F416473

General Info

Members Datasets Scaffolds Average Seq Length
345 179 690 106

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0020917|Ga0466969_0020917_1838_2224
Length 121
Sequence VCTGSASRRSATGRGADAERRAARWYRLRGWRILGANVWAGGNEIDLIVRRGRTLRFVEVKEKRGTGFGDPLEMITAEKRRRLRRAAAAWLAARPECQGLSVGFDAIAVRDGRVRRVPQAF

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
105 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.91
Rhizosphere 85.22
Stem 0
Stem Tuber 0
Unclassified 7.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0020917 3300044656 Bacteria 3384
2 rootL2_10230216 3300003322 Bacteria 2141
3 rootH1_10133855 3300003323 Bacteria 1404
4 Ga0070658_10299348 3300005327 Bacteria 1371
5 Ga0070658_11898862 3300005327 Unclassified 514
6 Ga0070683_100112907 3300005329 Bacteria 2564
7 Ga0070683_101090570 3300005329 Bacteria 767
8 Ga0070680_100103880 3300005336 Bacteria 2361
9 Ga0070680_100205654 3300005336 Bacteria 1660
10 Ga0070680_100550264 3300005336 Bacteria 989
11 Ga0070682_100126958 3300005337 Bacteria 1721
12 Ga0070682_100132687 3300005337 Bacteria 1687
13 Ga0070682_101871917 3300005337 Bacteria 525
14 Ga0070660_100042589 3300005339 Bacteria 3466
15 Ga0070660_101656953 3300005339 Unclassified 544
16 Ga0070661_100358305 3300005344 Bacteria 1146
17 Ga0070692_10472954 3300005345 Bacteria 807
18 Ga0070675_100660763 3300005354 Bacteria 950
19 Ga0070659_100775640 3300005366 Unclassified 833
20 Ga0070703_10124241 3300005406 Bacteria 940
21 Ga0070709_10044997 3300005434 Bacteria 2736
22 Ga0070714_100231698 3300005435 Bacteria 1702
23 Ga0070714_100274125 3300005435 Bacteria 1565
24 Ga0070713_100010195 3300005436 Bacteria 6779
25 Ga0070713_100013273 3300005436 Bacteria 6076
26 Ga0070713_101135133 3300005436 Bacteria 756
27 Ga0070710_10102401 3300005437 Bacteria 1707
28 Ga0070701_10963169 3300005438 Unclassified 593
29 Ga0070711_100116058 3300005439 Bacteria 1972
30 Ga0070711_100579511 3300005439 Bacteria 934
31 Ga0070694_100663354 3300005444 Bacteria 845
32 Ga0070663_100524234 3300005455 Bacteria 987
33 Ga0070678_101291004 3300005456 Bacteria 679
34 Ga0070662_101800131 3300005457 Bacteria 529
35 Ga0070681_10017999 3300005458 Bacteria 7059
36 Ga0070681_10079251 3300005458 Bacteria 3241
37 Ga0070681_10106825 3300005458 Bacteria 2741
38 Ga0070681_10516505 3300005458 Unclassified 1108
39 Ga0070685_11380335 3300005466 Bacteria 540
40 Ga0070706_100697187 3300005467 Bacteria 942
41 Ga0070707_100001421 3300005468 Bacteria 23463
42 Ga0070699_100987104 3300005518 Bacteria 772
43 Ga0070679_100114231 3300005530 Bacteria 2685
44 Ga0070679_100165684 3300005530 Bacteria 2183
45 Ga0070679_100176826 3300005530 Unclassified 2107
46 Ga0070679_100186808 3300005530 Bacteria 2043
47 Ga0070679_100271189 3300005530 Bacteria 1651
48 Ga0070679_100394746 3300005530 Bacteria 1329
49 Ga0070684_100025614 3300005535 Bacteria 4961
50 Ga0070684_100136435 3300005535 Bacteria 2216
51 Ga0070684_100211179 3300005535 Bacteria 1769
52 Ga0070684_101639277 3300005535 Bacteria 607
53 Ga0068853_101476092 3300005539 Bacteria 658
54 Ga0070693_100864575 3300005547 Bacteria 675
55 Ga0070704_100162825 3300005549 Bacteria 1766
56 Ga0070704_101281867 3300005549 Bacteria 670
57 Ga0070664_100238149 3300005564 Bacteria 1633
58 Ga0068856_100198860 3300005614 Bacteria 2019
59 Ga0068856_100442161 3300005614 Bacteria 1321
60 Ga0070702_100046131 3300005615 Bacteria 2469
61 Ga0068852_100512769 3300005616 Bacteria 1196
62 Ga0068866_11144014 3300005718 Bacteria 559
63 Ga0068863_100079253 3300005841 Bacteria 3111
64 Ga0070717_10051448 3300006028 Bacteria 3390
65 Ga0070717_10166695 3300006028 Bacteria 1914
66 Ga0070717_10863700 3300006028 Bacteria 823
67 Ga0070715_10000828 3300006163 Bacteria 8480
68 Ga0070712_100013170 3300006175 Bacteria 5277
69 Ga0070712_101041218 3300006175 Bacteria 709
70 Ga0070712_101433706 3300006175 Unclassified 603
71 Ga0097621_100542124 3300006237 Bacteria 1058
72 Ga0097621_100725146 3300006237 Bacteria 917
73 Ga0075433_10696139 3300006852 Bacteria 890
74 Ga0075433_11000610 3300006852 Bacteria 728
75 Ga0075434_100022564 3300006871 Bacteria 6129
76 Ga0075434_102080827 3300006871 Bacteria 572
77 Ga0075436_100507190 3300006914 Bacteria 883
78 Ga0075435_100382128 3300007076 Bacteria 1210
79 Ga0105251_10102122 3300009011 Bacteria 1310
80 Ga0105240_11506748 3300009093 Unclassified 705
81 Ga0111539_10749532 3300009094 Bacteria 1137
82 Ga0105245_10256569 3300009098 Bacteria 1700
83 Ga0105245_10566002 3300009098 Bacteria 1160
84 Ga0105245_10679895 3300009098 Bacteria 1061
85 Ga0105242_10266446 3300009176 Bacteria 1550
86 Ga0105242_10289298 3300009176 Bacteria 1491
87 Ga0105248_10235886 3300009177 Bacteria 2059
88 Ga0105248_10528772 3300009177 Unclassified 1330
89 Ga0105238_10919212 3300009551 Bacteria 894
90 Ga0105238_11294966 3300009551 Bacteria 755
91 Ga0105246_10150956 3300011119 Bacteria 1758
92 Ga0157373_10868037 3300013100 Bacteria 668
93 Ga0157371_11195923 3300013102 Bacteria 586
94 Ga0157369_10005241 3300013105 Bacteria 15120
95 Ga0157369_11231196 3300013105 Unclassified 764
96 Ga0157369_11506002 3300013105 Bacteria 684
97 Ga0157374_10103876 3300013296 Bacteria 2727
98 Ga0157374_10766700 3300013296 Bacteria 980
99 Ga0163162_10187624 3300013306 Bacteria 2195
100 Ga0157372_10718234 3300013307 Bacteria 1162
101 Ga0157372_11180357 3300013307 Bacteria 885
102 Ga0157372_11611376 3300013307 Bacteria 747
103 Ga0157372_11975464 3300013307 Bacteria 670
104 Ga0157372_12803502 3300013307 Bacteria 559
105 Ga0157379_10221953 3300014968 Bacteria 1712
106 Ga0157376_10014759 3300014969 Bacteria 5876
107 Ga0182007_10091775 3300015262 Bacteria 1000
108 Ga0206356_11455896 3300020070 Bacteria 757
109 Ga0206356_11645465 3300020070 Bacteria 688
110 Ga0206353_10449184 3300020082 Bacteria 1064
111 Ga0207656_10580184 3300025321 Unclassified 572
112 Ga0207653_10078241 3300025885 Bacteria 1141
113 Ga0207692_10049327 3300025898 Bacteria 2124
114 Ga0207642_10852648 3300025899 Bacteria 582
115 Ga0207685_10120566 3300025905 Bacteria 1151
116 Ga0207699_10163333 3300025906 Bacteria 1484
117 Ga0207699_10197963 3300025906 Bacteria 1360
118 Ga0207699_10701309 3300025906 Bacteria 741
119 Ga0207705_10193064 3300025909 Bacteria 1541
120 Ga0207705_10308381 3300025909 Bacteria 1215
121 Ga0207707_10072456 3300025912 Bacteria 3003
122 Ga0207707_10370109 3300025912 Bacteria 1233
123 Ga0207707_10419121 3300025912 Bacteria 1148
124 Ga0207707_10910956 3300025912 Bacteria 726
125 Ga0207693_10017266 3300025915 Bacteria 5756
126 Ga0207693_10883076 3300025915 Bacteria 686
127 Ga0207663_10144271 3300025916 Bacteria 1662
128 Ga0207660_10111356 3300025917 Unclassified 2060
129 Ga0207660_10770968 3300025917 Bacteria 785
130 Ga0207660_11292115 3300025917 Bacteria 593
131 Ga0207657_10001172 3300025919 Bacteria 27807
132 Ga0207657_10053148 3300025919 Bacteria 3511
133 Ga0207649_10291883 3300025920 Bacteria 1189
134 Ga0207649_10748341 3300025920 Bacteria 760
135 Ga0207652_10190741 3300025921 Bacteria 1843
136 Ga0207652_10259717 3300025921 Bacteria 1567
137 Ga0207652_10474935 3300025921 Bacteria 1126
138 Ga0207652_10707865 3300025921 Bacteria 898
139 Ga0207652_10886334 3300025921 Bacteria 789
140 Ga0207646_10003417 3300025922 Bacteria 17931
141 Ga0207694_10587144 3300025924 Bacteria 937
142 Ga0207700_10031832 3300025928 Bacteria 3752
143 Ga0207700_10165990 3300025928 Bacteria 1837
144 Ga0207700_10233506 3300025928 Bacteria 1565
145 Ga0207664_10040444 3300025929 Bacteria 3626
146 Ga0207664_10159095 3300025929 Bacteria 1925
147 Ga0207664_10217388 3300025929 Bacteria 1656
148 Ga0207664_10383954 3300025929 Bacteria 1247
149 Ga0207690_11017798 3300025932 Bacteria 689
150 Ga0207706_10801632 3300025933 Bacteria 800
151 Ga0207686_10165729 3300025934 Bacteria 1553
152 Ga0207709_10155238 3300025935 Bacteria 1590
153 Ga0207665_10059925 3300025939 Bacteria 2577
154 Ga0207665_11296507 3300025939 Unclassified 581
155 Ga0207711_10112113 3300025941 Bacteria 2427
156 Ga0207711_10835996 3300025941 Bacteria 857
157 Ga0207661_10004287 3300025944 Bacteria 9988
158 Ga0207661_10592831 3300025944 Bacteria 1017
159 Ga0207667_10273864 3300025949 Bacteria 1725
160 Ga0207677_10712485 3300026023 Bacteria 891
161 Ga0207678_10669074 3300026067 Bacteria 913
162 Ga0207702_10305292 3300026078 Unclassified 1511
163 Ga0207702_10338365 3300026078 Bacteria 1437
164 Ga0207702_10633733 3300026078 Bacteria 1051
165 Ga0207702_11773744 3300026078 Bacteria 609
166 Ga0207641_10135405 3300026088 Bacteria 2217
167 Ga0207676_10625355 3300026095 Bacteria 1037
168 Ga0207674_12181861 3300026116 Bacteria 517
169 Ga0207683_11145311 3300026121 Bacteria 721
170 Ga0207698_11176726 3300026142 Bacteria 780
171 Ga0265323_10085129 3300028653 Bacteria 1064
172 Ga0265327_10007600 3300031251 Bacteria 8319
173 Ga0265342_10622762 3300031712 Bacteria 543
174 Ga0373951_0070712 3300035091 Bacteria 889
175 Ga0373954_0427120 3300035118 Bacteria 656
176 Ga0373960_0235452 3300035121 Bacteria 660
177 Ga0373943_0405827 3300035170 Bacteria 787
178 Ga0373962_0275275 3300035242 Bacteria 591
179 Ga0373931_0034373 3300035691 Bacteria 2631
180 Ga0373947_0229788 3300035725 Bacteria 1222
181 Ga0373937_0018152 3300036401 Bacteria 6276
182 Ga0395899_0007467 3300037312 Bacteria 8444
183 Ga0395900_0070717 3300037418 Bacteria 3587
184 Ga0395900_0154957 3300037418 Bacteria 2340
185 Ga0395900_1404976 3300037418 Bacteria 611
186 Ga0395898_0091305 3300037466 Bacteria 2930
187 Ga0395898_0451345 3300037466 Unclassified 1224
188 Ga0395905_0007613 3300037471 Bacteria 10753
189 Ga0395905_0232208 3300037471 Bacteria 1725
190 Ga0395901_0132115 3300038443 Bacteria 2623
191 Ga0395901_0380158 3300038443 Bacteria 1453
192 Ga0395901_0832472 3300038443 Bacteria 909
193 Ga0436365_1226420 3300039437 Bacteria 1062
194 Ga0451577_0905696 3300042876 Bacteria 794
195 Ga0466969_0107911 3300044656 Bacteria 1305
196 Ga0466972_0043783 3300044658 Bacteria 2173
197 Ga0466965_0116633 3300044683 Bacteria 1376
198 Ga0466965_0146252 3300044683 Unclassified 1233
199 Ga0466966_0034481 3300044684 Bacteria 3271
200 Ga0466966_0968078 3300044684 Bacteria 513
201 Ga0466961_0007214 3300044693 Bacteria 7068
202 Ga0466961_0059877 3300044693 Bacteria 2421
203 Ga0466961_0108712 3300044693 Bacteria 1745
204 Ga0466963_0001549 3300044694 Bacteria 12465
205 Ga0466963_0005303 3300044694 Bacteria 7534
206 Ga0466963_0007626 3300044694 Bacteria 6458
207 Ga0466963_0046371 3300044694 Bacteria 2865
208 Ga0466963_0338943 3300044694 Bacteria 1058
209 Ga0466963_0362939 3300044694 Bacteria 1020
210 Ga0466964_0002432 3300044706 Bacteria 6617
211 Ga0466964_0012595 3300044706 Bacteria 3202
212 Ga0466964_0163079 3300044706 Bacteria 1043
213 Ga0466964_0344110 3300044706 Bacteria 764
214 Ga0466971_0000267 3300044719 Bacteria 20039
215 Ga0466971_0011188 3300044719 Bacteria 3931
216 Ga0466971_0235195 3300044719 Bacteria 870
217 Ga0466971_0241894 3300044719 Bacteria 858
218 Ga0466968_0032809 3300044735 Bacteria 2161
219 Ga0466968_0048205 3300044735 Bacteria 1813
220 Ga0466968_0056484 3300044735 Bacteria 1686
221 Ga0466968_0373787 3300044735 Unclassified 695
222 Ga0466970_0027315 3300044765 Bacteria 2995
223 Ga0466970_0135749 3300044765 Bacteria 1353
224 Ga0466957_0005308 3300044842 Bacteria 7224
225 Ga0466957_0010837 3300044842 Bacteria 5242
226 Ga0466957_0011140 3300044842 Bacteria 5178
227 Ga0466957_0031662 3300044842 Bacteria 3162
228 Ga0466957_0087550 3300044842 Bacteria 1947
229 Ga0466960_0000888 3300044901 Bacteria 10564
230 Ga0466960_0038132 3300044901 Bacteria 2258
231 Ga0466959_0006646 3300045049 Bacteria 8035
232 Ga0466959_0012465 3300045049 Bacteria 6143
233 Ga0466959_0019728 3300045049 Bacteria 4959
234 Ga0466959_0320596 3300045049 Bacteria 1059
235 Ga0466958_0004973 3300045836 Bacteria 7092
236 Ga0466958_0006470 3300045836 Bacteria 6376
237 Ga0466958_0016879 3300045836 Bacteria 4213
238 Ga0466958_0044604 3300045836 Bacteria 2672
239 Ga0466958_0085858 3300045836 Bacteria 1941
240 Ga0466958_0271285 3300045836 Bacteria 1086
241 Ga0466967_0009870 3300045976 Bacteria 7119
242 Ga0466967_0016444 3300045976 Bacteria 5834
243 Ga0466967_0016814 3300045976 Bacteria 5782
244 Ga0466967_0027643 3300045976 Bacteria 4721
245 Ga0466967_0049320 3300045976 Bacteria 3681
246 Ga0466967_0075520 3300045976 Bacteria 3029
247 Ga0466967_0211969 3300045976 Bacteria 1837
248 Ga0466967_0528817 3300045976 Bacteria 1159
249 Ga0466967_0545026 3300045976 Bacteria 1142
250 Ga0466967_0585457 3300045976 Bacteria 1100
251 Ga0466967_0631215 3300045976 Unclassified 1059
252 Ga0466967_0651361 3300045976 Bacteria 1041
253 Ga0495592_0224622 3300046454 Bacteria 1253
254 Ga0495629_0405450 3300046459 Unclassified 926
255 Ga0495641_0061165 3300046461 Bacteria 1700
256 Ga0495653_0019105 3300046463 Bacteria 5560
257 Ga0495653_0118322 3300046463 Bacteria 1892
258 Ga0495653_0371965 3300046463 Bacteria 914
259 Ga0495662_0050779 3300046476 Bacteria 2002
260 Ga0495664_0645335 3300046477 Bacteria 627
261 Ga0495608_0188602 3300046511 Bacteria 1302
262 Ga0495618_0117264 3300046514 Bacteria 1704
263 Ga0495618_0151298 3300046514 Unclassified 1482
264 Ga0495628_0083257 3300046516 Bacteria 2484
265 Ga0495630_0371698 3300046517 Bacteria 1095
266 Ga0495630_0483319 3300046517 Bacteria 949
267 Ga0495640_0558562 3300046533 Bacteria 693
268 Ga0495586_0037743 3300046535 Unclassified 2594
269 Ga0495645_0531240 3300046543 Bacteria 731
270 Ga0495667_0142038 3300046559 Bacteria 1547
271 Ga0495634_0557749 3300046642 Bacteria 667
272 Ga0495635_0118278 3300046663 Bacteria 1808
273 Ga0495635_0257926 3300046663 Bacteria 1174
274 Ga0495657_0162952 3300046675 Bacteria 1379
275 Ga0495599_0400291 3300046678 Bacteria 818
276 Ga0495658_0417231 3300046683 Bacteria 856
277 Ga0495624_0026730 3300046690 Bacteria 3781
278 Ga0495624_0028612 3300046690 Bacteria 3640
279 Ga0495624_0734179 3300046690 Bacteria 585
280 Ga0495624_0825766 3300046690 Unclassified 547
281 Ga0495589_0455717 3300046794 Bacteria 585
282 Ga0495600_0192729 3300046809 Bacteria 1310
283 Ga0495600_0718096 3300046809 Unclassified 600
284 Ga0495676_0187887 3300047321 Bacteria 1443
285 Ga0495684_0530546 3300047471 Bacteria 804
286 Ga0495602_0638528 3300048088 Bacteria 728
287 Ga0496100_0098205 3300048903 Bacteria 2012
288 Ga0496100_1194857 3300048903 Unclassified 600
289 Ga0496101_0054390 3300048904 Bacteria 2890
290 Ga0496101_0065315 3300048904 Bacteria 2652
291 Ga0496101_0143191 3300048904 Bacteria 1824
292 Ga0496102_0116420 3300048905 Bacteria 2494
293 Ga0496102_0421850 3300048905 Bacteria 1253
294 Ga0496102_0596785 3300048905 Bacteria 1027
295 Ga0496103_0374839 3300048906 Bacteria 914
296 Ga0496104_0595812 3300048907 Bacteria 1015
297 Ga0496104_0680081 3300048907 Bacteria 937
298 Ga0496105_0195692 3300048908 Bacteria 1652
299 Ga0496105_0288523 3300048908 Bacteria 1321
300 Ga0496105_0891675 3300048908 Bacteria 671
301 Ga0496106_0027056 3300048909 Bacteria 4270
302 Ga0496106_0272698 3300048909 Bacteria 1355
303 Ga0496106_0489090 3300048909 Bacteria 988
304 Ga0496107_0003518 3300048910 Bacteria 10486
305 Ga0496107_0114124 3300048910 Bacteria 1987
306 Ga0496107_0391158 3300048910 Unclassified 1034
307 Ga0496107_1014318 3300048910 Bacteria 602
308 Ga0496108_0100081 3300048911 Bacteria 2472
309 Ga0496108_0131409 3300048911 Bacteria 2152
310 Ga0496108_1160238 3300048911 Bacteria 654
311 Ga0496109_0040142 3300048912 Bacteria 4238
312 Ga0496109_0075892 3300048912 Bacteria 3090
313 Ga0496109_0177722 3300048912 Bacteria 1998
314 Ga0496109_0348819 3300048912 Unclassified 1398
315 Ga0496109_0376774 3300048912 Bacteria 1340
316 Ga0496109_0433570 3300048912 Bacteria 1241
317 Ga0496109_2013782 3300048912 Bacteria 509
318 Ga0496110_0055882 3300048913 Bacteria 3474
319 Ga0496110_0164358 3300048913 Bacteria 2012
320 Ga0496110_0581019 3300048913 Bacteria 1017
321 Ga0496111_0075779 3300048914 Bacteria 2451
322 Ga0496111_0496508 3300048914 Bacteria 898
323 Ga0496112_0020478 3300048915 Bacteria 6272
324 Ga0496112_0025505 3300048915 Bacteria 5676
325 Ga0496112_0099919 3300048915 Bacteria 2871
326 Ga0496112_0239478 3300048915 Bacteria 1767
327 Ga0496112_0334559 3300048915 Bacteria 1458
328 Ga0496112_0470753 3300048915 Bacteria 1194
329 Ga0496112_0783678 3300048915 Bacteria 878
330 Ga0496113_0046317 3300048916 Bacteria 3228
331 Ga0496113_0097853 3300048916 Bacteria 2270
332 Ga0496113_0361932 3300048916 Bacteria 1164
333 Ga0496114_1766794 3300048917 Bacteria 506
334 Ga0496115_0029386 3300048918 Bacteria 4317
335 Ga0501067_0021598 3300049583 Bacteria 3562
336 Ga0501067_0040052 3300049583 Bacteria 2603
337 Ga0501069_0011496 3300049585 Bacteria 4690
338 Ga0501070_0792031 3300049586 Bacteria 745
339 Ga0495601_0485925 3300053077 Bacteria 797
340 Ga0495619_0220262 3300053085 Bacteria 1314
341 Ga0466962_0009636 3300061719 Bacteria 4632
342 Ga0466962_0030241 3300061719 Bacteria 2593
343 Ga0466962_0040753 3300061719 Bacteria 2222
344 Ga0466962_0042365 3300061719 Bacteria 2179
345 Ga0466962_0125849 3300061719 Bacteria 1237
346 Ga0466969_0020917
347 rootL2_10230216
348 rootH1_10133855
349 Ga0070658_10299348
350 Ga0070658_11898862
351 Ga0070683_100112907
352 Ga0070683_101090570
353 Ga0070680_100103880
354 Ga0070680_100205654
355 Ga0070680_100550264
356 Ga0070682_100126958
357 Ga0070682_100132687
358 Ga0070682_101871917
359 Ga0070660_100042589
360 Ga0070660_101656953
361 Ga0070661_100358305
362 Ga0070692_10472954
363 Ga0070675_100660763
364 Ga0070659_100775640
365 Ga0070703_10124241
366 Ga0070709_10044997
367 Ga0070714_100231698
368 Ga0070714_100274125
369 Ga0070713_100010195
370 Ga0070713_100013273
371 Ga0070713_101135133
372 Ga0070710_10102401
373 Ga0070701_10963169
374 Ga0070711_100116058
375 Ga0070711_100579511
376 Ga0070694_100663354
377 Ga0070663_100524234
378 Ga0070678_101291004
379 Ga0070662_101800131
380 Ga0070681_10017999
381 Ga0070681_10079251
382 Ga0070681_10106825
383 Ga0070681_10516505
384 Ga0070685_11380335
385 Ga0070706_100697187
386 Ga0070707_100001421
387 Ga0070699_100987104
388 Ga0070679_100114231
389 Ga0070679_100165684
390 Ga0070679_100176826
391 Ga0070679_100186808
392 Ga0070679_100271189
393 Ga0070679_100394746
394 Ga0070684_100025614
395 Ga0070684_100136435
396 Ga0070684_100211179
397 Ga0070684_101639277
398 Ga0068853_101476092
399 Ga0070693_100864575
400 Ga0070704_100162825
401 Ga0070704_101281867
402 Ga0070664_100238149
403 Ga0068856_100198860
404 Ga0068856_100442161
405 Ga0070702_100046131
406 Ga0068852_100512769
407 Ga0068866_11144014
408 Ga0068863_100079253
409 Ga0070717_10051448
410 Ga0070717_10166695
411 Ga0070717_10863700
412 Ga0070715_10000828
413 Ga0070712_100013170
414 Ga0070712_101041218
415 Ga0070712_101433706
416 Ga0097621_100542124
417 Ga0097621_100725146
418 Ga0075433_10696139
419 Ga0075433_11000610
420 Ga0075434_100022564
421 Ga0075434_102080827
422 Ga0075436_100507190
423 Ga0075435_100382128
424 Ga0105251_10102122
425 Ga0105240_11506748
426 Ga0111539_10749532
427 Ga0105245_10256569
428 Ga0105245_10566002
429 Ga0105245_10679895
430 Ga0105242_10266446
431 Ga0105242_10289298
432 Ga0105248_10235886
433 Ga0105248_10528772
434 Ga0105238_10919212
435 Ga0105238_11294966
436 Ga0105246_10150956
437 Ga0157373_10868037
438 Ga0157371_11195923
439 Ga0157369_10005241
440 Ga0157369_11231196
441 Ga0157369_11506002
442 Ga0157374_10103876
443 Ga0157374_10766700
444 Ga0163162_10187624
445 Ga0157372_10718234
446 Ga0157372_11180357
447 Ga0157372_11611376
448 Ga0157372_11975464
449 Ga0157372_12803502
450 Ga0157379_10221953
451 Ga0157376_10014759
452 Ga0182007_10091775
453 Ga0206356_11455896
454 Ga0206356_11645465
455 Ga0206353_10449184
456 Ga0207656_10580184
457 Ga0207653_10078241
458 Ga0207692_10049327
459 Ga0207642_10852648
460 Ga0207685_10120566
461 Ga0207699_10163333
462 Ga0207699_10197963
463 Ga0207699_10701309
464 Ga0207705_10193064
465 Ga0207705_10308381
466 Ga0207707_10072456
467 Ga0207707_10370109
468 Ga0207707_10419121
469 Ga0207707_10910956
470 Ga0207693_10017266
471 Ga0207693_10883076
472 Ga0207663_10144271
473 Ga0207660_10111356
474 Ga0207660_10770968
475 Ga0207660_11292115
476 Ga0207657_10001172
477 Ga0207657_10053148
478 Ga0207649_10291883
479 Ga0207649_10748341
480 Ga0207652_10190741
481 Ga0207652_10259717
482 Ga0207652_10474935
483 Ga0207652_10707865
484 Ga0207652_10886334
485 Ga0207646_10003417
486 Ga0207694_10587144
487 Ga0207700_10031832
488 Ga0207700_10165990
489 Ga0207700_10233506
490 Ga0207664_10040444
491 Ga0207664_10159095
492 Ga0207664_10217388
493 Ga0207664_10383954
494 Ga0207690_11017798
495 Ga0207706_10801632
496 Ga0207686_10165729
497 Ga0207709_10155238
498 Ga0207665_10059925
499 Ga0207665_11296507
500 Ga0207711_10112113
501 Ga0207711_10835996
502 Ga0207661_10004287
503 Ga0207661_10592831
504 Ga0207667_10273864
505 Ga0207677_10712485
506 Ga0207678_10669074
507 Ga0207702_10305292
508 Ga0207702_10338365
509 Ga0207702_10633733
510 Ga0207702_11773744
511 Ga0207641_10135405
512 Ga0207676_10625355
513 Ga0207674_12181861
514 Ga0207683_11145311
515 Ga0207698_11176726
516 Ga0265323_10085129
517 Ga0265327_10007600
518 Ga0265342_10622762
519 Ga0373951_0070712
520 Ga0373954_0427120
521 Ga0373960_0235452
522 Ga0373943_0405827
523 Ga0373962_0275275
524 Ga0373931_0034373
525 Ga0373947_0229788
526 Ga0373937_0018152
527 Ga0395899_0007467
528 Ga0395900_0070717
529 Ga0395900_0154957
530 Ga0395900_1404976
531 Ga0395898_0091305
532 Ga0395898_0451345
533 Ga0395905_0007613
534 Ga0395905_0232208
535 Ga0395901_0132115
536 Ga0395901_0380158
537 Ga0395901_0832472
538 Ga0436365_1226420
539 Ga0451577_0905696
540 Ga0466969_0107911
541 Ga0466972_0043783
542 Ga0466965_0116633
543 Ga0466965_0146252
544 Ga0466966_0034481
545 Ga0466966_0968078
546 Ga0466961_0007214
547 Ga0466961_0059877
548 Ga0466961_0108712
549 Ga0466963_0001549
550 Ga0466963_0005303
551 Ga0466963_0007626
552 Ga0466963_0046371
553 Ga0466963_0338943
554 Ga0466963_0362939
555 Ga0466964_0002432
556 Ga0466964_0012595
557 Ga0466964_0163079
558 Ga0466964_0344110
559 Ga0466971_0000267
560 Ga0466971_0011188
561 Ga0466971_0235195
562 Ga0466971_0241894
563 Ga0466968_0032809
564 Ga0466968_0048205
565 Ga0466968_0056484
566 Ga0466968_0373787
567 Ga0466970_0027315
568 Ga0466970_0135749
569 Ga0466957_0005308
570 Ga0466957_0010837
571 Ga0466957_0011140
572 Ga0466957_0031662
573 Ga0466957_0087550
574 Ga0466960_0000888
575 Ga0466960_0038132
576 Ga0466959_0006646
577 Ga0466959_0012465
578 Ga0466959_0019728
579 Ga0466959_0320596
580 Ga0466958_0004973
581 Ga0466958_0006470
582 Ga0466958_0016879
583 Ga0466958_0044604
584 Ga0466958_0085858
585 Ga0466958_0271285
586 Ga0466967_0009870
587 Ga0466967_0016444
588 Ga0466967_0016814
589 Ga0466967_0027643
590 Ga0466967_0049320
591 Ga0466967_0075520
592 Ga0466967_0211969
593 Ga0466967_0528817
594 Ga0466967_0545026
595 Ga0466967_0585457
596 Ga0466967_0631215
597 Ga0466967_0651361
598 Ga0495592_0224622
599 Ga0495629_0405450
600 Ga0495641_0061165
601 Ga0495653_0019105
602 Ga0495653_0118322
603 Ga0495653_0371965
604 Ga0495662_0050779
605 Ga0495664_0645335
606 Ga0495608_0188602
607 Ga0495618_0117264
608 Ga0495618_0151298
609 Ga0495628_0083257
610 Ga0495630_0371698
611 Ga0495630_0483319
612 Ga0495640_0558562
613 Ga0495586_0037743
614 Ga0495645_0531240
615 Ga0495667_0142038
616 Ga0495634_0557749
617 Ga0495635_0118278
618 Ga0495635_0257926
619 Ga0495657_0162952
620 Ga0495599_0400291
621 Ga0495658_0417231
622 Ga0495624_0026730
623 Ga0495624_0028612
624 Ga0495624_0734179
625 Ga0495624_0825766
626 Ga0495589_0455717
627 Ga0495600_0192729
628 Ga0495600_0718096
629 Ga0495676_0187887
630 Ga0495684_0530546
631 Ga0495602_0638528
632 Ga0496100_0098205
633 Ga0496100_1194857
634 Ga0496101_0054390
635 Ga0496101_0065315
636 Ga0496101_0143191
637 Ga0496102_0116420
638 Ga0496102_0421850
639 Ga0496102_0596785
640 Ga0496103_0374839
641 Ga0496104_0595812
642 Ga0496104_0680081
643 Ga0496105_0195692
644 Ga0496105_0288523
645 Ga0496105_0891675
646 Ga0496106_0027056
647 Ga0496106_0272698
648 Ga0496106_0489090
649 Ga0496107_0003518
650 Ga0496107_0114124
651 Ga0496107_0391158
652 Ga0496107_1014318
653 Ga0496108_0100081
654 Ga0496108_0131409
655 Ga0496108_1160238
656 Ga0496109_0040142
657 Ga0496109_0075892
658 Ga0496109_0177722
659 Ga0496109_0348819
660 Ga0496109_0376774
661 Ga0496109_0433570
662 Ga0496109_2013782
663 Ga0496110_0055882
664 Ga0496110_0164358
665 Ga0496110_0581019
666 Ga0496111_0075779
667 Ga0496111_0496508
668 Ga0496112_0020478
669 Ga0496112_0025505
670 Ga0496112_0099919
671 Ga0496112_0239478
672 Ga0496112_0334559
673 Ga0496112_0470753
674 Ga0496112_0783678
675 Ga0496113_0046317
676 Ga0496113_0097853
677 Ga0496113_0361932
678 Ga0496114_1766794
679 Ga0496115_0029386
680 Ga0501067_0021598
681 Ga0501067_0040052
682 Ga0501069_0011496
683 Ga0501070_0792031
684 Ga0495601_0485925
685 Ga0495619_0220262
686 Ga0466962_0009636
687 Ga0466962_0030241
688 Ga0466962_0040753
689 Ga0466962_0042365
690 Ga0466962_0125849

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02021

UPF0102

Uncharacterised protein family UPF0102

18

109

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.9159 3 108
3fov-assembly1.cif.gz_A crystal structure of protein rpa0323 of unknown function from rhodopseudomonas palustris 0.8817 3 108
1ob8-assembly1.cif.gz_A holliday junction resolving enzyme 0.7012 3 104
2eo0-assembly2.cif.gz_B crystal structure of holliday junction resolvase st1444 0.6917 2 104
2wcz-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.6764 6 104
ID Description Score Start End Superfamily
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9157 3 108 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.9114 5 108 3.40.1350.10
3fovA00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8811 3 108 3.40.1350.10
af_P45465_23_131_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8719 5 108 3.40.1350.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.8702 4 104 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A538JMB1-F1-model_v4 UPF0102 protein E6G08_01665 0.9886 4 107 GO:0003676
AF-A0A537WAC4-F1-model_v4 UPF0102 protein E6G64_13375 0.9832 2 107 GO:0003676
AF-A0A6I3BRU2-F1-model_v4 UPF0102 protein F2663_03715 0.9769 2 104 GO:0003676
AF-A0A7V9P3L5-F1-model_v4 UPF0102 protein H0U90_01675 0.9689 4 104 GO:0003676
AF-A0A660U6V2-F1-model_v4 UPF0102 protein DRP54_04810 0.9683 3 107 GO:0003676

Map