070661_100146820 Ga0070661_1001468201 390
116 3300005347 Ga0070668_100081980 Ga0070668_1000819803 390
117 3300005353 Ga0070669_100123375 Ga0070669_1001233752 390
118 3300005354 Ga0070675_100169348 Ga0070675_1001693482 390
119 3300005356 Ga0070674_100069229 Ga0070674_1000692292 390
120 3300005364 Ga0070673_100033012 Ga0070673_1000330122 390
121 3300005367 Ga0070667_100042698 Ga0070667_1000426982 390
122 3300005437 Ga0070710_10049948 Ga0070710_100499482 390
123 3300005438 Ga0070701_10049553 Ga0070701_100495532 390
124 3300005439 Ga0070711_100011073 Ga0070711_1000110735 390
125 3300005441 Ga0070700_100025790 Ga0070700_1000257902 390
126 3300005455 Ga0070663_100012742 Ga0070663_1000127426 390
127 3300005456 Ga0070678_100284938 Ga0070678_1002849381 390
128 3300005457 Ga0070662_100014358 Ga0070662_1000143584 390
129 3300005518 Ga0070699_100049587 Ga0070699_1000495873 390
130 3300005543 Ga0070672_100077231 Ga0070672_1000772313 390
131 3300005548 Ga0070665_100138676 Ga0070665_1001386762 390
132 3300005564 Ga0070664_100097888 Ga0070664_1000978882 390
133 3300005564 Ga0070664_100271567 Ga0070664_1002715672 390
134 3300005578 Ga0068854_100096046 Ga0068854_1000960462 390
135 3300005617 Ga0068859_100048621 Ga0068859_1000486214 390
136 3300005718 Ga0068866_10010634 Ga0068866_100106342 390
137 3300005840 Ga0068870_10008552 Ga0068870_100085522 390
138 3300005841 Ga0068863_100032038 Ga0068863_1000320385 390
139 3300005843 Ga0068860_100094144 Ga0068860_1000941442 390
140 3300005844 Ga0068862_100218256 Ga0068862_1002182562 390
141 3300005937 Ga0081455_10001118 Ga0081455_1000111814 390
142 3300005937 Ga0081455_10031417 Ga0081455_100314172 390
143 3300005983 Ga0081540_1021237 Ga0081540_10212375 390
144 3300005985 Ga0081539_10000785 Ga0081539_1000078554 390
145 3300006028 Ga0070717_10046060 Ga0070717_100460603 390
146 3300006028 Ga0070717_10073182 Ga0070717_100731823 390
147 3300006042 Ga0075368_10037642 Ga0075368_100376422 390
148 3300006048 Ga0075363_100037489 Ga0075363_1000374892 390
149 3300006175 Ga0070712_100089088 Ga0070712_1000890882 390
150 3300006178 Ga0075367_10031643 Ga0075367_100316432 390
151 3300006178 Ga0075367_10050493 Ga0075367_100504932 390
152 3300006178 Ga0075367_10057325 Ga0075367_100573252 390
153 3300006353 Ga0075370_10032898 Ga0075370_100328982 390
154 3300006353 Ga0075370_10081883 Ga0075370_100818832 390
155 3300006847 Ga0075431_100265027 Ga0075431_1002650272 390
156 3300006847 Ga0075431_100355286 Ga0075431_1003552862 390
157 3300006880 Ga0075429_100122175 Ga0075429_1001221752 390
158 3300006881 Ga0068865_100127277 Ga0068865_1001272772 390
159 3300006931 Ga0097620_100048615 Ga0097620_1000486154 390
160 3300009094 Ga0111539_10316276 Ga0111539_103162762 390
161 3300009098 Ga0105245_10228879 Ga0105245_102288792 390
162 3300009147 Ga0114129_10117327 Ga0114129_101173273 390
163 3300009553 Ga0105249_10259541 Ga0105249_102595412 390
164 3300010375 Ga0105239_10095094 Ga0105239_100950942 390
165 3300013308 Ga0157375_10147388 Ga0157375_101473882 390
166 3300014325 Ga0163163_10238446 Ga0163163_102384462 390
167 3300014326 Ga0157380_10375553 Ga0157380_103755531 390
168 3300014745 Ga0157377_10037953 Ga0157377_100379532 390
169 3300014969 Ga0157376_10380775 Ga0157376_103807752 390
170 3300021361 Ga0213872_10010935 Ga0213872_100109355 390
171 3300025321 Ga0207656_10012246 Ga0207656_100122462 390
172 3300025900 Ga0207710_10044831 Ga0207710_100448312 390
173 3300025901 Ga0207688_10003505 Ga0207688_100035052 390
174 3300025901 Ga0207688_10089348 Ga0207688_100893482 390
175 3300025907 Ga0207645_10073030 Ga0207645_100730302 390
176 3300025908 Ga0207643_10003204 Ga0207643_100032043 390
177 3300025915 Ga0207693_10173196 Ga0207693_101731961 390
178 3300025915 Ga0207693_10183717 Ga0207693_101837172 390
179 3300025916 Ga0207663_10063884 Ga0207663_100638842 390
180 3300025916 Ga0207663_10148525 Ga0207663_101485252 390
181 3300025918 Ga0207662_10057227 Ga0207662_100572273 390
182 3300025919 Ga0207657_10008203 Ga0207657_100082036 390
183 3300025920 Ga0207649_10031778 Ga0207649_100317782 390
184 3300025926 Ga0207659_10106998 Ga0207659_101069982 390
185 3300025928 Ga0207700_10026457 Ga0207700_100264573 390
186 3300025933 Ga0207706_10018002 Ga0207706_100180022 390
187 3300025933 Ga0207706_10176960 Ga0207706_101769602 390
188 3300025935 Ga0207709_10029580 Ga0207709_100295802 390
189 3300025936 Ga0207670_10133950 Ga0207670_101339502 390
190 3300025937 Ga0207669_10012086 Ga0207669_100120862 390
191 3300025939 Ga0207665_10001028 Ga0207665_1000102816 390
192 3300025940 Ga0207691_10027477 Ga0207691_100274773 390
193 3300025940 Ga0207691_10097197 Ga0207691_100971972 390
194 3300025940 Ga0207691_10175221 Ga0207691_101752212 390
195 3300025942 Ga0207689_10019224 Ga0207689_100192242 390
196 3300025945 Ga0207679_10071622 Ga0207679_100716222 390
197 3300025945 Ga0207679_10215291 Ga0207679_102152912 390
198 3300025945 Ga0207679_10235655 Ga0207679_102356552 390
199 3300025972 Ga0207668_10336718 Ga0207668_103367181 390
200 3300025981 Ga0207640_10120493 Ga0207640_101204932 390
201 3300026067 Ga0207678_10027199 Ga0207678_100271994 390
202 3300026088 Ga0207641_10023689 Ga0207641_100236892 390
203 3300026089 Ga0207648_10032361 Ga0207648_100323612 390
204 3300026095 Ga0207676_10020617 Ga0207676_100206172 390
205 3300026116 Ga0207674_10049301 Ga0207674_100493014 390
206 3300026118 Ga0207675_100020523 Ga0207675_1000205235 390
207 3300026121 Ga0207683_10013274 Ga0207683_100132742 390
208 3300026142 Ga0207698_10141886 Ga0207698_101418862 390
209 3300027866 Ga0209813_10009107 Ga0209813_100091072 390
210 3300028379 Ga0268266_10179591 Ga0268266_101795912 390
211 3300028577 Ga0265318_10029594 Ga0265318_100295942 390
212 3300031238 Ga0265332_10001225 Ga0265332_100012256 390
213 3300031241 Ga0265325_10074654 Ga0265325_100746542 390
214 3300031247 Ga0265340_10000669 Ga0265340_100006696 390
215 3300031249 Ga0265339_10000253 Ga0265339_1000025333 390
216 3300031250 Ga0265331_10043963 Ga0265331_100439632 390
217 3300031344 Ga0265316_10193037 Ga0265316_101930372 390
218 3300031711 Ga0265314_10021311 Ga0265314_100213115 390
219 3300031711 Ga0265314_10117508 Ga0265314_101175082 390
220 3300031712 Ga0265342_10000039 Ga0265342_1000003985 390
221 3300035113 Ga0373936_0057919 Ga0373936_0057919_312_1502 390
222 3300035725 Ga0373947_0121356 Ga0373947_0121356_58_1260 390
223 3300037068 Ga0373925_0084812 Ga0373925_0084812_1157_2359 390
224 3300041408 Ga0439453_0007268 Ga0439453_0007268_105_1295 390
225 3300042156 Ga0439446_0011728 Ga0439446_0011728_188_1378 390
226 3300042461 Ga0439460_0023888 Ga0439460_0023888_319_1524 390
227 3300046460 Ga0495638_0004143 Ga0495638_0004143_6838_8028 390
228 3300046460 Ga0495638_0017807 Ga0495638_0017807_1679_2869 390
229 3300046473 Ga0495582_0028936 Ga0495582_0028936_851_2041 390
230 3300046499 Ga0495594_0013437 Ga0495594_0013437_588_1778 390
231 3300046529 Ga0495652_0045418 Ga0495652_0045418_2163_3353 390
232 3300046616 Ga0495668_0045012 Ga0495668_0045012_389_1579 390
233 3300046681 Ga0495647_0019621 Ga0495647_0019621_26_1216 390
234 3300046684 Ga0495669_0044009 Ga0495669_0044009_121_1311 390
235 3300047315 Ga0495581_0079804 Ga0495581_0079804_623_1813 390
236 3300047317 Ga0495604_0166342 Ga0495604_0166342_14_1204 390
237 3300047322 Ga0495680_0197273 Ga0495680_0197273_164_1366 390
238 3300048903 Ga0496100_0175007 Ga0496100_0175007_178_1368 390
239 3300048904 Ga0496101_0002302 Ga0496101_0002302_9466_10656 390
240 3300048905 Ga0496102_0015422 Ga0496102_0015422_1770_2960 390
241 3300048905 Ga0496102_0033040 Ga0496102_0033040_3356_4546 390
242 3300048905 Ga0496102_0060893 Ga0496102_0060893_187_1377 390
243 3300048906 Ga0496103_0004970 Ga0496103_0004970_6012_7202 390
244 3300048906 Ga0496103_0028678 Ga0496103_0028678_2009_3199 390
245 3300048907 Ga0496104_0001459 Ga0496104_0001459_1091_2281 390
246 3300048908 Ga0496105_0020603 Ga0496105_0020603_319_1509 390
247 3300048908 Ga0496105_0021253 Ga0496105_0021253_3260_4450 390
248 3300048909 Ga0496106_0022989 Ga0496106_0022989_181_1371 390
249 3300048909 Ga0496106_0025029 Ga0496106_0025029_1559_2749 390
250 3300048910 Ga0496107_0009730 Ga0496107_0009730_2542_3732 390
251 3300048910 Ga0496107_0034648 Ga0496107_0034648_1768_2958 390
252 3300048911 Ga0496108_0004926 Ga0496108_0004926_1230_2420 390
253 3300048911 Ga0496108_0041117 Ga0496108_0041117_1172_2362 390
254 3300048912 Ga0496109_0017030 Ga0496109_0017030_3180_4370 390
255 3300048912 Ga0496109_0042653 Ga0496109_0042653_1214_2404 390
256 3300048912 Ga0496109_0133374 Ga0496109_0133374_844_2034 390
257 3300048913 Ga0496110_0003213 Ga0496110_0003213_10882_12072 390
258 3300048913 Ga0496110_0012479 Ga0496110_0012479_2231_3421 390
259 3300048913 Ga0496110_0013740 Ga0496110_0013740_2272_3462 390
260 3300048914 Ga0496111_0010631 Ga0496111_0010631_4948_6138 390
261 3300048914 Ga0496111_0021560 Ga0496111_0021560_471_1661 390
262 3300048915 Ga0496112_0005390 Ga0496112_0005390_6629_7819 390
263 3300048915 Ga0496112_0017506 Ga0496112_0017506_2759_3949 390
264 3300048915 Ga0496112_0057342 Ga0496112_0057342_646_1836 390
265 3300048916 Ga0496113_0058585 Ga0496113_0058585_1286_2476 390
266 3300048917 Ga0496114_0016642 Ga0496114_0016642_3022_4212 390
267 3300048917 Ga0496114_0080177 Ga0496114_0080177_1040_2230 390
268 3300048918 Ga0496115_0073010 Ga0496115_0073010_737_1927 390
269 3300048918 Ga0496115_0165731 Ga0496115_0165731_443_1633 390
270 3300049570 Ga0501033_0045380 Ga0501033_0045380_1062_2270 390
271 3300049571 Ga0501034_0066501 Ga0501034_0066501_445_1653 390
272 3300049575 Ga0501039_0247576 Ga0501039_0247576_181_1371 390
273 3300049578 Ga0501042_0036032 Ga0501042_0036032_1524_2732 390
274 3300049579 Ga0501043_0005145 Ga0501043_0005145_8067_9275 390
275 3300049581 Ga0501047_0068103 Ga0501047_0068103_812_2020 390
276 3300049581 Ga0501047_0152424 Ga0501047_0152424_219_1427 390
277 3300049581 Ga0501047_0203959 Ga0501047_0203959_605_1801 390
278 3300049585 Ga0501069_0012701 Ga0501069_0012701_2093_3301 390
279 3300049589 Ga0501073_0009744 Ga0501073_0009744_3899_5107 390
280 3300049590 Ga0501074_0001813 Ga0501074_0001813_12377_13585 390
281 3300049741 Ga0501079_0037938 Ga0501079_0037938_1822_3030 390
282 3300049741 Ga0501079_0301853 Ga0501079_0301853_52_1242 390
283 3300049742 Ga0501080_0043043 Ga0501080_0043043_2317_3525 390
284 3300049743 Ga0501081_0215505 Ga0501081_0215505_182_1372 390
285 3300049822 Ga0501035_0046032 Ga0501035_0046032_751_1959 390
286 3300049823 Ga0501044_0000961 Ga0501044_0000961_19659_20867 390
287 3300049823 Ga0501044_0068398 Ga0501044_0068398_1965_3173 390
288 3300049824 Ga0501045_0003920 Ga0501045_0003920_5812_7020 390
289 3300050492 nmdc:mga0yw44_20492_c1 nmdc:mga0yw44_20492_c1_999_2189 390
290 3300050492 nmdc:mga0yw44_67754_c1 nmdc:mga0yw44_67754_c1_680_1870 390
291 3300050493 nmdc:mga0k408_20096_c1 nmdc:mga0k408_20096_c1_1496_2698 390
292 3300050494 nmdc:mga06z11_22749_c1 nmdc:mga06z11_22749_c1_986_2179 390
293 3300050507 nmdc:mga05p37_6151_c1 nmdc:mga05p37_6151_c1_11329_12519 390
294 3300050508 nmdc:mga09592_212161_c1 nmdc:mga09592_212161_c1_270_1460 390
295 3300050508 nmdc:mga09592_77043_c1 nmdc:mga09592_77043_c1_1166_2356 390
296 3300050510 nmdc:mga06r32_312596_c1 nmdc:mga06r32_312596_c1_208_1398 390
297 3300050511 nmdc:mga08y16_102127_c1 nmdc:mga08y16_102127_c1_93_1283 390
298 3300050513 nmdc:mga0rr50_112733_c1 nmdc:mga0rr50_112733_c1_562_1752 390
299 3300053090 Ga0500646_0022858 Ga0500646_0022858_454_1644 390
300 3300053096 Ga0500641_0008166 Ga0500641_0008166_1574_2764 390
301 3300053096 Ga0500641_0010047 Ga0500641_0010047_1282_2487 390
302 3300053117 Ga0500593_004997 Ga0500593_004997_2488_3684 390
303 3300053119 Ga0500595_002894 Ga0500595_002894_442_1629 390
304 3300053119 Ga0500595_004596 Ga0500595_004596_4743_5936 390
305 3300053131 Ga0500652_000004 Ga0500652_000004_130964_132151 390
306 3300053146 Ga0500588_0035249 Ga0500588_0035249_256_1446 390
307 3300053153 Ga0500616_0009002 Ga0500616_0009002_1609_2793 390
308 3300054114 Ga0501084_0051851 Ga0501084_0051851_1152_2360 390
309 3300060353 Ga0501082_0172452 Ga0501082_0172452_37_1227 390
310 3300061734 Ga0530510_0035386 Ga0530510_0035386_2257_3501 390
311 3300061734 Ga0530510_0216946 Ga0530510_0216946_12_1202 390
312 3300005262 Ga0065165_1000089 Ga0065165_1000089148 391
313 3300025284 Ga0209130_1000087 Ga0209130_1000087152 391
314 3300025294 Ga0209025_1002055 Ga0209025_100205518 391
315 3300049742 Ga0501080_0137517 Ga0501080_0137517_971_2170 391
316 3300049822 Ga0501035_0107412 Ga0501035_0107412_1228_2427 391
317 3300049823 Ga0501044_0024495 Ga0501044_0024495_754_1953 391
318 3300006195 Ga0075366_10124034 Ga0075366_101240341 392
319 3300025294 Ga0209025_1039064 Ga0209025_10390642 392
320 iso_pu_bacteria 2643221736 2644747246 393
321 iso_pu_bacteria 2841911363 2841911867 393
322 iso_pu_bacteria 2841917233 2841921320 393
323 3300046522 Ga0495643_0083535 Ga0495643_0083535_56_1345 395
324 3300003771 Ga0055526_1002158 Ga0055526_10021585 396
325 3300003775 Ga0055524_1000150 Ga0055524_100015025 396
326 3300025291 Ga0209675_1001089 Ga0209675_10010896 396
327 3300025295 Ga0209564_1000035 Ga0209564_1000035390 396
328 3300025299 Ga0209256_1000025 Ga0209256_100002556 396
329 3300025299 Ga0209256_1000330 Ga0209256_10003305 397
330 3300048925 Ga0496122_0040220 Ga0496122_0040220_1720_2964 397
331 3300048926 Ga0496123_0027160 Ga0496123_0027160_756_2000 397
332 3300048926 Ga0496123_0029552 Ga0496123_0029552_2031_3275 397
333 iso_pu_bacteria 2643221734 2644733162 398
334 iso_pu_bacteria 2818991467 2819717933 398
335 iso_pu_bacteria 2917699015 2917700605 398
336 3300048911 Ga0496108_0008116 Ga0496108_0008116_1114_2340 400
337 3300048912 Ga0496109_0005534 Ga0496109_0005534_1034_2260 400
338 3300048913 Ga0496110_0008208 Ga0496110_0008208_6222_7448 400
339 3300048914 Ga0496111_0000245 Ga0496111_0000245_18684_19910 400
340 3300048915 Ga0496112_0010464 Ga0496112_0010464_6021_7247 400
341 3300048916 Ga0496113_0067023 Ga0496113_0067023_937_2163 400
342 iso_pu_bacteria 2643221733 2644728663 400
343 3300003187 JGI25151J46595_10000047 JGI25151J46595_10000047148 402
344 3300003187 JGI25151J46595_10000086 JGI25151J46595_1000008662 402
345 3300025294 Ga0209025_1000016 Ga0209025_100001680 402
346 3300053177 Ga0500636_0025376 Ga0500636_0025376_2079_3338 402

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

220

375

0.98

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

235

364

0.96

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

14

122

0.87

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

120

208

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jsc-assembly1.cif.gz_C crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans 0.9594 16 399
5jsc-assembly1.cif.gz_D crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans 0.9576 16 399
5idu-assembly1.cif.gz_B crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad 0.957 16 395
5jsc-assembly1.cif.gz_A-2 crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans 0.9497 12 397
5jsc-assembly1.cif.gz_C crystal structure of a putative acyl-coa dehydrogenase from burkholderia xenovorans 0.94 16 399
ID Description Score Start End Superfamily
5iduC01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9659 21 132 1.10.540.10
5jscB01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9641 18 133 1.10.540.10
4o5mC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9623 242 393 1.20.140.10
5iduB02 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9573 136 247 2.40.110.10
4o5mB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9522 242 393 1.20.140.10
ID Description Score Start End GO Terms
AF-X1A816-F1-model_v4 Acyl-CoA oxidase/dehydrogenase middle domain-containing protein 0.9718 98 232 GO:0003995
GO:0050660
AF-A0A527XP13-F1-model_v4 Acyl-CoA dehydrogenase 0.9675 167 262 GO:0003995
AF-A0A534T154-F1-model_v4 Acyl-CoA dehydrogenase 0.9517 18 318 GO:0003995
GO:0050660
AF-A0A2N0QJJ7-F1-model_v4 Acyl-CoA dehydrogenase NM domain-like protein 0.9455 81 320 GO:0003995
GO:0050660
AF-A0A654TYG2-F1-model_v4 Acyl-CoA dehydrogenase (EC 1.3.8.1) 0.9441 89 390 GO:0016937
GO:0050660

Feature Viewer

pLDDT pTM Quality
89.9 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map