F416526

General Info

Members Datasets Scaffolds Average Seq Length
345 187 690 103

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0212589|Ga0496105_0212589_369_662
Length 97
Sequence MPTTTLAGHQIRVDDEGFLAEPGEWTEELAPVLAEQIGITLTDAHWEAIRFLRNDATLRRIATVGGIPVKTLFQLFPQKPAKKLAYIAGLPKPYGCV

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
92 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
96 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
104 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
105 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
109 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
159 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
172 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
181 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
184 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
185 2643221641 Nocardioides sp. Root122 Isolate Unclassified
186 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
187 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 2.9
Isolates 0.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0.29
Rhizoplane 9.57
Rhizosphere 82.32
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0212589 3300048908 Bacteria 1576
2 JGI24735J21928_10063359 3300002067 Bacteria 1061
3 Ga0070658_10009082 3300005327 Bacteria 7996
4 Ga0070683_100076599 3300005329 Bacteria 3127
5 Ga0070683_102252859 3300005329 Bacteria 523
6 Ga0070660_100122608 3300005339 Bacteria 2075
7 Ga0070687_100647868 3300005343 Bacteria 732
8 Ga0070714_100023696 3300005435 Bacteria 5047
9 Ga0070708_100079567 3300005445 Bacteria 2965
10 Ga0070662_100255231 3300005457 Bacteria 1411
11 Ga0070681_11596881 3300005458 Bacteria 578
12 Ga0070706_100031768 3300005467 Bacteria 4868
13 Ga0070698_100000167 3300005471 Bacteria 60583
14 Ga0070684_100198332 3300005535 Bacteria 1828
15 Ga0070684_101697801 3300005535 Bacteria 596
16 Ga0070686_101378492 3300005544 Bacteria 591
17 Ga0070665_100003401 3300005548 Bacteria 17006
18 Ga0070665_101373498 3300005548 Bacteria 716
19 Ga0068855_101595543 3300005563 Bacteria 668
20 Ga0068857_101012698 3300005577 Bacteria 800
21 Ga0068852_102133542 3300005616 Bacteria 582
22 Ga0068859_101219063 3300005617 Bacteria 829
23 Ga0068859_102218381 3300005617 Bacteria 606
24 Ga0070717_11136742 3300006028 Unclassified 711
25 Ga0075365_10220734 3300006038 Bacteria 1330
26 Ga0075365_10290266 3300006038 Bacteria 1151
27 Ga0075365_10900716 3300006038 Bacteria 624
28 Ga0075368_10226152 3300006042 Bacteria 796
29 Ga0075368_10594977 3300006042 Bacteria 500
30 Ga0075363_100440498 3300006048 Bacteria 769
31 Ga0075364_10039196 3300006051 Bacteria 3071
32 Ga0075364_10187971 3300006051 Bacteria 1398
33 Ga0070716_101730175 3300006173 Bacteria 516
34 Ga0075367_10081950 3300006178 Bacteria 1953
35 Ga0075367_10226862 3300006178 Bacteria 1170
36 Ga0075370_10561431 3300006353 Bacteria 691
37 Ga0075430_100017753 3300006846 Bacteria 6057
38 Ga0075431_101076261 3300006847 Bacteria 769
39 Ga0097620_101218920 3300006931 Bacteria 829
40 Ga0097620_102218056 3300006931 Bacteria 606
41 Ga0105240_11193974 3300009093 Bacteria 806
42 Ga0105245_10333980 3300009098 Bacteria 1497
43 Ga0105245_11701283 3300009098 Bacteria 683
44 Ga0114129_10000446 3300009147 Bacteria 49171
45 Ga0114129_10079579 3300009147 Bacteria 4557
46 Ga0105243_10548985 3300009148 Bacteria 1104
47 Ga0105237_10270118 3300009545 Bacteria 1703
48 Ga0105249_11901980 3300009553 Bacteria 668
49 Ga0105239_10251190 3300010375 Bacteria 1986
50 Ga0105239_12814136 3300010375 Bacteria 568
51 Ga0105239_13043294 3300010375 Bacteria 546
52 Ga0105246_10972903 3300011119 Bacteria 766
53 Ga0105246_11181705 3300011119 Bacteria 703
54 Ga0157370_10122351 3300013104 Bacteria 2430
55 Ga0157370_10511947 3300013104 Bacteria 1102
56 Ga0157369_10909412 3300013105 Bacteria 902
57 Ga0157369_11591216 3300013105 Bacteria 664
58 Ga0163162_10934564 3300013306 Bacteria 979
59 Ga0163162_11803522 3300013306 Bacteria 699
60 Ga0157372_10037266 3300013307 Bacteria 5362
61 Ga0157372_10510595 3300013307 Bacteria 1401
62 Ga0157375_10521848 3300013308 Bacteria 1351
63 Ga0157375_10999191 3300013308 Bacteria 976
64 Ga0163163_10482173 3300014325 Bacteria 1301
65 Ga0163163_10764783 3300014325 Bacteria 1029
66 Ga0163163_13082620 3300014325 Bacteria 520
67 Ga0157380_10809661 3300014326 Bacteria 955
68 Ga0157380_10932132 3300014326 Bacteria 897
69 Ga0157377_10702861 3300014745 Bacteria 734
70 Ga0157377_10874768 3300014745 Bacteria 669
71 Ga0157376_10464844 3300014969 Bacteria 1237
72 Ga0157376_10478411 3300014969 Bacteria 1220
73 Ga0163161_10189185 3300017792 Bacteria 1581
74 Ga0163161_10272633 3300017792 Bacteria 1324
75 Ga0206354_10936373 3300020081 Bacteria 778
76 Ga0206353_11144540 3300020082 Bacteria 571
77 Ga0207680_10506746 3300025903 Bacteria 860
78 Ga0207647_10113611 3300025904 Bacteria 1600
79 Ga0207705_10354910 3300025909 Bacteria 1130
80 Ga0207705_11310733 3300025909 Bacteria 553
81 Ga0207684_10023977 3300025910 Bacteria 5206
82 Ga0207707_10564791 3300025912 Bacteria 966
83 Ga0207707_11467530 3300025912 Bacteria 542
84 Ga0207671_10112917 3300025914 Bacteria 2069
85 Ga0207657_10096221 3300025919 Bacteria 2463
86 Ga0207652_10745494 3300025921 Bacteria 872
87 Ga0207652_10794311 3300025921 Bacteria 841
88 Ga0207694_10782667 3300025924 Bacteria 806
89 Ga0207700_10722302 3300025928 Bacteria 890
90 Ga0207664_10002741 3300025929 Bacteria 11699
91 Ga0207690_10092584 3300025932 Bacteria 2140
92 Ga0207706_10080131 3300025933 Bacteria 2871
93 Ga0207661_10053558 3300025944 Bacteria 3229
94 Ga0207661_10196393 3300025944 Bacteria 1772
95 Ga0207661_11865252 3300025944 Bacteria 547
96 Ga0207679_11719265 3300025945 Bacteria 574
97 Ga0207658_10364741 3300025986 Bacteria 1261
98 Ga0207641_11732013 3300026088 Bacteria 627
99 Ga0209813_10190453 3300027866 Bacteria 755
100 Ga0268266_10003700 3300028379 Bacteria 15076
101 Ga0268265_11296689 3300028380 Bacteria 728
102 Ga0268264_10000576 3300028381 Bacteria 44482
103 Ga0307512_10029077 3300030522 Bacteria 4835
104 Ga0307508_10612626 3300031616 Bacteria 691
105 Ga0316575_10000001 3300031665 Bacteria 151281
106 Ga0316576_10098150 3300031727 Bacteria 2187
107 Ga0316578_10437628 3300031728 Bacteria 773
108 Ga0307405_10073416 3300031731 Bacteria 2209
109 Ga0307405_10114693 3300031731 Bacteria 1832
110 Ga0307413_11462848 3300031824 Bacteria 603
111 Ga0307410_10461885 3300031852 Bacteria 1038
112 Ga0307410_10511257 3300031852 Bacteria 990
113 Ga0307410_11327885 3300031852 Bacteria 630
114 Ga0307406_10912377 3300031901 Bacteria 749
115 Ga0307407_10194404 3300031903 Bacteria 1355
116 Ga0307407_10266395 3300031903 Bacteria 1181
117 Ga0307409_100850896 3300031995 Bacteria 923
118 Ga0307416_101329246 3300032002 Bacteria 825
119 Ga0307416_103577573 3300032002 Bacteria 520
120 Ga0307411_10519532 3300032005 Bacteria 1010
121 Ga0307415_100144756 3300032126 Bacteria 1820
122 Ga0307415_100178928 3300032126 Bacteria 1662
123 Ga0307415_100231559 3300032126 Bacteria 1488
124 Ga0307415_100763233 3300032126 Bacteria 879
125 Ga0316593_10044930 3300032168 Bacteria 1479
126 Ga0316593_10050317 3300032168 Bacteria 1406
127 Ga0316592_1020737 3300033524 Bacteria 1397
128 Ga0316592_1129160 3300033524 Bacteria 589
129 Ga0316592_1133436 3300033524 Bacteria 580
130 Ga0316586_1019023 3300033527 Bacteria 1119
131 Ga0316587_1016954 3300033529 Bacteria 1218
132 Ga0316596_1017646 3300033541 Bacteria 1797
133 Ga0373938_0041221 3300034957 Bacteria 1027
134 Ga0373957_0116108 3300035120 Bacteria 1081
135 Ga0316574_0006810 3300035398 Bacteria 6209
136 Ga0316574_0107155 3300035398 Bacteria 1790
137 Ga0316574_0399759 3300035398 Bacteria 865
138 Ga0316574_0840377 3300035398 Bacteria 557
139 Ga0373937_0065201 3300036401 Bacteria 3352
140 Ga0316582_0006151 3300036647 Bacteria 6269
141 Ga0316584_0296749 3300036712 Bacteria 1171
142 Ga0395899_0393152 3300037312 Bacteria 919
143 Ga0395900_0632920 3300037418 Bacteria 1008
144 Ga0395900_1118556 3300037418 Bacteria 705
145 Ga0395898_0420224 3300037466 Bacteria 1274
146 Ga0395898_1203392 3300037466 Bacteria 689
147 Ga0316581_0058868 3300037588 Bacteria 1178
148 Ga0395901_0085065 3300038443 Bacteria 3306
149 Ga0395901_0445808 3300038443 Bacteria 1324
150 Ga0395901_0563597 3300038443 Bacteria 1153
151 Ga0436365_1904154 3300039437 Bacteria 590
152 Ga0439461_0085913 3300041410 Bacteria 748
153 Ga0451789_1154676 3300041443 Bacteria 639
154 Ga0451791_1823857 3300041451 Bacteria 757
155 Ga0451807_1363053 3300041486 Bacteria 810
156 Ga0439431_0088064 3300041997 Unclassified 843
157 Ga0439456_055215 3300042013 Unclassified 870
158 Ga0439435_0196980 3300042436 Bacteria 663
159 Ga0439464_0124141 3300042439 Bacteria 797
160 Ga0495603_0581206 3300046455 Bacteria 641
161 Ga0495641_0441221 3300046461 Bacteria 592
162 Ga0495582_0111158 3300046473 Bacteria 1539
163 Ga0495582_0781039 3300046473 Bacteria 553
164 Ga0495639_0122174 3300046475 Bacteria 1243
165 Ga0495639_0313857 3300046475 Bacteria 783
166 Ga0495662_0647450 3300046476 Bacteria 516
167 Ga0495594_0083751 3300046499 Bacteria 1783
168 Ga0495667_0852954 3300046559 Bacteria 560
169 Ga0495635_0467253 3300046663 Bacteria 833
170 Ga0495635_0738587 3300046663 Bacteria 637
171 Ga0495661_0202075 3300046665 Bacteria 1040
172 Ga0495658_0135186 3300046683 Bacteria 1504
173 Ga0495658_0416953 3300046683 Bacteria 856
174 Ga0495658_0447294 3300046683 Bacteria 825
175 Ga0495600_0139473 3300046809 Bacteria 1574
176 Ga0495600_0355505 3300046809 Bacteria 917
177 Ga0495674_0365770 3300047319 Bacteria 1169
178 Ga0495680_0131947 3300047322 Bacteria 1835
179 Ga0495680_0305607 3300047322 Bacteria 1116
180 Ga0496101_0379792 3300048904 Bacteria 1112
181 Ga0496102_0183995 3300048905 Bacteria 1968
182 Ga0496104_0071249 3300048907 Bacteria 3305
183 Ga0496104_0395329 3300048907 Bacteria 1295
184 Ga0496105_0112308 3300048908 Bacteria 2249
185 Ga0496105_0213060 3300048908 Bacteria 1574
186 Ga0496105_0368389 3300048908 Bacteria 1145
187 Ga0496105_0592788 3300048908 Bacteria 861
188 Ga0496106_1115605 3300048909 Bacteria 618
189 Ga0496107_0808310 3300048910 Bacteria 686
190 Ga0496108_0234746 3300048911 Bacteria 1595
191 Ga0496108_0297792 3300048911 Bacteria 1405
192 Ga0496108_0404927 3300048911 Bacteria 1191
193 Ga0496108_0858542 3300048911 Bacteria 781
194 Ga0496109_0060676 3300048912 Bacteria 3456
195 Ga0496109_0120785 3300048912 Bacteria 2441
196 Ga0496109_0445650 3300048912 Bacteria 1223
197 Ga0496109_0765805 3300048912 Bacteria 903
198 Ga0496109_0888317 3300048912 Bacteria 829
199 Ga0496109_1249865 3300048912 Bacteria 679
200 Ga0496109_1642534 3300048912 Bacteria 577
201 Ga0496110_0008319 3300048913 Bacteria 8345
202 Ga0496110_0201194 3300048913 Bacteria 1810
203 Ga0496111_0014665 3300048914 Bacteria 5359
204 Ga0496113_0719714 3300048916 Bacteria 796
205 Ga0496114_0028407 3300048917 Bacteria 4590
206 Ga0496114_0059472 3300048917 Bacteria 3192
207 Ga0496114_0117308 3300048917 Bacteria 2286
208 Ga0496114_1774116 3300048917 Bacteria 505
209 Ga0501031_0513567 3300049568 Bacteria 772
210 Ga0501032_0576002 3300049569 Bacteria 717
211 Ga0501033_0383106 3300049570 Bacteria 982
212 Ga0501034_0018841 3300049571 Bacteria 7074
213 Ga0501034_0701379 3300049571 Bacteria 911
214 Ga0501034_1000495 3300049571 Bacteria 720
215 Ga0501036_0075519 3300049572 Bacteria 2850
216 Ga0501036_0349509 3300049572 Bacteria 1235
217 Ga0501036_0404714 3300049572 Bacteria 1138
218 Ga0501037_0206703 3300049573 Bacteria 1386
219 Ga0501038_0654065 3300049574 Bacteria 791
220 Ga0501038_0697325 3300049574 Unclassified 761
221 Ga0501039_0058196 3300049575 Bacteria 2993
222 Ga0501039_0533365 3300049575 Bacteria 921
223 Ga0501039_0723841 3300049575 Bacteria 778
224 Ga0501040_0009396 3300049576 Bacteria 6372
225 Ga0501040_0089468 3300049576 Bacteria 2139
226 Ga0501041_0048898 3300049577 Bacteria 2576
227 Ga0501041_0162900 3300049577 Bacteria 1394
228 Ga0501041_0689942 3300049577 Bacteria 653
229 Ga0501042_0284104 3300049578 Bacteria 1195
230 Ga0501042_0467014 3300049578 Bacteria 915
231 Ga0501042_1205422 3300049578 Bacteria 552
232 Ga0501043_0257585 3300049579 Bacteria 1343
233 Ga0501043_0477878 3300049579 Bacteria 933
234 Ga0501043_0847768 3300049579 Bacteria 658
235 Ga0501043_0974242 3300049579 Bacteria 605
236 Ga0501046_0053006 3300049580 Bacteria 3196
237 Ga0501047_0108778 3300049581 Bacteria 2655
238 Ga0501047_0991712 3300049581 Bacteria 653
239 Ga0501048_0147812 3300049582 Bacteria 1662
240 Ga0501048_0202311 3300049582 Bacteria 1408
241 Ga0501048_0345831 3300049582 Bacteria 1060
242 Ga0501048_0455290 3300049582 Bacteria 917
243 Ga0501048_1147447 3300049582 Bacteria 559
244 Ga0501067_0000743 3300049583 Bacteria 17525
245 Ga0501067_0008749 3300049583 Bacteria 5609
246 Ga0501067_0113718 3300049583 Bacteria 1505
247 Ga0501068_0038089 3300049584 Bacteria 2879
248 Ga0501068_0192125 3300049584 Bacteria 1293
249 Ga0501068_0229166 3300049584 Bacteria 1181
250 Ga0501069_0042899 3300049585 Bacteria 2503
251 Ga0501069_0554853 3300049585 Bacteria 688
252 Ga0501069_0899922 3300049585 Bacteria 538
253 Ga0501070_0018151 3300049586 Bacteria 5902
254 Ga0501070_0029746 3300049586 Bacteria 4578
255 Ga0501070_0426149 3300049586 Bacteria 1071
256 Ga0501070_0672752 3300049586 Bacteria 820
257 Ga0501070_1009593 3300049586 Bacteria 645
258 Ga0501071_0007239 3300049587 Bacteria 7263
259 Ga0501071_0122712 3300049587 Bacteria 1926
260 Ga0501071_0129201 3300049587 Bacteria 1876
261 Ga0501071_0170237 3300049587 Bacteria 1630
262 Ga0501071_0539657 3300049587 Bacteria 895
263 Ga0501071_0697498 3300049587 Bacteria 782
264 Ga0501072_0030868 3300049588 Bacteria 4192
265 Ga0501072_0038015 3300049588 Bacteria 3777
266 Ga0501072_0066295 3300049588 Bacteria 2848
267 Ga0501072_0366065 3300049588 Bacteria 1144
268 Ga0501072_1425451 3300049588 Bacteria 535
269 Ga0501073_0003113 3300049589 Bacteria 12428
270 Ga0501073_0101684 3300049589 Bacteria 1996
271 Ga0501073_0822338 3300049589 Bacteria 640
272 Ga0501074_0002303 3300049590 Bacteria 13294
273 Ga0501074_0006155 3300049590 Bacteria 8666
274 Ga0501074_0137185 3300049590 Bacteria 1750
275 Ga0501074_0267247 3300049590 Bacteria 1216
276 Ga0501075_0038303 3300049591 Bacteria 3583
277 Ga0501075_0167410 3300049591 Bacteria 1677
278 Ga0501075_0234273 3300049591 Bacteria 1400
279 Ga0501075_0475841 3300049591 Bacteria 953
280 Ga0501075_0785787 3300049591 Bacteria 724
281 Ga0501076_0098200 3300049592 Bacteria 2359
282 Ga0501076_0195277 3300049592 Bacteria 1652
283 Ga0501076_0419155 3300049592 Bacteria 1101
284 Ga0501076_0819923 3300049592 Bacteria 768
285 Ga0501076_1628316 3300049592 Bacteria 530
286 Ga0501077_0007727 3300049593 Bacteria 6635
287 Ga0501077_0013664 3300049593 Bacteria 5089
288 Ga0501077_0294933 3300049593 Bacteria 1033
289 Ga0501253_184782 3300049683 Bacteria 544
290 Ga0501079_0038837 3300049741 Bacteria 3671
291 Ga0501079_0103606 3300049741 Bacteria 2207
292 Ga0501079_0142652 3300049741 Bacteria 1866
293 Ga0501079_0391311 3300049741 Bacteria 1090
294 Ga0501079_0452884 3300049741 Bacteria 1008
295 Ga0501079_0650676 3300049741 Bacteria 830
296 Ga0501079_0956018 3300049741 Bacteria 675
297 Ga0501080_0007922 3300049742 Bacteria 9623
298 Ga0501080_0009733 3300049742 Bacteria 8779
299 Ga0501080_0383401 3300049742 Bacteria 1266
300 Ga0501080_0507582 3300049742 Unclassified 1077
301 Ga0501081_0039714 3300049743 Bacteria 3221
302 Ga0501081_0214925 3300049743 Bacteria 1397
303 Ga0501081_0302022 3300049743 Bacteria 1174
304 Ga0501083_0016184 3300049744 Bacteria 5222
305 Ga0501035_0619044 3300049822 Bacteria 881
306 Ga0501035_0678411 3300049822 Bacteria 833
307 Ga0501045_0058033 3300049824 Bacteria 2833
308 Ga0501045_0185767 3300049824 Bacteria 1549
309 Ga0501045_0645435 3300049824 Bacteria 782
310 nmdc:mga03n38_549668_c1 3300050490 Bacteria 653
311 nmdc:mga00v17_19046_c1 3300050491 Bacteria 1783
312 nmdc:mga00v17_424411_c1 3300050491 Bacteria 864
313 nmdc:mga0yw44_786901_c1 3300050492 Bacteria 646
314 nmdc:mga0yw44_848260_c1 3300050492 Bacteria 620
315 nmdc:mga06z11_253576_c1 3300050494 Bacteria 1037
316 nmdc:mga04h51_195806_c1 3300050495 Bacteria 792
317 nmdc:mga07m45_501214_c1 3300050496 Bacteria 703
318 nmdc:mga07m45_90946_c1 3300050496 Bacteria 1748
319 nmdc:mga05p37_1367_c1 3300050507 Bacteria 28342
320 nmdc:mga05p37_164516_c1 3300050507 Bacteria 2708
321 nmdc:mga0qj67_5258_c1 3300050509 Bacteria 9439
322 nmdc:mga06r32_1202751_c1 3300050510 Bacteria 704
323 Ga0495601_0082180 3300053077 Bacteria 2068
324 Ga0495595_0059609 3300053084 Bacteria 1785
325 Ga0495595_0147966 3300053084 Bacteria 1155
326 Ga0495619_0149714 3300053085 Bacteria 1610
327 Ga0495619_0173564 3300053085 Bacteria 1491
328 Ga0495619_0192568 3300053085 Bacteria 1411
329 Ga0495619_0556308 3300053085 Bacteria 787
330 Ga0500578_0454900 3300053086 Bacteria 728
331 Ga0500568_0296873 3300053139 Bacteria 586
332 Ga0501084_0028046 3300054114 Bacteria 4705
333 Ga0501084_0051513 3300054114 Bacteria 3445
334 Ga0501084_0132142 3300054114 Bacteria 2101
335 Ga0501084_0335313 3300054114 Bacteria 1277
336 Ga0501084_0823714 3300054114 Bacteria 781
337 Ga0501082_0014645 3300060353 Bacteria 6756
338 Ga0501082_0938850 3300060353 Bacteria 756
339 Ga0530510_0009089 3300061734 Bacteria 6964
340 Ga0530510_0047806 3300061734 Bacteria 3092
341 Ga0530510_0054968 3300061734 Bacteria 2877
342 Ga0530510_0187219 3300061734 Bacteria 1536
343 2644228631 2643221641 Bacteria 4490190
344 2919450214 2919446982 Bacteria 3994487
345 8054610811 8054609563 Bacteria 5170090
346 Ga0496105_0212589
347 JGI24735J21928_10063359
348 Ga0070658_10009082
349 Ga0070683_100076599
350 Ga0070683_102252859
351 Ga0070660_100122608
352 Ga0070687_100647868
353 Ga0070714_100023696
354 Ga0070708_100079567
355 Ga0070662_100255231
356 Ga0070681_11596881
357 Ga0070706_100031768
358 Ga0070698_100000167
359 Ga0070684_100198332
360 Ga0070684_101697801
361 Ga0070686_101378492
362 Ga0070665_100003401
363 Ga0070665_101373498
364 Ga0068855_101595543
365 Ga0068857_101012698
366 Ga0068852_102133542
367 Ga0068859_101219063
368 Ga0068859_102218381
369 Ga0070717_11136742
370 Ga0075365_10220734
371 Ga0075365_10290266
372 Ga0075365_10900716
373 Ga0075368_10226152
374 Ga0075368_10594977
375 Ga0075363_100440498
376 Ga0075364_10039196
377 Ga0075364_10187971
378 Ga0070716_101730175
379 Ga0075367_10081950
380 Ga0075367_10226862
381 Ga0075370_10561431
382 Ga0075430_100017753
383 Ga0075431_101076261
384 Ga0097620_101218920
385 Ga0097620_102218056
386 Ga0105240_11193974
387 Ga0105245_10333980
388 Ga0105245_11701283
389 Ga0114129_10000446
390 Ga0114129_10079579
391 Ga0105243_10548985
392 Ga0105237_10270118
393 Ga0105249_11901980
394 Ga0105239_10251190
395 Ga0105239_12814136
396 Ga0105239_13043294
397 Ga0105246_10972903
398 Ga0105246_11181705
399 Ga0157370_10122351
400 Ga0157370_10511947
401 Ga0157369_10909412
402 Ga0157369_11591216
403 Ga0163162_10934564
404 Ga0163162_11803522
405 Ga0157372_10037266
406 Ga0157372_10510595
407 Ga0157375_10521848
408 Ga0157375_10999191
409 Ga0163163_10482173
410 Ga0163163_10764783
411 Ga0163163_13082620
412 Ga0157380_10809661
413 Ga0157380_10932132
414 Ga0157377_10702861
415 Ga0157377_10874768
416 Ga0157376_10464844
417 Ga0157376_10478411
418 Ga0163161_10189185
419 Ga0163161_10272633
420 Ga0206354_10936373
421 Ga0206353_11144540
422 Ga0207680_10506746
423 Ga0207647_10113611
424 Ga0207705_10354910
425 Ga0207705_11310733
426 Ga0207684_10023977
427 Ga0207707_10564791
428 Ga0207707_11467530
429 Ga0207671_10112917
430 Ga0207657_10096221
431 Ga0207652_10745494
432 Ga0207652_10794311
433 Ga0207694_10782667
434 Ga0207700_10722302
435 Ga0207664_10002741
436 Ga0207690_10092584
437 Ga0207706_10080131
438 Ga0207661_10053558
439 Ga0207661_10196393
440 Ga0207661_11865252
441 Ga0207679_11719265
442 Ga0207658_10364741
443 Ga0207641_11732013
444 Ga0209813_10190453
445 Ga0268266_10003700
446 Ga0268265_11296689
447 Ga0268264_10000576
448 Ga0307512_10029077
449 Ga0307508_10612626
450 Ga0316575_10000001
451 Ga0316576_10098150
452 Ga0316578_10437628
453 Ga0307405_10073416
454 Ga0307405_10114693
455 Ga0307413_11462848
456 Ga0307410_10461885
457 Ga0307410_10511257
458 Ga0307410_11327885
459 Ga0307406_10912377
460 Ga0307407_10194404
461 Ga0307407_10266395
462 Ga0307409_100850896
463 Ga0307416_101329246
464 Ga0307416_103577573
465 Ga0307411_10519532
466 Ga0307415_100144756
467 Ga0307415_100178928
468 Ga0307415_100231559
469 Ga0307415_100763233
470 Ga0316593_10044930
471 Ga0316593_10050317
472 Ga0316592_1020737
473 Ga0316592_1129160
474 Ga0316592_1133436
475 Ga0316586_1019023
476 Ga0316587_1016954
477 Ga0316596_1017646
478 Ga0373938_0041221
479 Ga0373957_0116108
480 Ga0316574_0006810
481 Ga0316574_0107155
482 Ga0316574_0399759
483 Ga0316574_0840377
484 Ga0373937_0065201
485 Ga0316582_0006151
486 Ga0316584_0296749
487 Ga0395899_0393152
488 Ga0395900_0632920
489 Ga0395900_1118556
490 Ga0395898_0420224
491 Ga0395898_1203392
492 Ga0316581_0058868
493 Ga0395901_0085065
494 Ga0395901_0445808
495 Ga0395901_0563597
496 Ga0436365_1904154
497 Ga0439461_0085913
498 Ga0451789_1154676
499 Ga0451791_1823857
500 Ga0451807_1363053
501 Ga0439431_0088064
502 Ga0439456_055215
503 Ga0439435_0196980
504 Ga0439464_0124141
505 Ga0495603_0581206
506 Ga0495641_0441221
507 Ga0495582_0111158
508 Ga0495582_0781039
509 Ga0495639_0122174
510 Ga0495639_0313857
511 Ga0495662_0647450
512 Ga0495594_0083751
513 Ga0495667_0852954
514 Ga0495635_0467253
515 Ga0495635_0738587
516 Ga0495661_0202075
517 Ga0495658_0135186
518 Ga0495658_0416953
519 Ga0495658_0447294
520 Ga0495600_0139473
521 Ga0495600_0355505
522 Ga0495674_0365770
523 Ga0495680_0131947
524 Ga0495680_0305607
525 Ga0496101_0379792
526 Ga0496102_0183995
527 Ga0496104_0071249
528 Ga0496104_0395329
529 Ga0496105_0112308
530 Ga0496105_0213060
531 Ga0496105_0368389
532 Ga0496105_0592788
533 Ga0496106_1115605
534 Ga0496107_0808310
535 Ga0496108_0234746
536 Ga0496108_0297792
537 Ga0496108_0404927
538 Ga0496108_0858542
539 Ga0496109_0060676
540 Ga0496109_0120785
541 Ga0496109_0445650
542 Ga0496109_0765805
543 Ga0496109_0888317
544 Ga0496109_1249865
545 Ga0496109_1642534
546 Ga0496110_0008319
547 Ga0496110_0201194
548 Ga0496111_0014665
549 Ga0496113_0719714
550 Ga0496114_0028407
551 Ga0496114_0059472
552 Ga0496114_0117308
553 Ga0496114_1774116
554 Ga0501031_0513567
555 Ga0501032_0576002
556 Ga0501033_0383106
557 Ga0501034_0018841
558 Ga0501034_0701379
559 Ga0501034_1000495
560 Ga0501036_0075519
561 Ga0501036_0349509
562 Ga0501036_0404714
563 Ga0501037_0206703
564 Ga0501038_0654065
565 Ga0501038_0697325
566 Ga0501039_0058196
567 Ga0501039_0533365
568 Ga0501039_0723841
569 Ga0501040_0009396
570 Ga0501040_0089468
571 Ga0501041_0048898
572 Ga0501041_0162900
573 Ga0501041_0689942
574 Ga0501042_0284104
575 Ga0501042_0467014
576 Ga0501042_1205422
577 Ga0501043_0257585
578 Ga0501043_0477878
579 Ga0501043_0847768
580 Ga0501043_0974242
581 Ga0501046_0053006
582 Ga0501047_0108778
583 Ga0501047_0991712
584 Ga0501048_0147812
585 Ga0501048_0202311
586 Ga0501048_0345831
587 Ga0501048_0455290
588 Ga0501048_1147447
589 Ga0501067_0000743
590 Ga0501067_0008749
591 Ga0501067_0113718
592 Ga0501068_0038089
593 Ga0501068_0192125
594 Ga0501068_0229166
595 Ga0501069_0042899
596 Ga0501069_0554853
597 Ga0501069_0899922
598 Ga0501070_0018151
599 Ga0501070_0029746
600 Ga0501070_0426149
601 Ga0501070_0672752
602 Ga0501070_1009593
603 Ga0501071_0007239
604 Ga0501071_0122712
605 Ga0501071_0129201
606 Ga0501071_0170237
607 Ga0501071_0539657
608 Ga0501071_0697498
609 Ga0501072_0030868
610 Ga0501072_0038015
611 Ga0501072_0066295
612 Ga0501072_0366065
613 Ga0501072_1425451
614 Ga0501073_0003113
615 Ga0501073_0101684
616 Ga0501073_0822338
617 Ga0501074_0002303
618 Ga0501074_0006155
619 Ga0501074_0137185
620 Ga0501074_0267247
621 Ga0501075_0038303
622 Ga0501075_0167410
623 Ga0501075_0234273
624 Ga0501075_0475841
625 Ga0501075_0785787
626 Ga0501076_0098200
627 Ga0501076_0195277
628 Ga0501076_0419155
629 Ga0501076_0819923
630 Ga0501076_1628316
631 Ga0501077_0007727
632 Ga0501077_0013664
633 Ga0501077_0294933
634 Ga0501253_184782
635 Ga0501079_0038837
636 Ga0501079_0103606
637 Ga0501079_0142652
638 Ga0501079_0391311
639 Ga0501079_0452884
640 Ga0501079_0650676
641 Ga0501079_0956018
642 Ga0501080_0007922
643 Ga0501080_0009733
644 Ga0501080_0383401
645 Ga0501080_0507582
646 Ga0501081_0039714
647 Ga0501081_0214925
648 Ga0501081_0302022
649 Ga0501083_0016184
650 Ga0501035_0619044
651 Ga0501035_0678411
652 Ga0501045_0058033
653 Ga0501045_0185767
654 Ga0501045_0645435
655 nmdc:mga03n38_549668_c1
656 nmdc:mga00v17_19046_c1
657 nmdc:mga00v17_424411_c1
658 nmdc:mga0yw44_786901_c1
659 nmdc:mga0yw44_848260_c1
660 nmdc:mga06z11_253576_c1
661 nmdc:mga04h51_195806_c1
662 nmdc:mga07m45_501214_c1
663 nmdc:mga07m45_90946_c1
664 nmdc:mga05p37_1367_c1
665 nmdc:mga05p37_164516_c1
666 nmdc:mga0qj67_5258_c1
667 nmdc:mga06r32_1202751_c1
668 Ga0495601_0082180
669 Ga0495595_0059609
670 Ga0495595_0147966
671 Ga0495619_0149714
672 Ga0495619_0173564
673 Ga0495619_0192568
674 Ga0495619_0556308
675 Ga0500578_0454900
676 Ga0500568_0296873
677 Ga0501084_0028046
678 Ga0501084_0051513
679 Ga0501084_0132142
680 Ga0501084_0335313
681 Ga0501084_0823714
682 Ga0501082_0014645
683 Ga0501082_0938850
684 Ga0530510_0009089
685 Ga0530510_0047806
686 Ga0530510_0054968
687 Ga0530510_0187219
688 2644228631
689 2919450214
690 8054610811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04358

DsrC

DsrC like protein

5

97

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2v4j-assembly1.cif.gz_F the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration 0.8513 4 104
2xsj-assembly1.cif.gz_F structure of desulforubidin from desulfomicrobium norvegicum 0.8473 2 104
3or1-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase i (dsri) 0.8447 2 104
3or2-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase ii (dsrii) 0.844 2 104
3jsp-assembly1.cif.gz_A classic protein with a new twist: crystal structure of a lexa repressor dna complex 0.8422 40 75
ID Description Score Start End Superfamily
af_P9WGI5_163_239_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8705 43 82 1.10.10.10
2v4jF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8448 41 104 1.10.10.370
3or1F02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8359 41 104 1.10.10.370
2v4jF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8334 41 104 1.10.10.370
3or1F02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.8247 41 104 1.10.10.370
ID Description Score Start End GO Terms
AF-A0A7Y1UXM6-F1-model_v4 TusE/DsrC/DsvC family sulfur relay protein 0.9931 26 104 GO:0002143
GO:0005737
GO:0097163
AF-T0Z464-F1-model_v4 Sulfur relay protein, TusE/DsrC/DsvC family 0.9834 20 104 GO:0002143
GO:0005737
GO:0097163
AF-A0A7Y1UXM6-F1-model_v4 TusE/DsrC/DsvC family sulfur relay protein 0.9808 26 104 GO:0002143
GO:0005737
GO:0097163
AF-A0A1G6GEF8-F1-model_v4 tRNA 2-thiouridine synthesizing protein E 0.9768 1 104 GO:0002143
GO:0005737
GO:0097163
AF-A0A5Q2FAF3-F1-model_v4 TusE/DsrC/DsvC family sulfur relay protein 0.976 1 104 GO:0002143
GO:0005737
GO:0097163

Map