F416480

General Info

Members Datasets Scaffolds Average Seq Length
345 168 690 195

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0115973|Ga0466961_0115973_251_925
Length 224
Sequence MPFAPPVTTAVLPWNLVMRPTVYGPPMELRDILRSRRMHRAFLPDPLPREQIERIAGVIRHAPSGGFSQGGSIVVVTDRELREAIARAFGDEHYSTGGRNFIADAPVHLVISANEALYHARYNEADKLAATGGVEVTWPVPYWFVDAGALMMLVLLAAIDEGLAGAFVGHPDQKRIFDELLGLPEDVVPLGLALIGKPGESPEVGSRLRSRRRPLDDLVHWERW

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
84 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
103 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
106 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
107 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
108 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
133 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
164 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
165 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 3.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.06
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 5.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0115973 3300044693 Bacteria 1683
2 Ga0070658_10012381 3300005327 Bacteria 6847
3 Ga0070658_10069897 3300005327 Bacteria 2873
4 Ga0070658_10254599 3300005327 Bacteria 1490
5 Ga0070683_100081829 3300005329 Bacteria 3023
6 Ga0070683_100086937 3300005329 Bacteria 2931
7 Ga0070683_100131625 3300005329 Bacteria 2367
8 Ga0070683_100350060 3300005329 Bacteria 1407
9 Ga0070690_100326785 3300005330 Bacteria 1107
10 Ga0070680_100001578 3300005336 Bacteria 16617
11 Ga0070680_100007180 3300005336 Bacteria 8491
12 Ga0070680_100121497 3300005336 Bacteria 2181
13 Ga0070680_100176814 3300005336 Bacteria 1797
14 Ga0070682_100149330 3300005337 Unclassified 1602
15 Ga0070682_100160156 3300005337 Bacteria 1553
16 Ga0070682_100421409 3300005337 Unclassified 1015
17 Ga0070660_100004667 3300005339 Bacteria 9488
18 Ga0070660_100354634 3300005339 Bacteria 1208
19 Ga0070687_100167089 3300005343 Bacteria 1306
20 Ga0070661_100004998 3300005344 Bacteria 9136
21 Ga0070661_100113011 3300005344 Bacteria 2029
22 Ga0070661_100375545 3300005344 Bacteria 1120
23 Ga0070671_100604253 3300005355 Unclassified 948
24 Ga0070674_100130262 3300005356 Bacteria 1874
25 Ga0070659_100049217 3300005366 Bacteria 3313
26 Ga0070659_100094637 3300005366 Bacteria 2399
27 Ga0070659_100643285 3300005366 Bacteria 914
28 Ga0070659_101197507 3300005366 Bacteria 672
29 Ga0070714_100167338 3300005435 Unclassified 1993
30 Ga0070663_100382260 3300005455 Bacteria 1147
31 Ga0070678_100025333 3300005456 Bacteria 3988
32 Ga0070678_100169513 3300005456 Bacteria 1777
33 Ga0070681_10005445 3300005458 Bacteria 12298
34 Ga0070681_10015929 3300005458 Bacteria 7496
35 Ga0070681_10033496 3300005458 Bacteria 5157
36 Ga0070681_10093288 3300005458 Bacteria 2959
37 Ga0070681_10096204 3300005458 Bacteria 2909
38 Ga0070681_10363076 3300005458 Bacteria 1358
39 Ga0070681_10560076 3300005458 Bacteria 1057
40 Ga0068867_100487077 3300005459 Bacteria 1058
41 Ga0070679_100004975 3300005530 Bacteria 12267
42 Ga0070679_100006220 3300005530 Bacteria 11122
43 Ga0070679_100052549 3300005530 Bacteria 4057
44 Ga0070679_100067653 3300005530 Bacteria 3562
45 Ga0070679_100198836 3300005530 Bacteria 1971
46 Ga0070679_100215331 3300005530 Bacteria 1883
47 Ga0070679_100243979 3300005530 Bacteria 1753
48 Ga0070679_100305775 3300005530 Bacteria 1540
49 Ga0070684_100019692 3300005535 Bacteria 5584
50 Ga0070684_100140612 3300005535 Unclassified 2183
51 Ga0070684_100290300 3300005535 Bacteria 1499
52 Ga0070696_100010904 3300005546 Bacteria 6092
53 Ga0068855_100100126 3300005563 Bacteria 3337
54 Ga0068855_100168369 3300005563 Bacteria 2482
55 Ga0068855_100591149 3300005563 Bacteria 1198
56 Ga0068855_100884004 3300005563 Bacteria 945
57 Ga0068857_100038711 3300005577 Bacteria 4222
58 Ga0068854_100124959 3300005578 Bacteria 1958
59 Ga0068856_100095656 3300005614 Bacteria 2958
60 Ga0068856_101308955 3300005614 Unclassified 740
61 Ga0070702_100024422 3300005615 Bacteria 3225
62 Ga0068852_100027613 3300005616 Bacteria 4628
63 Ga0068858_100267667 3300005842 Bacteria 1625
64 Ga0070717_10602140 3300006028 Bacteria 997
65 Ga0068865_100263759 3300006881 Unclassified 1365
66 Ga0105240_10136816 3300009093 Bacteria 2933
67 Ga0105240_10177866 3300009093 Bacteria 2514
68 Ga0105240_10481789 3300009093 Bacteria 1383
69 Ga0105240_10842633 3300009093 Bacteria 990
70 Ga0105245_10149003 3300009098 Bacteria 2210
71 Ga0105243_10075854 3300009148 Bacteria 2730
72 Ga0105241_10017497 3300009174 Bacteria 5270
73 Ga0105242_10010790 3300009176 Bacteria 7015
74 Ga0105248_10109572 3300009177 Bacteria 3113
75 Ga0105237_10339759 3300009545 Bacteria 1506
76 Ga0105237_11029756 3300009545 Unclassified 830
77 Ga0105238_10043690 3300009551 Bacteria 4533
78 Ga0105238_10185399 3300009551 Bacteria 2057
79 Ga0105239_10284779 3300010375 Bacteria 1861
80 Ga0105246_10847666 3300011119 Unclassified 815
81 Ga0157373_10079554 3300013100 Bacteria 2312
82 Ga0157370_10006440 3300013104 Bacteria 12952
83 Ga0157370_10032209 3300013104 Bacteria 5120
84 Ga0157370_10116163 3300013104 Bacteria 2500
85 Ga0157370_10624222 3300013104 Bacteria 986
86 Ga0157369_10002020 3300013105 Bacteria 24467
87 Ga0157369_10052082 3300013105 Bacteria 4430
88 Ga0157369_10056568 3300013105 Bacteria 4232
89 Ga0157369_10080727 3300013105 Bacteria 3482
90 Ga0157369_10353684 3300013105 Bacteria 1525
91 Ga0157374_10822527 3300013296 Bacteria 945
92 Ga0157372_10103711 3300013307 Bacteria 3250
93 Ga0157372_10162060 3300013307 Bacteria 2585
94 Ga0157372_10183062 3300013307 Bacteria 2425
95 Ga0157372_10435672 3300013307 Bacteria 1528
96 Ga0157375_10071614 3300013308 Bacteria 3480
97 Ga0157379_10202218 3300014968 Bacteria 1796
98 Ga0182007_10096406 3300015262 Unclassified 976
99 Ga0197907_10776925 3300020069 Unclassified 1179
100 Ga0197907_10850563 3300020069 Bacteria 1612
101 Ga0206356_10586299 3300020070 Bacteria 2176
102 Ga0206356_11434230 3300020070 Bacteria 1597
103 Ga0206354_10170378 3300020081 Bacteria 985
104 Ga0206354_10526152 3300020081 Bacteria 1413
105 Ga0206354_11085433 3300020081 Bacteria 2337
106 Ga0206354_11403101 3300020081 Bacteria 1237
107 Ga0206353_10460861 3300020082 Bacteria 1123
108 Ga0206353_10961017 3300020082 Bacteria 1457
109 Ga0224712_10053221 3300022467 Bacteria 1584
110 Ga0207642_10035389 3300025899 Unclassified 2132
111 Ga0207699_10775624 3300025906 Unclassified 704
112 Ga0207705_10003296 3300025909 Bacteria 12289
113 Ga0207705_10084318 3300025909 Bacteria 2320
114 Ga0207707_10001299 3300025912 Bacteria 23250
115 Ga0207707_10005034 3300025912 Bacteria 11604
116 Ga0207707_10184911 3300025912 Bacteria 1819
117 Ga0207707_10563276 3300025912 Bacteria 967
118 Ga0207695_10944911 3300025913 Bacteria 742
119 Ga0207663_10147886 3300025916 Bacteria 1644
120 Ga0207660_10049265 3300025917 Bacteria 2985
121 Ga0207660_10098659 3300025917 Bacteria 2179
122 Ga0207660_10521679 3300025917 Bacteria 965
123 Ga0207657_10001723 3300025919 Bacteria 23569
124 Ga0207657_10006468 3300025919 Bacteria 12142
125 Ga0207657_10010548 3300025919 Bacteria 9213
126 Ga0207657_10120101 3300025919 Bacteria 2163
127 Ga0207649_10052363 3300025920 Bacteria 2532
128 Ga0207649_10220268 3300025920 Bacteria 1351
129 Ga0207649_10565387 3300025920 Bacteria 871
130 Ga0207652_10009473 3300025921 Bacteria 7829
131 Ga0207652_10029826 3300025921 Bacteria 4564
132 Ga0207652_10052362 3300025921 Bacteria 3503
133 Ga0207652_10072564 3300025921 Bacteria 2993
134 Ga0207652_10083578 3300025921 Bacteria 2795
135 Ga0207652_10311416 3300025921 Bacteria 1421
136 Ga0207652_10338856 3300025921 Bacteria 1357
137 Ga0207652_10491177 3300025921 Bacteria 1105
138 Ga0207646_10327586 3300025922 Bacteria 1384
139 Ga0207694_10099920 3300025924 Bacteria 2298
140 Ga0207664_10420679 3300025929 Bacteria 1190
141 Ga0207690_10022838 3300025932 Bacteria 3896
142 Ga0207686_10058990 3300025934 Bacteria 2422
143 Ga0207686_10184338 3300025934 Bacteria 1482
144 Ga0207704_10158834 3300025938 Bacteria 1606
145 Ga0207661_10039122 3300025944 Bacteria 3721
146 Ga0207661_10109875 3300025944 Bacteria 2330
147 Ga0207661_10521086 3300025944 Bacteria 1087
148 Ga0207667_10112721 3300025949 Bacteria 2804
149 Ga0207640_10151624 3300025981 Bacteria 1704
150 Ga0207703_10384589 3300026035 Bacteria 1299
151 Ga0207639_10205006 3300026041 Bacteria 1694
152 Ga0207639_10423525 3300026041 Bacteria 1204
153 Ga0207674_10014902 3300026116 Bacteria 8572
154 Ga0207674_10051951 3300026116 Bacteria 4181
155 Ga0207674_10119841 3300026116 Bacteria 2600
156 Ga0207683_10000271 3300026121 Bacteria 46316
157 Ga0207683_10216006 3300026121 Bacteria 1746
158 Ga0265322_10041440 3300028654 Bacteria 1311
159 Ga0265338_10118431 3300028800 Bacteria 2116
160 Ga0265338_10163704 3300028800 Bacteria 1715
161 Ga0265340_10055503 3300031247 Bacteria 1908
162 Ga0265327_10029372 3300031251 Unclassified 3128
163 Ga0265313_10029634 3300031595 Bacteria 2829
164 Ga0307412_10267389 3300031911 Bacteria 1336
165 Ga0307416_100012410 3300032002 Bacteria 5741
166 Ga0373945_0002317 3300035116 Bacteria 5962
167 Ga0373954_0032840 3300035118 Bacteria 2401
168 Ga0373943_0033280 3300035170 Bacteria 2454
169 Ga0373955_0003609 3300035172 Bacteria 6807
170 Ga0373935_0658384 3300035692 Bacteria 768
171 Ga0373933_0025576 3300035724 Bacteria 3386
172 Ga0373947_0006189 3300035725 Bacteria 6961
173 Ga0373937_0028969 3300036401 Bacteria 5015
174 Ga0373925_0019924 3300037068 Bacteria 4880
175 Ga0395899_0019436 3300037312 Bacteria 5160
176 Ga0395899_0609127 3300037312 Bacteria 695
177 Ga0395900_0037330 3300037418 Bacteria 5010
178 Ga0395900_0185745 3300037418 Bacteria 2110
179 Ga0395898_0001852 3300037466 Bacteria 27141
180 Ga0395898_0111417 3300037466 Bacteria 2623
181 Ga0395898_0389295 3300037466 Bacteria 1329
182 Ga0395905_1088779 3300037471 Unclassified 702
183 Ga0395901_0000713 3300038443 Bacteria 38015
184 Ga0395901_0006636 3300038443 Bacteria 11692
185 Ga0395901_0048938 3300038443 Bacteria 4391
186 Ga0395901_0138384 3300038443 Bacteria 2559
187 Ga0395901_0315532 3300038443 Bacteria 1618
188 Ga0395901_0471255 3300038443 Bacteria 1282
189 Ga0395901_0566303 3300038443 Bacteria 1150
190 Ga0436365_0030296 3300039437 Bacteria 4063
191 Ga0451853_0679537 3300041512 Bacteria 1306
192 Ga0439448_0041559 3300042005 Bacteria 1488
193 Ga0466972_0340957 3300044658 Bacteria 701
194 Ga0466966_0005953 3300044684 Bacteria 8046
195 Ga0466961_0001970 3300044693 Bacteria 12775
196 Ga0466963_0013284 3300044694 Bacteria 5054
197 Ga0466963_0028336 3300044694 Bacteria 3595
198 Ga0466963_0050518 3300044694 Bacteria 2752
199 Ga0466963_0072082 3300044694 Bacteria 2326
200 Ga0466963_0199933 3300044694 Bacteria 1398
201 Ga0466963_0202488 3300044694 Bacteria 1388
202 Ga0466963_0302874 3300044694 Bacteria 1124
203 Ga0466963_0462786 3300044694 Bacteria 895
204 Ga0466964_0002625 3300044706 Bacteria 6432
205 Ga0466971_0001715 3300044719 Bacteria 9285
206 Ga0466970_0089182 3300044765 Bacteria 1673
207 Ga0466970_0183220 3300044765 Bacteria 1162
208 Ga0466957_0001396 3300044842 Bacteria 12596
209 Ga0466957_0004732 3300044842 Bacteria 7622
210 Ga0466957_0260319 3300044842 Bacteria 1156
211 Ga0466960_0053499 3300044901 Bacteria 1957
212 Ga0466959_0001891 3300045049 Bacteria 13177
213 Ga0466959_0022066 3300045049 Bacteria 4702
214 Ga0466959_0042995 3300045049 Bacteria 3332
215 Ga0466959_0194099 3300045049 Bacteria 1416
216 Ga0466958_0001022 3300045836 Bacteria 12735
217 Ga0466958_0018172 3300045836 Bacteria 4076
218 Ga0466958_0020477 3300045836 Bacteria 3857
219 Ga0466967_0009404 3300045976 Bacteria 7249
220 Ga0466967_0026148 3300045976 Bacteria 4828
221 Ga0466967_0027707 3300045976 Bacteria 4717
222 Ga0466967_0036808 3300045976 Bacteria 4181
223 Ga0466967_0040287 3300045976 Bacteria 4021
224 Ga0466967_0055060 3300045976 Bacteria 3503
225 Ga0466967_0159714 3300045976 Bacteria 2115
226 Ga0466967_0171995 3300045976 Bacteria 2039
227 Ga0466967_0185885 3300045976 Bacteria 1962
228 Ga0466967_0241436 3300045976 Bacteria 1723
229 Ga0466967_0352605 3300045976 Bacteria 1424
230 Ga0466967_0407909 3300045976 Bacteria 1323
231 Ga0466967_0492477 3300045976 Bacteria 1202
232 Ga0495592_0003289 3300046454 Bacteria 11583
233 Ga0495592_0251933 3300046454 Bacteria 1166
234 Ga0495592_0368530 3300046454 Bacteria 917
235 Ga0495629_0290152 3300046459 Bacteria 1121
236 Ga0495629_0461521 3300046459 Bacteria 859
237 Ga0495651_0008333 3300046462 Bacteria 7945
238 Ga0495651_0108520 3300046462 Bacteria 2055
239 Ga0495651_0141970 3300046462 Bacteria 1740
240 Ga0495653_0067775 3300046463 Bacteria 2678
241 Ga0495639_0153630 3300046475 Bacteria 1111
242 Ga0495662_0019448 3300046476 Bacteria 3284
243 Ga0495662_0073688 3300046476 Bacteria 1656
244 Ga0495664_0030993 3300046477 Bacteria 3134
245 Ga0495664_0031569 3300046477 Bacteria 3106
246 Ga0495664_0292328 3300046477 Bacteria 984
247 Ga0495608_0008094 3300046511 Bacteria 7391
248 Ga0495608_0020701 3300046511 Bacteria 4519
249 Ga0495608_0095349 3300046511 Bacteria 1922
250 Ga0495618_0174426 3300046514 Bacteria 1367
251 Ga0495628_0025238 3300046516 Bacteria 4856
252 Ga0495630_0036152 3300046517 Bacteria 3692
253 Ga0495630_0103786 3300046517 Bacteria 2151
254 Ga0495630_0279034 3300046517 Bacteria 1276
255 Ga0495652_0036675 3300046529 Bacteria 4259
256 Ga0495652_0278047 3300046529 Bacteria 1227
257 Ga0495652_0449366 3300046529 Bacteria 902
258 Ga0495665_0183188 3300046531 Bacteria 1088
259 Ga0495640_0036288 3300046533 Bacteria 3483
260 Ga0495640_0047984 3300046533 Bacteria 2953
261 Ga0495640_0253924 3300046533 Bacteria 1100
262 Ga0495587_0094553 3300046536 Bacteria 1725
263 Ga0495587_0104570 3300046536 Bacteria 1629
264 Ga0495645_0036038 3300046543 Bacteria 3606
265 Ga0495645_0209553 3300046543 Bacteria 1317
266 Ga0495667_0066304 3300046559 Bacteria 2360
267 Ga0495667_0075484 3300046559 Bacteria 2193
268 Ga0495634_0083442 3300046642 Bacteria 2085
269 Ga0495635_0083312 3300046663 Bacteria 2188
270 Ga0495635_0271221 3300046663 Bacteria 1141
271 Ga0495657_0007199 3300046675 Bacteria 8627
272 Ga0495657_0154848 3300046675 Bacteria 1421
273 Ga0495657_0545976 3300046675 Bacteria 673
274 Ga0495599_0003531 3300046678 Bacteria 9153
275 Ga0495599_0100465 3300046678 Bacteria 1803
276 Ga0495646_0208543 3300046680 Bacteria 1061
277 Ga0495658_0021340 3300046683 Bacteria 3413
278 Ga0495613_0010397 3300046689 Bacteria 6912
279 Ga0495613_0141663 3300046689 Bacteria 1718
280 Ga0495600_0009238 3300046809 Bacteria 6083
281 Ga0495600_0052415 3300046809 Bacteria 2664
282 Ga0495581_0132210 3300047315 Bacteria 1454
283 Ga0495581_0155424 3300047315 Bacteria 1337
284 Ga0495604_0011451 3300047317 Bacteria 7042
285 Ga0495604_0028971 3300047317 Bacteria 4405
286 Ga0495674_0017580 3300047319 Bacteria 6657
287 Ga0495674_0022680 3300047319 Bacteria 5787
288 Ga0495674_0285383 3300047319 Bacteria 1351
289 Ga0495680_0003405 3300047322 Bacteria 15694
290 Ga0495680_0008793 3300047322 Bacteria 9149
291 Ga0495680_0008876 3300047322 Bacteria 9089
292 Ga0495675_0015432 3300047444 Bacteria 4830
293 Ga0495675_0173281 3300047444 Bacteria 1324
294 Ga0495684_0049124 3300047471 Bacteria 3224
295 Ga0495684_0079145 3300047471 Bacteria 2495
296 Ga0495602_0116294 3300048088 Bacteria 2161
297 Ga0495602_0165019 3300048088 Bacteria 1725
298 Ga0495602_0225487 3300048088 Bacteria 1411
299 Ga0495602_0372637 3300048088 Bacteria 1025
300 Ga0495614_0093695 3300048089 Bacteria 1308
301 Ga0496100_0258118 3300048903 Bacteria 1291
302 Ga0496102_0048755 3300048905 Bacteria 3851
303 Ga0496102_0204578 3300048905 Bacteria 1861
304 Ga0496102_0222531 3300048905 Bacteria 1779
305 Ga0496102_0954446 3300048905 Bacteria 778
306 Ga0496106_0022966 3300048909 Bacteria 4632
307 Ga0496106_0063169 3300048909 Bacteria 2813
308 Ga0496107_0085715 3300048910 Bacteria 2298
309 Ga0496112_0127566 3300048915 Bacteria 2515
310 Ga0496112_0437563 3300048915 Unclassified 1246
311 Ga0496114_0098805 3300048917 Unclassified 2489
312 Ga0496114_0178877 3300048917 Bacteria 1851
313 Ga0496115_0013174 3300048918 Bacteria 6247
314 Ga0496115_0326496 3300048918 Bacteria 1254
315 Ga0501032_0398043 3300049569 Bacteria 885
316 Ga0501034_0179252 3300049571 Bacteria 2084
317 Ga0501046_0495710 3300049580 Bacteria 875
318 Ga0501047_0000178 3300049581 Bacteria 77670
319 Ga0501047_0067722 3300049581 Bacteria 3440
320 Ga0501047_0117905 3300049581 Bacteria 2536
321 Ga0501047_0577304 3300049581 Bacteria 947
322 Ga0501047_0828852 3300049581 Archaea 739
323 Ga0501067_0001272 3300049583 Bacteria 13710
324 Ga0501067_0460835 3300049583 Unclassified 710
325 Ga0501069_0040483 3300049585 Bacteria 2576
326 Ga0501070_0019220 3300049586 Bacteria 5730
327 Ga0501070_0461476 3300049586 Unclassified 1023
328 Ga0501074_0136918 3300049590 Bacteria 1751
329 Ga0501080_0059837 3300049742 Bacteria 3545
330 Ga0501080_0178482 3300049742 Bacteria 1955
331 Ga0501080_0707427 3300049742 Bacteria 888
332 Ga0501083_0471587 3300049744 Bacteria 817
333 Ga0501035_0200917 3300049822 Bacteria 1710
334 Ga0501035_0436061 3300049822 Bacteria 1086
335 Ga0501044_0494377 3300049823 Bacteria 1125
336 Ga0495601_0213783 3300053077 Bacteria 1259
337 Ga0495612_0058919 3300053078 Bacteria 1587
338 Ga0495595_0001277 3300053084 Bacteria 9808
339 Ga0495595_0038196 3300053084 Bacteria 2186
340 Ga0495619_0001934 3300053085 Bacteria 13809
341 Ga0495619_0025761 3300053085 Bacteria 3779
342 Ga0495619_0167920 3300053085 Bacteria 1517
343 Ga0466962_0001294 3300061719 Bacteria 11553
344 Ga0466962_0056259 3300061719 Bacteria 1879
345 Ga0530510_0019152 3300061734 Bacteria 4855
346 Ga0466961_0115973
347 Ga0070658_10012381
348 Ga0070658_10069897
349 Ga0070658_10254599
350 Ga0070683_100081829
351 Ga0070683_100086937
352 Ga0070683_100131625
353 Ga0070683_100350060
354 Ga0070690_100326785
355 Ga0070680_100001578
356 Ga0070680_100007180
357 Ga0070680_100121497
358 Ga0070680_100176814
359 Ga0070682_100149330
360 Ga0070682_100160156
361 Ga0070682_100421409
362 Ga0070660_100004667
363 Ga0070660_100354634
364 Ga0070687_100167089
365 Ga0070661_100004998
366 Ga0070661_100113011
367 Ga0070661_100375545
368 Ga0070671_100604253
369 Ga0070674_100130262
370 Ga0070659_100049217
371 Ga0070659_100094637
372 Ga0070659_100643285
373 Ga0070659_101197507
374 Ga0070714_100167338
375 Ga0070663_100382260
376 Ga0070678_100025333
377 Ga0070678_100169513
378 Ga0070681_10005445
379 Ga0070681_10015929
380 Ga0070681_10033496
381 Ga0070681_10093288
382 Ga0070681_10096204
383 Ga0070681_10363076
384 Ga0070681_10560076
385 Ga0068867_100487077
386 Ga0070679_100004975
387 Ga0070679_100006220
388 Ga0070679_100052549
389 Ga0070679_100067653
390 Ga0070679_100198836
391 Ga0070679_100215331
392 Ga0070679_100243979
393 Ga0070679_100305775
394 Ga0070684_100019692
395 Ga0070684_100140612
396 Ga0070684_100290300
397 Ga0070696_100010904
398 Ga0068855_100100126
399 Ga0068855_100168369
400 Ga0068855_100591149
401 Ga0068855_100884004
402 Ga0068857_100038711
403 Ga0068854_100124959
404 Ga0068856_100095656
405 Ga0068856_101308955
406 Ga0070702_100024422
407 Ga0068852_100027613
408 Ga0068858_100267667
409 Ga0070717_10602140
410 Ga0068865_100263759
411 Ga0105240_10136816
412 Ga0105240_10177866
413 Ga0105240_10481789
414 Ga0105240_10842633
415 Ga0105245_10149003
416 Ga0105243_10075854
417 Ga0105241_10017497
418 Ga0105242_10010790
419 Ga0105248_10109572
420 Ga0105237_10339759
421 Ga0105237_11029756
422 Ga0105238_10043690
423 Ga0105238_10185399
424 Ga0105239_10284779
425 Ga0105246_10847666
426 Ga0157373_10079554
427 Ga0157370_10006440
428 Ga0157370_10032209
429 Ga0157370_10116163
430 Ga0157370_10624222
431 Ga0157369_10002020
432 Ga0157369_10052082
433 Ga0157369_10056568
434 Ga0157369_10080727
435 Ga0157369_10353684
436 Ga0157374_10822527
437 Ga0157372_10103711
438 Ga0157372_10162060
439 Ga0157372_10183062
440 Ga0157372_10435672
441 Ga0157375_10071614
442 Ga0157379_10202218
443 Ga0182007_10096406
444 Ga0197907_10776925
445 Ga0197907_10850563
446 Ga0206356_10586299
447 Ga0206356_11434230
448 Ga0206354_10170378
449 Ga0206354_10526152
450 Ga0206354_11085433
451 Ga0206354_11403101
452 Ga0206353_10460861
453 Ga0206353_10961017
454 Ga0224712_10053221
455 Ga0207642_10035389
456 Ga0207699_10775624
457 Ga0207705_10003296
458 Ga0207705_10084318
459 Ga0207707_10001299
460 Ga0207707_10005034
461 Ga0207707_10184911
462 Ga0207707_10563276
463 Ga0207695_10944911
464 Ga0207663_10147886
465 Ga0207660_10049265
466 Ga0207660_10098659
467 Ga0207660_10521679
468 Ga0207657_10001723
469 Ga0207657_10006468
470 Ga0207657_10010548
471 Ga0207657_10120101
472 Ga0207649_10052363
473 Ga0207649_10220268
474 Ga0207649_10565387
475 Ga0207652_10009473
476 Ga0207652_10029826
477 Ga0207652_10052362
478 Ga0207652_10072564
479 Ga0207652_10083578
480 Ga0207652_10311416
481 Ga0207652_10338856
482 Ga0207652_10491177
483 Ga0207646_10327586
484 Ga0207694_10099920
485 Ga0207664_10420679
486 Ga0207690_10022838
487 Ga0207686_10058990
488 Ga0207686_10184338
489 Ga0207704_10158834
490 Ga0207661_10039122
491 Ga0207661_10109875
492 Ga0207661_10521086
493 Ga0207667_10112721
494 Ga0207640_10151624
495 Ga0207703_10384589
496 Ga0207639_10205006
497 Ga0207639_10423525
498 Ga0207674_10014902
499 Ga0207674_10051951
500 Ga0207674_10119841
501 Ga0207683_10000271
502 Ga0207683_10216006
503 Ga0265322_10041440
504 Ga0265338_10118431
505 Ga0265338_10163704
506 Ga0265340_10055503
507 Ga0265327_10029372
508 Ga0265313_10029634
509 Ga0307412_10267389
510 Ga0307416_100012410
511 Ga0373945_0002317
512 Ga0373954_0032840
513 Ga0373943_0033280
514 Ga0373955_0003609
515 Ga0373935_0658384
516 Ga0373933_0025576
517 Ga0373947_0006189
518 Ga0373937_0028969
519 Ga0373925_0019924
520 Ga0395899_0019436
521 Ga0395899_0609127
522 Ga0395900_0037330
523 Ga0395900_0185745
524 Ga0395898_0001852
525 Ga0395898_0111417
526 Ga0395898_0389295
527 Ga0395905_1088779
528 Ga0395901_0000713
529 Ga0395901_0006636
530 Ga0395901_0048938
531 Ga0395901_0138384
532 Ga0395901_0315532
533 Ga0395901_0471255
534 Ga0395901_0566303
535 Ga0436365_0030296
536 Ga0451853_0679537
537 Ga0439448_0041559
538 Ga0466972_0340957
539 Ga0466966_0005953
540 Ga0466961_0001970
541 Ga0466963_0013284
542 Ga0466963_0028336
543 Ga0466963_0050518
544 Ga0466963_0072082
545 Ga0466963_0199933
546 Ga0466963_0202488
547 Ga0466963_0302874
548 Ga0466963_0462786
549 Ga0466964_0002625
550 Ga0466971_0001715
551 Ga0466970_0089182
552 Ga0466970_0183220
553 Ga0466957_0001396
554 Ga0466957_0004732
555 Ga0466957_0260319
556 Ga0466960_0053499
557 Ga0466959_0001891
558 Ga0466959_0022066
559 Ga0466959_0042995
560 Ga0466959_0194099
561 Ga0466958_0001022
562 Ga0466958_0018172
563 Ga0466958_0020477
564 Ga0466967_0009404
565 Ga0466967_0026148
566 Ga0466967_0027707
567 Ga0466967_0036808
568 Ga0466967_0040287
569 Ga0466967_0055060
570 Ga0466967_0159714
571 Ga0466967_0171995
572 Ga0466967_0185885
573 Ga0466967_0241436
574 Ga0466967_0352605
575 Ga0466967_0407909
576 Ga0466967_0492477
577 Ga0495592_0003289
578 Ga0495592_0251933
579 Ga0495592_0368530
580 Ga0495629_0290152
581 Ga0495629_0461521
582 Ga0495651_0008333
583 Ga0495651_0108520
584 Ga0495651_0141970
585 Ga0495653_0067775
586 Ga0495639_0153630
587 Ga0495662_0019448
588 Ga0495662_0073688
589 Ga0495664_0030993
590 Ga0495664_0031569
591 Ga0495664_0292328
592 Ga0495608_0008094
593 Ga0495608_0020701
594 Ga0495608_0095349
595 Ga0495618_0174426
596 Ga0495628_0025238
597 Ga0495630_0036152
598 Ga0495630_0103786
599 Ga0495630_0279034
600 Ga0495652_0036675
601 Ga0495652_0278047
602 Ga0495652_0449366
603 Ga0495665_0183188
604 Ga0495640_0036288
605 Ga0495640_0047984
606 Ga0495640_0253924
607 Ga0495587_0094553
608 Ga0495587_0104570
609 Ga0495645_0036038
610 Ga0495645_0209553
611 Ga0495667_0066304
612 Ga0495667_0075484
613 Ga0495634_0083442
614 Ga0495635_0083312
615 Ga0495635_0271221
616 Ga0495657_0007199
617 Ga0495657_0154848
618 Ga0495657_0545976
619 Ga0495599_0003531
620 Ga0495599_0100465
621 Ga0495646_0208543
622 Ga0495658_0021340
623 Ga0495613_0010397
624 Ga0495613_0141663
625 Ga0495600_0009238
626 Ga0495600_0052415
627 Ga0495581_0132210
628 Ga0495581_0155424
629 Ga0495604_0011451
630 Ga0495604_0028971
631 Ga0495674_0017580
632 Ga0495674_0022680
633 Ga0495674_0285383
634 Ga0495680_0003405
635 Ga0495680_0008793
636 Ga0495680_0008876
637 Ga0495675_0015432
638 Ga0495675_0173281
639 Ga0495684_0049124
640 Ga0495684_0079145
641 Ga0495602_0116294
642 Ga0495602_0165019
643 Ga0495602_0225487
644 Ga0495602_0372637
645 Ga0495614_0093695
646 Ga0496100_0258118
647 Ga0496102_0048755
648 Ga0496102_0204578
649 Ga0496102_0222531
650 Ga0496102_0954446
651 Ga0496106_0022966
652 Ga0496106_0063169
653 Ga0496107_0085715
654 Ga0496112_0127566
655 Ga0496112_0437563
656 Ga0496114_0098805
657 Ga0496114_0178877
658 Ga0496115_0013174
659 Ga0496115_0326496
660 Ga0501032_0398043
661 Ga0501034_0179252
662 Ga0501046_0495710
663 Ga0501047_0000178
664 Ga0501047_0067722
665 Ga0501047_0117905
666 Ga0501047_0577304
667 Ga0501047_0828852
668 Ga0501067_0001272
669 Ga0501067_0460835
670 Ga0501069_0040483
671 Ga0501070_0019220
672 Ga0501070_0461476
673 Ga0501074_0136918
674 Ga0501080_0059837
675 Ga0501080_0178482
676 Ga0501080_0707427
677 Ga0501083_0471587
678 Ga0501035_0200917
679 Ga0501035_0436061
680 Ga0501044_0494377
681 Ga0495601_0213783
682 Ga0495612_0058919
683 Ga0495595_0001277
684 Ga0495595_0038196
685 Ga0495619_0001934
686 Ga0495619_0025761
687 Ga0495619_0167920
688 Ga0466962_0001294
689 Ga0466962_0056259
690 Ga0530510_0019152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00881

Nitroreductase

Nitroreductase family

33

197

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g14-assembly1.cif.gz_B crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.7759 3 162
3g14-assembly1.cif.gz_A crystal structure of nitroreductase family protein (yp_877874.1) from clostridium novyi nt at 1.75 a resolution 0.7757 3 155
3gb5-assembly1.cif.gz_A-2 crystal structure of mus musculus iodotyrosine deiodinase (iyd) bound to fmn 0.7757 3 177
3e39-assembly1.cif.gz_B crystal structure of a putative nitroreductase in complex with fmn (dde_0787) from desulfovibrio desulfuricans subsp. at 1.70 a resolution 0.7723 3 176
3e10-assembly1.cif.gz_A crystal structure of putative nadh oxidase (np_348178.1) from clostridium acetobutylicum at 1.40 a resolution 0.7667 3 181
ID Description Score Start End Superfamily
3gb5A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7757 3 177 3.40.109.10
3g14A00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7687 3 155 3.40.109.10
3e10B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7636 3 181 3.40.109.10
3e39B00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7404 3 176 3.40.109.10
3qdlD00 Alpha Beta;3-Layer(aba) Sandwich;NADH Oxidase;NADH Oxidase 0.7372 2 178 3.40.109.10
ID Description Score Start End GO Terms
AF-A0A0H2SK79-F1-model_v4 Nitroreductase 0.8391 2 157 GO:0016491
AF-A0A6I2L3Y3-F1-model_v4 Nitroreductase 0.8357 2 155 GO:0016491
AF-A0A348ZKX1-F1-model_v4 Nitroreductase 0.8275 3 158 GO:0016491
AF-A0A7J3DL31-F1-model_v4 Nitroreductase domain-containing protein 0.8261 2 154 GO:0016491
AF-A0A832MW56-F1-model_v4 Nitroreductase 0.8251 3 158 GO:0016491

Map