F416506

General Info

Members Datasets Scaffolds Average Seq Length
345 238 690 169

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0005588|Ga0495597_0005588_1486_2064
Length 192
Sequence MPSLFAPTELEPAMHAVNPTHTPTAMPTIATDTGLVAKAARALQFARRSLDAAAPAVDLVIRLLVASVFFKSGLTKIASWSSTVSLFQNEYAVPLLPPELAALLGTGVELFFPVLLVLGLGSRFAAAVLFVFNIVAVISYPDLGEIGLKDHQTWGLLLLVTLLHGPGKLSLDHLLGTRFLGAPYGRFFGRRT

Samples

Sample ID Description Type Environment
1 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
118 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
144 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
145 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
146 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
147 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
148 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
149 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
150 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
151 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
152 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
155 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
156 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
164 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
165 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
166 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
167 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
168 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
169 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
170 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
180 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
181 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
197 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
217 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
220 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
236 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
237 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
238 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.65
Metatranscriptomes 2.9
Isolates 1.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.64
Nodule 0.29
Rhizoplane 4.35
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 5.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495597_0005588 3300046542 Bacteria 6634
2 Ga0070676_10267841 3300005328 Bacteria 1146
3 Ga0070683_100081685 3300005329 Bacteria 3026
4 Ga0070690_100062499 3300005330 Bacteria 2401
5 Ga0070670_100135293 3300005331 Bacteria 2130
6 Ga0070677_10018340 3300005333 Bacteria 2519
7 Ga0068869_100266194 3300005334 Bacteria 1374
8 Ga0070666_10126132 3300005335 Bacteria 1777
9 Ga0070666_10421445 3300005335 Unclassified 961
10 Ga0068868_100046998 3300005338 Bacteria 3380
11 Ga0068868_101327173 3300005338 Bacteria 669
12 Ga0070660_100488415 3300005339 Bacteria 1024
13 Ga0070661_100034534 3300005344 Bacteria 3667
14 Ga0070668_100027333 3300005347 Bacteria 4332
15 Ga0070668_100219265 3300005347 Unclassified 1568
16 Ga0070669_101051744 3300005353 Bacteria 700
17 Ga0070675_100937573 3300005354 Bacteria 794
18 Ga0070671_100039068 3300005355 Bacteria 3939
19 Ga0070671_100121262 3300005355 Bacteria 2201
20 Ga0070674_100531800 3300005356 Unclassified 984
21 Ga0070673_100151555 3300005364 Bacteria 1964
22 Ga0070688_100614118 3300005365 Bacteria 834
23 Ga0070659_100211209 3300005366 Bacteria 1599
24 Ga0070667_100155402 3300005367 Bacteria 2012
25 Ga0070667_100938372 3300005367 Bacteria 806
26 Ga0070701_10134890 3300005438 Bacteria 1406
27 Ga0070700_100047555 3300005441 Bacteria 2655
28 Ga0070663_100086795 3300005455 Bacteria 2311
29 Ga0070678_100037302 3300005456 Bacteria 3412
30 Ga0070678_100335690 3300005456 Bacteria 1295
31 Ga0070662_100111932 3300005457 Bacteria 2081
32 Ga0070662_100339456 3300005457 Bacteria 1229
33 Ga0068867_100012930 3300005459 Bacteria 5905
34 Ga0070706_100014915 3300005467 Bacteria 7178
35 Ga0070707_101096061 3300005468 Bacteria 762
36 Ga0070698_100495648 3300005471 Bacteria 1159
37 Ga0070684_100218842 3300005535 Bacteria 1737
38 Ga0068853_100736384 3300005539 Bacteria 942
39 Ga0070672_100018012 3300005543 Bacteria 5097
40 Ga0070672_100018368 3300005543 Bacteria 5055
41 Ga0070672_100363423 3300005543 Bacteria 1236
42 Ga0070665_100152461 3300005548 Bacteria 2314
43 Ga0070665_100259386 3300005548 Bacteria 1739
44 Ga0070665_101180255 3300005548 Bacteria 776
45 Ga0070664_100894288 3300005564 Bacteria 832
46 Ga0068857_100417450 3300005577 Bacteria 1251
47 Ga0068857_101026746 3300005577 Bacteria 794
48 Ga0068854_100332968 3300005578 Bacteria 1237
49 Ga0068852_100099468 3300005616 Bacteria 2622
50 Ga0068852_100551640 3300005616 Bacteria 1153
51 Ga0068852_101484933 3300005616 Bacteria 700
52 Ga0068859_100078884 3300005617 Bacteria 3333
53 Ga0068859_100109053 3300005617 Bacteria 2830
54 Ga0068864_100076543 3300005618 Bacteria 2924
55 Ga0068866_10018595 3300005718 Bacteria 3146
56 Ga0068866_10128065 3300005718 Bacteria 1440
57 Ga0068861_100000750 3300005719 Bacteria 19469
58 Ga0068861_100074964 3300005719 Bacteria 2632
59 Ga0068861_100139290 3300005719 Bacteria 1978
60 Ga0068851_10204195 3300005834 Bacteria 1104
61 Ga0068870_10218624 3300005840 Unclassified 1165
62 Ga0068863_100021067 3300005841 Bacteria 6226
63 Ga0068863_100201159 3300005841 Bacteria 1916
64 Ga0068858_100002886 3300005842 Bacteria 17285
65 Ga0068858_100034373 3300005842 Bacteria 4702
66 Ga0068860_100001666 3300005843 Bacteria 23760
67 Ga0068860_100004020 3300005843 Bacteria 15104
68 Ga0068862_100003929 3300005844 Bacteria 12643
69 Ga0068862_100051087 3300005844 Bacteria 3535
70 Ga0075369_10053606 3300006186 Bacteria 1750
71 Ga0075366_10008328 3300006195 Bacteria 5758
72 Ga0075366_10062885 3300006195 Bacteria 2206
73 Ga0075366_10095032 3300006195 Bacteria 1787
74 Ga0097621_101591184 3300006237 Unclassified 621
75 Ga0075370_10000041 3300006353 Bacteria 40659
76 Ga0075370_10101781 3300006353 Bacteria 1663
77 Ga0068865_100020706 3300006881 Bacteria 4269
78 Ga0068865_100194687 3300006881 Bacteria 1570
79 Ga0097620_100078885 3300006931 Bacteria 3333
80 Ga0097620_100109050 3300006931 Bacteria 2830
81 Ga0105240_10633435 3300009093 Bacteria 1174
82 Ga0105245_10198043 3300009098 Bacteria 1928
83 Ga0105245_10263057 3300009098 Bacteria 1679
84 Ga0105247_10062996 3300009101 Bacteria 2301
85 Ga0105243_10032858 3300009148 Bacteria 4010
86 Ga0105248_10104861 3300009177 Bacteria 3187
87 Ga0105248_10188510 3300009177 Bacteria 2324
88 Ga0105237_10001331 3300009545 Bacteria 32775
89 Ga0105237_10078490 3300009545 Bacteria 3291
90 Ga0105237_11479478 3300009545 Bacteria 686
91 Ga0105238_10043261 3300009551 Bacteria 4557
92 Ga0105238_10540718 3300009551 Bacteria 1169
93 Ga0105249_10006572 3300009553 Bacteria 10118
94 Ga0105249_10112772 3300009553 Bacteria 2572
95 Ga0105249_10388005 3300009553 Bacteria 1424
96 Ga0105239_10000563 3300010375 Bacteria 53173
97 Ga0105239_10134492 3300010375 Bacteria 2752
98 Ga0157378_10000700 3300013297 Bacteria 31401
99 Ga0157378_10254438 3300013297 Bacteria 1682
100 Ga0163162_10006499 3300013306 Bacteria 11317
101 Ga0163162_10091770 3300013306 Bacteria 3120
102 Ga0163162_10146108 3300013306 Bacteria 2481
103 Ga0157375_10144856 3300013308 Bacteria 2506
104 Ga0157375_10567155 3300013308 Unclassified 1296
105 Ga0157380_10030661 3300014326 Bacteria 4121
106 Ga0157380_10048670 3300014326 Bacteria 3340
107 Ga0157379_10004130 3300014968 Bacteria 12388
108 Ga0157379_10005931 3300014968 Bacteria 10522
109 Ga0157379_10136615 3300014968 Bacteria 2209
110 Ga0157379_10149598 3300014968 Bacteria 2106
111 Ga0157379_10222847 3300014968 Bacteria 1709
112 Ga0157376_10398260 3300014969 Unclassified 1330
113 Ga0163161_10083510 3300017792 Bacteria 2354
114 Ga0163161_10109714 3300017792 Bacteria 2062
115 Ga0207682_10019985 3300025893 Bacteria 2626
116 Ga0207642_10011883 3300025899 Bacteria 3124
117 Ga0207680_10396399 3300025903 Bacteria 975
118 Ga0207645_10016829 3300025907 Bacteria 4834
119 Ga0207645_10132130 3300025907 Unclassified 1625
120 Ga0207643_10198360 3300025908 Bacteria 1221
121 Ga0207705_10409314 3300025909 Bacteria 1049
122 Ga0207705_11017694 3300025909 Bacteria 640
123 Ga0207684_10003219 3300025910 Bacteria 16025
124 Ga0207695_10003089 3300025913 Bacteria 23836
125 Ga0207695_10480592 3300025913 Bacteria 1124
126 Ga0207671_10091217 3300025914 Bacteria 2296
127 Ga0207649_10897437 3300025920 Bacteria 695
128 Ga0207646_10185878 3300025922 Bacteria 1877
129 Ga0207681_10186592 3300025923 Unclassified 1583
130 Ga0207694_11264938 3300025924 Bacteria 624
131 Ga0207650_10160448 3300025925 Bacteria 1781
132 Ga0207650_10192559 3300025925 Bacteria 1630
133 Ga0207659_10125546 3300025926 Bacteria 1973
134 Ga0207659_10240360 3300025926 Bacteria 1465
135 Ga0207644_10061623 3300025931 Bacteria 2718
136 Ga0207690_10352058 3300025932 Bacteria 1165
137 Ga0207706_10207323 3300025933 Bacteria 1719
138 Ga0207709_10016145 3300025935 Bacteria 4148
139 Ga0207669_10019053 3300025937 Bacteria 3564
140 Ga0207704_10006759 3300025938 Bacteria 5375
141 Ga0207704_10394450 3300025938 Bacteria 1090
142 Ga0207691_10026442 3300025940 Bacteria 5443
143 Ga0207691_10029869 3300025940 Bacteria 5097
144 Ga0207691_10030916 3300025940 Bacteria 4999
145 Ga0207711_10143868 3300025941 Bacteria 2147
146 Ga0207711_10357263 3300025941 Bacteria 1353
147 Ga0207689_10174042 3300025942 Unclassified 1775
148 Ga0207661_10654718 3300025944 Bacteria 965
149 Ga0207679_10122737 3300025945 Bacteria 2071
150 Ga0207651_10048359 3300025960 Bacteria 2875
151 Ga0207651_10602229 3300025960 Bacteria 961
152 Ga0207651_11125705 3300025960 Bacteria 704
153 Ga0207712_10017506 3300025961 Bacteria 4655
154 Ga0207712_10436642 3300025961 Bacteria 1108
155 Ga0207668_10148830 3300025972 Unclassified 1810
156 Ga0207668_10333740 3300025972 Bacteria 1262
157 Ga0207658_10044596 3300025986 Bacteria 3229
158 Ga0207658_10155584 3300025986 Bacteria 1868
159 Ga0207658_10695152 3300025986 Bacteria 919
160 Ga0207658_11246378 3300025986 Bacteria 680
161 Ga0207677_10062344 3300026023 Bacteria 2586
162 Ga0207677_10176266 3300026023 Bacteria 1677
163 Ga0207703_10127054 3300026035 Bacteria 2197
164 Ga0207703_11052236 3300026035 Bacteria 781
165 Ga0207703_11320060 3300026035 Bacteria 694
166 Ga0207639_10491184 3300026041 Bacteria 1120
167 Ga0207639_11227192 3300026041 Bacteria 704
168 Ga0207678_10143421 3300026067 Bacteria 2038
169 Ga0207708_10065277 3300026075 Bacteria 2782
170 Ga0207641_10201209 3300026088 Bacteria 1836
171 Ga0207641_10460224 3300026088 Bacteria 1231
172 Ga0207648_10000579 3300026089 Bacteria 41056
173 Ga0207648_10009963 3300026089 Bacteria 9050
174 Ga0207676_10151214 3300026095 Bacteria 1999
175 Ga0207676_11092821 3300026095 Bacteria 788
176 Ga0207674_10033549 3300026116 Bacteria 5374
177 Ga0207674_10204221 3300026116 Bacteria 1925
178 Ga0207674_10633345 3300026116 Bacteria 1033
179 Ga0207675_100001492 3300026118 Bacteria 23463
180 Ga0207675_100094660 3300026118 Bacteria 2810
181 Ga0207683_10127264 3300026121 Bacteria 2290
182 Ga0207683_10275610 3300026121 Bacteria 1537
183 Ga0207698_10084374 3300026142 Bacteria 2575
184 Ga0207698_10280442 3300026142 Bacteria 1541
185 Ga0207698_10298152 3300026142 Bacteria 1499
186 Ga0207698_10348438 3300026142 Bacteria 1398
187 Ga0207698_11030838 3300026142 Bacteria 834
188 Ga0209983_1083103 3300027665 Bacteria 718
189 Ga0209974_10039809 3300027876 Bacteria 1563
190 Ga0268266_10423356 3300028379 Bacteria 1262
191 Ga0268265_10004235 3300028380 Bacteria 10013
192 Ga0268265_10837660 3300028380 Bacteria 899
193 Ga0268264_10006163 3300028381 Bacteria 10126
194 Ga0268264_10024552 3300028381 Bacteria 4921
195 Ga0307517_10019725 3300028786 Bacteria 8631
196 Ga0307517_10461009 3300028786 Bacteria 656
197 Ga0307515_10000067 3300028794 Bacteria 242978
198 Ga0307513_10408379 3300031456 Bacteria 1091
199 Ga0307408_100030645 3300031548 Bacteria 3737
200 Ga0307408_100518516 3300031548 Bacteria 1046
201 Ga0307516_10014997 3300031730 Bacteria 8170
202 Ga0307405_10009638 3300031731 Bacteria 4960
203 Ga0307405_10040587 3300031731 Bacteria 2819
204 Ga0307405_10060012 3300031731 Bacteria 2399
205 Ga0307413_10012179 3300031824 Bacteria 4270
206 Ga0307413_10206570 3300031824 Bacteria 1423
207 Ga0307410_10002778 3300031852 Bacteria 8565
208 Ga0307406_10004644 3300031901 Bacteria 7480
209 Ga0307406_10419989 3300031901 Bacteria 1065
210 Ga0307407_10035362 3300031903 Bacteria 2744
211 Ga0307412_10016680 3300031911 Bacteria 4380
212 Ga0307412_10169436 3300031911 Bacteria 1631
213 Ga0307409_100125500 3300031995 Bacteria 2182
214 Ga0307416_100001565 3300032002 Bacteria 12537
215 Ga0307416_100003932 3300032002 Bacteria 8847
216 Ga0307416_100165704 3300032002 Bacteria 2049
217 Ga0307416_100252885 3300032002 Bacteria 1716
218 Ga0307414_10002534 3300032004 Bacteria 9592
219 Ga0307414_10534086 3300032004 Bacteria 1043
220 Ga0307411_10000230 3300032005 Bacteria 18232
221 Ga0307411_10145616 3300032005 Bacteria 1753
222 Ga0307411_10384106 3300032005 Bacteria 1156
223 Ga0307415_100006860 3300032126 Bacteria 6181
224 Ga0373923_0095134 3300035111 Bacteria 1308
225 Ga0373943_0086581 3300035170 Bacteria 1616
226 Ga0373931_0168605 3300035691 Bacteria 1288
227 Ga0373935_0249984 3300035692 Bacteria 1240
228 Ga0373927_0184935 3300035695 Bacteria 1367
229 Ga0373933_0075629 3300035724 Bacteria 2056
230 Ga0373937_0133688 3300036401 Bacteria 2318
231 Ga0316584_0235069 3300036712 Bacteria 1343
232 Ga0373925_0092118 3300037068 Bacteria 2318
233 Ga0373925_0293584 3300037068 Bacteria 1311
234 Ga0395905_0067222 3300037471 Bacteria 3357
235 Ga0439436_0001471 3300041404 Bacteria 6841
236 Ga0439439_0006004 3300041406 Bacteria 2796
237 Ga0439461_0020464 3300041410 Bacteria 1310
238 Ga0439466_0005706 3300041411 Bacteria 4746
239 Ga0451789_0966360 3300041443 Bacteria 2567
240 Ga0451791_0934926 3300041451 Bacteria 565
241 Ga0451793_0148914 3300041452 Bacteria 1458
242 Ga0451793_0580131 3300041452 Bacteria 2249
243 Ga0451798_0659504 3300041458 Bacteria 926
244 Ga0451800_1620009 3300041459 Bacteria 1310
245 Ga0451804_0645196 3300041463 Bacteria 933
246 Ga0451807_0807165 3300041486 Bacteria 1372
247 Ga0451841_0759913 3300041498 Bacteria 877
248 Ga0451849_0282237 3300041505 Bacteria 928
249 Ga0451855_0023220 3300041511 Bacteria 593
250 Ga0451853_1230432 3300041512 Bacteria 2621
251 Ga0451853_3684172 3300041512 Bacteria 1710
252 Ga0439431_0003140 3300041997 Bacteria 3634
253 Ga0439433_0002092 3300041999 Bacteria 4203
254 Ga0439445_0200395 3300042004 Bacteria 589
255 Ga0439432_001473 3300042006 Bacteria 8841
256 Ga0439449_0001998 3300042007 Bacteria 8016
257 Ga0439449_0006792 3300042007 Bacteria 4364
258 Ga0439452_002593 3300042010 Bacteria 6626
259 Ga0439462_0001308 3300042015 Bacteria 5474
260 Ga0450896_030196 3300042133 Bacteria 818
261 Ga0450899_004511 3300042135 Bacteria 1492
262 Ga0439446_0007018 3300042156 Bacteria 2951
263 Ga0439434_0022560 3300042435 Bacteria 1892
264 Ga0439464_0027476 3300042439 Bacteria 1582
265 Ga0450893_0039077 3300042532 Bacteria 865
266 Ga0451577_1195081 3300042876 Bacteria 678
267 Ga0466972_0048097 3300044658 Bacteria 2061
268 Ga0466965_0198109 3300044683 Bacteria 1064
269 Ga0495603_0675526 3300046455 Bacteria 591
270 Ga0495590_0058982 3300046457 Bacteria 1342
271 Ga0495629_0094781 3300046459 Bacteria 2083
272 Ga0495580_0116550 3300046472 Bacteria 1855
273 Ga0495580_0717993 3300046472 Bacteria 653
274 Ga0495582_0363408 3300046473 Bacteria 834
275 Ga0495605_0176044 3300046474 Bacteria 943
276 Ga0495605_0277342 3300046474 Bacteria 713
277 Ga0495583_0080966 3300046506 Bacteria 1411
278 Ga0495606_0562089 3300046507 Bacteria 566
279 Ga0495608_0370521 3300046511 Bacteria 879
280 Ga0495618_0533697 3300046514 Bacteria 704
281 Ga0495632_0005599 3300046519 Bacteria 8266
282 Ga0495587_0178525 3300046536 Bacteria 1205
283 Ga0495598_0050211 3300046537 Bacteria 1253
284 Ga0495621_0002401 3300046539 Bacteria 5044
285 Ga0495621_0079084 3300046539 Bacteria 1223
286 Ga0495645_0019885 3300046543 Bacteria 4840
287 Ga0495668_0546610 3300046616 Bacteria 639
288 Ga0495634_0424902 3300046642 Bacteria 787
289 Ga0495625_0074951 3300046660 Unclassified 2368
290 Ga0495657_0351595 3300046675 Bacteria 872
291 Ga0495647_0095118 3300046681 Bacteria 1227
292 Ga0495658_0047880 3300046683 Bacteria 2409
293 Ga0495658_0204444 3300046683 Bacteria 1232
294 Ga0495613_0320344 3300046689 Bacteria 1070
295 Ga0495649_0005975 3300046694 Bacteria 7628
296 Ga0495660_0095122 3300046810 Bacteria 1541
297 Ga0495674_0012568 3300047319 Bacteria 7976
298 Ga0495687_000070 3300047443 Bacteria 159227
299 Ga0495687_000125 3300047443 Bacteria 118053
300 Ga0495686_0167876 3300047472 Bacteria 1278
301 Ga0496106_0259181 3300048909 Bacteria 1391
302 Ga0496107_0219306 3300048910 Bacteria 1415
303 Ga0496110_0176201 3300048913 Bacteria 1941
304 Ga0496112_0022990 3300048915 Bacteria 5949
305 Ga0496112_1237419 3300048915 Unclassified 663
306 Ga0496113_0307404 3300048916 Bacteria 1270
307 Ga0496115_0435429 3300048918 Bacteria 1061
308 Ga0496117_0252063 3300048920 Bacteria 962
309 Ga0496118_0162272 3300048921 Bacteria 1380
310 Ga0496121_0011739 3300048924 Bacteria 9665
311 Ga0496124_0000079 3300048927 Bacteria 212057
312 Ga0496125_0005397 3300048928 Bacteria 14250
313 Ga0501306_010341 3300049127 Bacteria 1172
314 Ga0501309_010875 3300049129 Bacteria 1179
315 Ga0501305_002746 3300049161 Bacteria 1931
316 Ga0495678_127491 3300049459 Bacteria 847
317 Ga0501292_009366 3300049515 Bacteria 1453
318 Ga0501297_028851 3300049520 Bacteria 730
319 Ga0501298_122727 3300049521 Bacteria 613
320 Ga0501257_030445 3300049686 Bacteria 1300
321 Ga0501262_007508 3300049759 Bacteria 1320
322 nmdc:mga0k408_10321_c1 3300050493 Bacteria 5049
323 nmdc:mga0k408_110989_c1 3300050493 Bacteria 1621
324 nmdc:mga0k408_125095_c1 3300050493 Bacteria 1525
325 nmdc:mga0k408_1594_c2 3300050493 Bacteria 6978
326 nmdc:mga06z11_267880_c1 3300050494 Bacteria 1009
327 nmdc:mga06z11_270710_c1 3300050494 Bacteria 1004
328 nmdc:mga07m45_10961_c1 3300050496 Bacteria 4751
329 nmdc:mga07m45_160470_c1 3300050496 Bacteria 1305
330 nmdc:mga0qj67_290853_c1 3300050509 Bacteria 1324
331 nmdc:mga0sz30_82845_c1 3300050516 Bacteria 1389
332 Ga0495601_0155761 3300053077 Bacteria 1492
333 Ga0500651_0304125 3300053093 Bacteria 914
334 Ga0587077_022241 3300059493 Unclassified 1134
335 Ga0587091_015401 3300059511 Unclassified 1261
336 Ga0587101_004841 3300059623 Unclassified 1462
337 Ga0587127_001944 3300059629 Unclassified 1211
338 Ga0587062_004977 3300059639 Unclassified 1445
339 Ga0587076_000595 3300059645 Bacteria 3092
340 Ga0587111_0013803 3300060346 Unclassified 1450
341 2514047607 2513237166 Bacteria 10373764
342 2792840567 2791355137 Bacteria 9654227
343 2885193881 2885192300 Bacteria 5882526
344 2904616916 2904615490 Bacteria 10047340
345 2904624891 2904615490 Bacteria 10047340
346 Ga0495597_0005588
347 Ga0070676_10267841
348 Ga0070683_100081685
349 Ga0070690_100062499
350 Ga0070670_100135293
351 Ga0070677_10018340
352 Ga0068869_100266194
353 Ga0070666_10126132
354 Ga0070666_10421445
355 Ga0068868_100046998
356 Ga0068868_101327173
357 Ga0070660_100488415
358 Ga0070661_100034534
359 Ga0070668_100027333
360 Ga0070668_100219265
361 Ga0070669_101051744
362 Ga0070675_100937573
363 Ga0070671_100039068
364 Ga0070671_100121262
365 Ga0070674_100531800
366 Ga0070673_100151555
367 Ga0070688_100614118
368 Ga0070659_100211209
369 Ga0070667_100155402
370 Ga0070667_100938372
371 Ga0070701_10134890
372 Ga0070700_100047555
373 Ga0070663_100086795
374 Ga0070678_100037302
375 Ga0070678_100335690
376 Ga0070662_100111932
377 Ga0070662_100339456
378 Ga0068867_100012930
379 Ga0070706_100014915
380 Ga0070707_101096061
381 Ga0070698_100495648
382 Ga0070684_100218842
383 Ga0068853_100736384
384 Ga0070672_100018012
385 Ga0070672_100018368
386 Ga0070672_100363423
387 Ga0070665_100152461
388 Ga0070665_100259386
389 Ga0070665_101180255
390 Ga0070664_100894288
391 Ga0068857_100417450
392 Ga0068857_101026746
393 Ga0068854_100332968
394 Ga0068852_100099468
395 Ga0068852_100551640
396 Ga0068852_101484933
397 Ga0068859_100078884
398 Ga0068859_100109053
399 Ga0068864_100076543
400 Ga0068866_10018595
401 Ga0068866_10128065
402 Ga0068861_100000750
403 Ga0068861_100074964
404 Ga0068861_100139290
405 Ga0068851_10204195
406 Ga0068870_10218624
407 Ga0068863_100021067
408 Ga0068863_100201159
409 Ga0068858_100002886
410 Ga0068858_100034373
411 Ga0068860_100001666
412 Ga0068860_100004020
413 Ga0068862_100003929
414 Ga0068862_100051087
415 Ga0075369_10053606
416 Ga0075366_10008328
417 Ga0075366_10062885
418 Ga0075366_10095032
419 Ga0097621_101591184
420 Ga0075370_10000041
421 Ga0075370_10101781
422 Ga0068865_100020706
423 Ga0068865_100194687
424 Ga0097620_100078885
425 Ga0097620_100109050
426 Ga0105240_10633435
427 Ga0105245_10198043
428 Ga0105245_10263057
429 Ga0105247_10062996
430 Ga0105243_10032858
431 Ga0105248_10104861
432 Ga0105248_10188510
433 Ga0105237_10001331
434 Ga0105237_10078490
435 Ga0105237_11479478
436 Ga0105238_10043261
437 Ga0105238_10540718
438 Ga0105249_10006572
439 Ga0105249_10112772
440 Ga0105249_10388005
441 Ga0105239_10000563
442 Ga0105239_10134492
443 Ga0157378_10000700
444 Ga0157378_10254438
445 Ga0163162_10006499
446 Ga0163162_10091770
447 Ga0163162_10146108
448 Ga0157375_10144856
449 Ga0157375_10567155
450 Ga0157380_10030661
451 Ga0157380_10048670
452 Ga0157379_10004130
453 Ga0157379_10005931
454 Ga0157379_10136615
455 Ga0157379_10149598
456 Ga0157379_10222847
457 Ga0157376_10398260
458 Ga0163161_10083510
459 Ga0163161_10109714
460 Ga0207682_10019985
461 Ga0207642_10011883
462 Ga0207680_10396399
463 Ga0207645_10016829
464 Ga0207645_10132130
465 Ga0207643_10198360
466 Ga0207705_10409314
467 Ga0207705_11017694
468 Ga0207684_10003219
469 Ga0207695_10003089
470 Ga0207695_10480592
471 Ga0207671_10091217
472 Ga0207649_10897437
473 Ga0207646_10185878
474 Ga0207681_10186592
475 Ga0207694_11264938
476 Ga0207650_10160448
477 Ga0207650_10192559
478 Ga0207659_10125546
479 Ga0207659_10240360
480 Ga0207644_10061623
481 Ga0207690_10352058
482 Ga0207706_10207323
483 Ga0207709_10016145
484 Ga0207669_10019053
485 Ga0207704_10006759
486 Ga0207704_10394450
487 Ga0207691_10026442
488 Ga0207691_10029869
489 Ga0207691_10030916
490 Ga0207711_10143868
491 Ga0207711_10357263
492 Ga0207689_10174042
493 Ga0207661_10654718
494 Ga0207679_10122737
495 Ga0207651_10048359
496 Ga0207651_10602229
497 Ga0207651_11125705
498 Ga0207712_10017506
499 Ga0207712_10436642
500 Ga0207668_10148830
501 Ga0207668_10333740
502 Ga0207658_10044596
503 Ga0207658_10155584
504 Ga0207658_10695152
505 Ga0207658_11246378
506 Ga0207677_10062344
507 Ga0207677_10176266
508 Ga0207703_10127054
509 Ga0207703_11052236
510 Ga0207703_11320060
511 Ga0207639_10491184
512 Ga0207639_11227192
513 Ga0207678_10143421
514 Ga0207708_10065277
515 Ga0207641_10201209
516 Ga0207641_10460224
517 Ga0207648_10000579
518 Ga0207648_10009963
519 Ga0207676_10151214
520 Ga0207676_11092821
521 Ga0207674_10033549
522 Ga0207674_10204221
523 Ga0207674_10633345
524 Ga0207675_100001492
525 Ga0207675_100094660
526 Ga0207683_10127264
527 Ga0207683_10275610
528 Ga0207698_10084374
529 Ga0207698_10280442
530 Ga0207698_10298152
531 Ga0207698_10348438
532 Ga0207698_11030838
533 Ga0209983_1083103
534 Ga0209974_10039809
535 Ga0268266_10423356
536 Ga0268265_10004235
537 Ga0268265_10837660
538 Ga0268264_10006163
539 Ga0268264_10024552
540 Ga0307517_10019725
541 Ga0307517_10461009
542 Ga0307515_10000067
543 Ga0307513_10408379
544 Ga0307408_100030645
545 Ga0307408_100518516
546 Ga0307516_10014997
547 Ga0307405_10009638
548 Ga0307405_10040587
549 Ga0307405_10060012
550 Ga0307413_10012179
551 Ga0307413_10206570
552 Ga0307410_10002778
553 Ga0307406_10004644
554 Ga0307406_10419989
555 Ga0307407_10035362
556 Ga0307412_10016680
557 Ga0307412_10169436
558 Ga0307409_100125500
559 Ga0307416_100001565
560 Ga0307416_100003932
561 Ga0307416_100165704
562 Ga0307416_100252885
563 Ga0307414_10002534
564 Ga0307414_10534086
565 Ga0307411_10000230
566 Ga0307411_10145616
567 Ga0307411_10384106
568 Ga0307415_100006860
569 Ga0373923_0095134
570 Ga0373943_0086581
571 Ga0373931_0168605
572 Ga0373935_0249984
573 Ga0373927_0184935
574 Ga0373933_0075629
575 Ga0373937_0133688
576 Ga0316584_0235069
577 Ga0373925_0092118
578 Ga0373925_0293584
579 Ga0395905_0067222
580 Ga0439436_0001471
581 Ga0439439_0006004
582 Ga0439461_0020464
583 Ga0439466_0005706
584 Ga0451789_0966360
585 Ga0451791_0934926
586 Ga0451793_0148914
587 Ga0451793_0580131
588 Ga0451798_0659504
589 Ga0451800_1620009
590 Ga0451804_0645196
591 Ga0451807_0807165
592 Ga0451841_0759913
593 Ga0451849_0282237
594 Ga0451855_0023220
595 Ga0451853_1230432
596 Ga0451853_3684172
597 Ga0439431_0003140
598 Ga0439433_0002092
599 Ga0439445_0200395
600 Ga0439432_001473
601 Ga0439449_0001998
602 Ga0439449_0006792
603 Ga0439452_002593
604 Ga0439462_0001308
605 Ga0450896_030196
606 Ga0450899_004511
607 Ga0439446_0007018
608 Ga0439434_0022560
609 Ga0439464_0027476
610 Ga0450893_0039077
611 Ga0451577_1195081
612 Ga0466972_0048097
613 Ga0466965_0198109
614 Ga0495603_0675526
615 Ga0495590_0058982
616 Ga0495629_0094781
617 Ga0495580_0116550
618 Ga0495580_0717993
619 Ga0495582_0363408
620 Ga0495605_0176044
621 Ga0495605_0277342
622 Ga0495583_0080966
623 Ga0495606_0562089
624 Ga0495608_0370521
625 Ga0495618_0533697
626 Ga0495632_0005599
627 Ga0495587_0178525
628 Ga0495598_0050211
629 Ga0495621_0002401
630 Ga0495621_0079084
631 Ga0495645_0019885
632 Ga0495668_0546610
633 Ga0495634_0424902
634 Ga0495625_0074951
635 Ga0495657_0351595
636 Ga0495647_0095118
637 Ga0495658_0047880
638 Ga0495658_0204444
639 Ga0495613_0320344
640 Ga0495649_0005975
641 Ga0495660_0095122
642 Ga0495674_0012568
643 Ga0495687_000070
644 Ga0495687_000125
645 Ga0495686_0167876
646 Ga0496106_0259181
647 Ga0496107_0219306
648 Ga0496110_0176201
649 Ga0496112_0022990
650 Ga0496112_1237419
651 Ga0496113_0307404
652 Ga0496115_0435429
653 Ga0496117_0252063
654 Ga0496118_0162272
655 Ga0496121_0011739
656 Ga0496124_0000079
657 Ga0496125_0005397
658 Ga0501306_010341
659 Ga0501309_010875
660 Ga0501305_002746
661 Ga0495678_127491
662 Ga0501292_009366
663 Ga0501297_028851
664 Ga0501298_122727
665 Ga0501257_030445
666 Ga0501262_007508
667 nmdc:mga0k408_10321_c1
668 nmdc:mga0k408_110989_c1
669 nmdc:mga0k408_125095_c1
670 nmdc:mga0k408_1594_c2
671 nmdc:mga06z11_267880_c1
672 nmdc:mga06z11_270710_c1
673 nmdc:mga07m45_10961_c1
674 nmdc:mga07m45_160470_c1
675 nmdc:mga0qj67_290853_c1
676 nmdc:mga0sz30_82845_c1
677 Ga0495601_0155761
678 Ga0500651_0304125
679 Ga0587077_022241
680 Ga0587091_015401
681 Ga0587101_004841
682 Ga0587127_001944
683 Ga0587062_004977
684 Ga0587076_000595
685 Ga0587111_0013803
686 2514047607
687 2792840567
688 2885193881
689 2904616916
690 2904624891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

57

141

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.473 50 155
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.432 50 155
7d6w-assembly1.cif.gz_A crystal structure of phycocyanin from synechococcus sp. r42dm 0.4195 27 154
2j96-assembly1.cif.gz_B the e-configuration of alfa-phycoerythrocyanin 0.4169 27 154
4xxi-assembly1.cif.gz_B crystal structure of the bilin-binding domain of phycobilisome core-membrane linker apce 0.3966 28 154
ID Description Score Start End Superfamily
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7586 53 150 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7556 48 156 1.10.10.1740
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7344 45 170 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.696 48 156 1.10.10.1740
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6786 39 177 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A6B1GWR2-F1-model_v4 DoxX family protein 0.9699 101 171 GO:0016020
AF-A0A244EEY7-F1-model_v4 DoxX family protein 0.9392 28 174 GO:0005886
AF-A0A6L7JTX4-F1-model_v4 DoxX family protein 0.9392 29 171 GO:0005886
AF-A0A1P8UHY1-F1-model_v4 DoxX family protein 0.9386 28 172 GO:0005886
AF-A0A1X7AL12-F1-model_v4 DoxX 0.9384 27 168 GO:0005886

Map