F416454

General Info

Members Datasets Scaffolds Average Seq Length
345 206 690 186

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0203550|Ga0436364_0203550_11_658
Length 215
Sequence VAAPANLQIALSAGNEEVRTLDLITGVIAMNGKRMPTIATLXXXLTVAGSWAISAQDKYTLKVPNGLAFSEFRGYEAWQFVSISQDTNLNLMSATLANPVAIQAYLAGVPSNGKPFPDGSKLAKIHWNPDKIEGFPAKTVPGTQHDVDFIVKDSKRFADSGGWGWAMFEYDAQSDTFRPGNSADKPPQGNDAKCGFACHTRAKTRDYVFTDYRHR

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
155 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
203 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
204 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
205 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
206 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.45
Nodule 0
Rhizoplane 2.61
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 4.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0203550 3300037853 Bacteria 917
2 Ga0065704_10088299 3300005289 Bacteria 2951
3 Ga0065712_10108968 3300005290 Bacteria 1863
4 Ga0065712_10163259 3300005290 Bacteria 1288
5 Ga0065712_10226252 3300005290 Bacteria 965
6 Ga0065715_10104036 3300005293 Bacteria 2990
7 Ga0065715_10130304 3300005293 Bacteria 2029
8 Ga0070676_10193296 3300005328 Bacteria 1330
9 Ga0070683_100992612 3300005329 Bacteria 806
10 Ga0070690_100077940 3300005330 Bacteria 2164
11 Ga0070670_100553060 3300005331 Bacteria 1027
12 Ga0068869_100052324 3300005334 Bacteria 2965
13 Ga0070666_10022629 3300005335 Bacteria 4083
14 Ga0070666_10252134 3300005335 Bacteria 1250
15 Ga0070666_10857856 3300005335 Bacteria 670
16 Ga0068868_100132364 3300005338 Bacteria 2042
17 Ga0070689_100106931 3300005340 Bacteria 2221
18 Ga0070691_10116147 3300005341 Bacteria 1343
19 Ga0070691_10623611 3300005341 Bacteria 639
20 Ga0070661_100216673 3300005344 Bacteria 1467
21 Ga0070669_100007282 3300005353 Bacteria 7936
22 Ga0070669_100139340 3300005353 Bacteria 1869
23 Ga0070669_100476842 3300005353 Bacteria 1032
24 Ga0070675_100586044 3300005354 Bacteria 1011
25 Ga0070671_100580595 3300005355 Bacteria 968
26 Ga0070674_100271627 3300005356 Bacteria 1340
27 Ga0070674_100309788 3300005356 Bacteria 1262
28 Ga0070673_100116715 3300005364 Bacteria 2221
29 Ga0070673_100596131 3300005364 Bacteria 1007
30 Ga0070688_100060933 3300005365 Bacteria 2384
31 Ga0070667_100034125 3300005367 Bacteria 4255
32 Ga0070705_100147912 3300005440 Bacteria 1555
33 Ga0070700_100090520 3300005441 Bacteria 1995
34 Ga0070700_100408206 3300005441 Unclassified 1023
35 Ga0070700_100710175 3300005441 Bacteria 800
36 Ga0070694_100003149 3300005444 Bacteria 9827
37 Ga0070694_100069985 3300005444 Bacteria 2415
38 Ga0070708_100425300 3300005445 Bacteria 1253
39 Ga0070663_100062491 3300005455 Bacteria 2685
40 Ga0070678_100057230 3300005456 Bacteria 2855
41 Ga0070678_100067462 3300005456 Bacteria 2663
42 Ga0068867_100050472 3300005459 Bacteria 3066
43 Ga0070685_10005388 3300005466 Bacteria 6480
44 Ga0070706_100704261 3300005467 Bacteria 936
45 Ga0070707_100003051 3300005468 Bacteria 15871
46 Ga0070707_100088288 3300005468 Bacteria 2999
47 Ga0070698_100919920 3300005471 Bacteria 820
48 Ga0070699_100574857 3300005518 Bacteria 1027
49 Ga0070697_100207384 3300005536 Bacteria 1667
50 Ga0070697_100767109 3300005536 Bacteria 852
51 Ga0070672_100135977 3300005543 Bacteria 2024
52 Ga0070686_100060935 3300005544 Bacteria 2436
53 Ga0070686_100483675 3300005544 Bacteria 958
54 Ga0070695_100007204 3300005545 Bacteria 6594
55 Ga0070695_100732450 3300005545 Bacteria 787
56 Ga0070696_100066056 3300005546 Bacteria 2536
57 Ga0070665_100087967 3300005548 Bacteria 3113
58 Ga0070665_100617780 3300005548 Bacteria 1097
59 Ga0070704_100033306 3300005549 Bacteria 3482
60 Ga0070664_100000914 3300005564 Bacteria 23012
61 Ga0070664_100255125 3300005564 Bacteria 1577
62 Ga0068854_101057884 3300005578 Bacteria 721
63 Ga0070702_100952998 3300005615 Bacteria 676
64 Ga0068852_100671122 3300005616 Bacteria 1045
65 Ga0068859_100045181 3300005617 Bacteria 4426
66 Ga0068864_100058781 3300005618 Bacteria 3324
67 Ga0068864_100068111 3300005618 Bacteria 3092
68 Ga0068866_10063372 3300005718 Bacteria 1927
69 Ga0068866_10138810 3300005718 Bacteria 1393
70 Ga0068866_10291787 3300005718 Bacteria 1015
71 Ga0068861_100729049 3300005719 Bacteria 924
72 Ga0068851_10062405 3300005834 Bacteria 1912
73 Ga0068851_10393519 3300005834 Unclassified 814
74 Ga0068870_10002586 3300005840 Bacteria 7572
75 Ga0068870_10454156 3300005840 Bacteria 845
76 Ga0068863_100035499 3300005841 Bacteria 4749
77 Ga0068858_100017565 3300005842 Bacteria 6709
78 Ga0068858_100083555 3300005842 Bacteria 2969
79 Ga0068858_100099469 3300005842 Bacteria 2712
80 Ga0068858_100231489 3300005842 Bacteria 1752
81 Ga0068858_100363715 3300005842 Bacteria 1387
82 Ga0068858_100404963 3300005842 Bacteria 1311
83 Ga0068860_100036113 3300005843 Bacteria 4737
84 Ga0068860_100449232 3300005843 Bacteria 1281
85 Ga0068862_100317449 3300005844 Bacteria 1437
86 Ga0068862_100898178 3300005844 Bacteria 871
87 Ga0081540_1017587 3300005983 Bacteria 4419
88 Ga0070712_100679010 3300006175 Bacteria 877
89 Ga0075367_10071713 3300006178 Bacteria 2084
90 Ga0097621_100064178 3300006237 Bacteria 3019
91 Ga0097621_100353936 3300006237 Bacteria 1306
92 Ga0097621_100665916 3300006237 Bacteria 956
93 Ga0068871_100091205 3300006358 Bacteria 2539
94 Ga0068871_100289165 3300006358 Bacteria 1436
95 Ga0068871_100596100 3300006358 Bacteria 1004
96 Ga0068871_100819349 3300006358 Bacteria 859
97 Ga0075428_100011520 3300006844 Bacteria 9836
98 Ga0075428_100283074 3300006844 Bacteria 1784
99 Ga0075430_100009319 3300006846 Bacteria 8298
100 Ga0075430_100180138 3300006846 Bacteria 1758
101 Ga0075431_100003661 3300006847 Bacteria 14912
102 Ga0075431_100698816 3300006847 Bacteria 992
103 Ga0075433_10027041 3300006852 Bacteria 4864
104 Ga0075433_10046628 3300006852 Bacteria 3770
105 Ga0075433_10113597 3300006852 Bacteria 2403
106 Ga0075434_100008260 3300006871 Bacteria 9669
107 Ga0075434_100016177 3300006871 Bacteria 7169
108 Ga0075434_100017172 3300006871 Bacteria 6967
109 Ga0075434_100041664 3300006871 Bacteria 4549
110 Ga0075434_100150257 3300006871 Bacteria 2349
111 Ga0075434_100201697 3300006871 Bacteria 2009
112 Ga0075436_100013956 3300006914 Bacteria 5498
113 Ga0075436_100701059 3300006914 Bacteria 750
114 Ga0097620_100045183 3300006931 Bacteria 4426
115 Ga0075435_100001867 3300007076 Bacteria 13698
116 Ga0105240_10368915 3300009093 Bacteria 1624
117 Ga0111539_10189576 3300009094 Bacteria 2399
118 Ga0111539_11058767 3300009094 Bacteria 943
119 Ga0105245_10382962 3300009098 Bacteria 1401
120 Ga0105245_10538618 3300009098 Unclassified 1188
121 Ga0105247_10379580 3300009101 Bacteria 1002
122 Ga0114129_10010795 3300009147 Bacteria 13011
123 Ga0114129_10080881 3300009147 Bacteria 4516
124 Ga0105243_10110598 3300009148 Bacteria 2298
125 Ga0105241_11060557 3300009174 Bacteria 761
126 Ga0105242_10099173 3300009176 Bacteria 2465
127 Ga0105242_10219759 3300009176 Bacteria 1697
128 Ga0105242_11123106 3300009176 Bacteria 801
129 Ga0105248_10007193 3300009177 Bacteria 12211
130 Ga0105248_10021148 3300009177 Bacteria 7209
131 Ga0105248_10030021 3300009177 Bacteria 6067
132 Ga0105248_10037435 3300009177 Bacteria 5428
133 Ga0105248_10077546 3300009177 Bacteria 3735
134 Ga0105237_10498814 3300009545 Bacteria 1224
135 Ga0105238_10106242 3300009551 Bacteria 2789
136 Ga0105238_10157432 3300009551 Bacteria 2247
137 Ga0105249_10002976 3300009553 Bacteria 14611
138 Ga0105249_10003029 3300009553 Bacteria 14496
139 Ga0105249_10055331 3300009553 Bacteria 3629
140 Ga0105249_10154423 3300009553 Bacteria 2212
141 Ga0105249_10246960 3300009553 Bacteria 1767
142 Ga0105249_11159542 3300009553 Bacteria 843
143 Ga0105239_10766088 3300010375 Bacteria 1105
144 Ga0105239_10845059 3300010375 Bacteria 1050
145 Ga0105239_11666325 3300010375 Bacteria 738
146 Ga0105239_12360428 3300010375 Bacteria 619
147 Ga0105246_10043598 3300011119 Bacteria 3044
148 Ga0105246_10089632 3300011119 Unclassified 2213
149 Ga0105246_11095665 3300011119 Bacteria 727
150 Ga0157370_10737752 3300013104 Unclassified 898
151 Ga0157374_10596584 3300013296 Bacteria 1114
152 Ga0157378_10045029 3300013297 Bacteria 3920
153 Ga0157378_11229779 3300013297 Bacteria 789
154 Ga0163162_10019656 3300013306 Bacteria 6631
155 Ga0163162_10053797 3300013306 Bacteria 4046
156 Ga0163162_10622888 3300013306 Bacteria 1204
157 Ga0163162_10671078 3300013306 Bacteria 1159
158 Ga0157372_10078950 3300013307 Bacteria 3720
159 Ga0157375_10005456 3300013308 Bacteria 11059
160 Ga0157375_10270185 3300013308 Bacteria 1862
161 Ga0157375_10385776 3300013308 Bacteria 1568
162 Ga0157375_10728409 3300013308 Bacteria 1144
163 Ga0157375_11354999 3300013308 Bacteria 837
164 Ga0163163_10284388 3300014325 Unclassified 1706
165 Ga0163163_11247535 3300014325 Bacteria 806
166 Ga0157380_10009619 3300014326 Bacteria 6933
167 Ga0157380_10210030 3300014326 Bacteria 1734
168 Ga0157380_10641467 3300014326 Bacteria 1058
169 Ga0157377_10118927 3300014745 Bacteria 1598
170 Ga0157377_10294293 3300014745 Bacteria 1069
171 Ga0157379_10022094 3300014968 Bacteria 5639
172 Ga0157379_10271430 3300014968 Unclassified 1542
173 Ga0157379_10388908 3300014968 Bacteria 1281
174 Ga0157376_10067903 3300014969 Unclassified 3017
175 Ga0163161_10420798 3300017792 Bacteria 1075
176 Ga0163161_10736161 3300017792 Bacteria 824
177 Ga0163161_10749966 3300017792 Bacteria 817
178 Ga0213876_10116744 3300021384 Bacteria 1416
179 Ga0207697_10001608 3300025315 Bacteria 12201
180 Ga0207682_10010095 3300025893 Bacteria 3707
181 Ga0207642_10032945 3300025899 Bacteria 2187
182 Ga0207642_10528828 3300025899 Bacteria 725
183 Ga0207688_10004636 3300025901 Bacteria 7489
184 Ga0207680_10275390 3300025903 Bacteria 1168
185 Ga0207643_10000692 3300025908 Bacteria 21034
186 Ga0207662_10143965 3300025918 Bacteria 1511
187 Ga0207646_10015125 3300025922 Bacteria 7302
188 Ga0207681_10064500 3300025923 Bacteria 2529
189 Ga0207681_10109855 3300025923 Bacteria 2004
190 Ga0207681_10276169 3300025923 Bacteria 1321
191 Ga0207694_10043847 3300025924 Bacteria 3452
192 Ga0207659_10172196 3300025926 Bacteria 1708
193 Ga0207659_10201655 3300025926 Bacteria 1589
194 Ga0207687_10002081 3300025927 Bacteria 13680
195 Ga0207644_10425603 3300025931 Bacteria 1088
196 Ga0207690_10223017 3300025932 Bacteria 1443
197 Ga0207706_10004290 3300025933 Bacteria 13403
198 Ga0207686_10121851 3300025934 Bacteria 1776
199 Ga0207709_10418163 3300025935 Bacteria 1029
200 Ga0207670_10019616 3300025936 Bacteria 4134
201 Ga0207670_10085983 3300025936 Bacteria 2211
202 Ga0207669_11037128 3300025937 Bacteria 690
203 Ga0207691_10003296 3300025940 Bacteria 15735
204 Ga0207711_10000564 3300025941 Bacteria 37778
205 Ga0207711_10032236 3300025941 Bacteria 4430
206 Ga0207711_10065843 3300025941 Bacteria 3133
207 Ga0207711_10270013 3300025941 Bacteria 1565
208 Ga0207689_10070594 3300025942 Bacteria 2869
209 Ga0207689_10365962 3300025942 Bacteria 1199
210 Ga0207679_10046368 3300025945 Bacteria 3150
211 Ga0207651_10039295 3300025960 Bacteria 3119
212 Ga0207712_10002221 3300025961 Bacteria 12632
213 Ga0207712_10185658 3300025961 Bacteria 1637
214 Ga0207640_10061932 3300025981 Bacteria 2480
215 Ga0207640_10680530 3300025981 Bacteria 880
216 Ga0207658_10069131 3300025986 Bacteria 2667
217 Ga0207677_10325250 3300026023 Bacteria 1279
218 Ga0207703_10038565 3300026035 Bacteria 3814
219 Ga0207703_10083728 3300026035 Bacteria 2666
220 Ga0207703_10113809 3300026035 Bacteria 2313
221 Ga0207703_10647203 3300026035 Bacteria 1002
222 Ga0207708_10018001 3300026075 Bacteria 5316
223 Ga0207708_10175972 3300026075 Bacteria 1697
224 Ga0207708_10363218 3300026075 Bacteria 1190
225 Ga0207708_10522942 3300026075 Bacteria 997
226 Ga0207641_10097545 3300026088 Bacteria 2583
227 Ga0207641_10484380 3300026088 Bacteria 1199
228 Ga0207648_10029621 3300026089 Bacteria 4854
229 Ga0207648_10056648 3300026089 Bacteria 3420
230 Ga0207648_10546255 3300026089 Bacteria 1064
231 Ga0207648_10598477 3300026089 Bacteria 1016
232 Ga0207676_10026154 3300026095 Bacteria 4338
233 Ga0207676_10196378 3300026095 Unclassified 1780
234 Ga0207676_10248009 3300026095 Bacteria 1601
235 Ga0207675_100012355 3300026118 Bacteria 7977
236 Ga0207675_100282592 3300026118 Bacteria 1613
237 Ga0207683_10119069 3300026121 Bacteria 2369
238 Ga0207428_10111972 3300027907 Bacteria 2100
239 Ga0268266_10244851 3300028379 Bacteria 1656
240 Ga0268266_11053005 3300028379 Bacteria 787
241 Ga0268265_10289323 3300028380 Bacteria 1470
242 Ga0268265_10886188 3300028380 Bacteria 875
243 Ga0268265_11039344 3300028380 Bacteria 811
244 Ga0268264_10053457 3300028381 Bacteria 3369
245 Ga0268264_10257695 3300028381 Bacteria 1623
246 Ga0265320_10022925 3300031240 Bacteria 3333
247 Ga0265329_10025042 3300031242 Bacteria 1978
248 Ga0265331_10052765 3300031250 Bacteria 1941
249 Ga0307509_10014396 3300031507 Bacteria 9297
250 Ga0265342_10114315 3300031712 Bacteria 1525
251 Ga0307416_100236830 3300032002 Bacteria 1765
252 Ga0307414_10959124 3300032004 Bacteria 786
253 Ga0373940_0031844 3300035088 Bacteria 1410
254 Ga0373952_0090768 3300035092 Bacteria 793
255 Ga0373953_0042528 3300035117 Bacteria 1811
256 Ga0373960_0094573 3300035121 Bacteria 960
257 Ga0373943_0007859 3300035170 Bacteria 4788
258 Ga0373946_0004006 3300035171 Bacteria 5243
259 Ga0373946_0366757 3300035171 Bacteria 722
260 Ga0373955_0088860 3300035172 Bacteria 1758
261 Ga0373955_0328210 3300035172 Bacteria 925
262 Ga0373927_0080296 3300035695 Bacteria 2114
263 Ga0373927_0399777 3300035695 Bacteria 906
264 Ga0373937_0010435 3300036401 Bacteria 8113
265 Ga0373937_0558422 3300036401 Bacteria 1087
266 Ga0373925_0042779 3300037068 Bacteria 3361
267 Ga0373925_0552732 3300037068 Bacteria 947
268 Ga0436364_1409439 3300037853 Bacteria 954
269 Ga0436365_0746072 3300039437 Bacteria 1407
270 Ga0436365_1680196 3300039437 Bacteria 4532
271 Ga0436363_1115802 3300039450 Bacteria 1830
272 Ga0451853_3139451 3300041512 Bacteria 1763
273 Ga0439460_0184024 3300042461 Unclassified 707
274 Ga0439440_0062531 3300042993 Bacteria 953
275 Ga0453684_0231736 3300044712 Bacteria 2132
276 Ga0451576_1027379 3300045051 Bacteria 864
277 Ga0495641_0210021 3300046461 Bacteria 873
278 Ga0495651_0117326 3300046462 Bacteria 1959
279 Ga0495664_0413622 3300046477 Bacteria 809
280 Ga0495628_0166740 3300046516 Bacteria 1672
281 Ga0495637_0201216 3300046520 Bacteria 732
282 Ga0495652_0007163 3300046529 Bacteria 10293
283 Ga0495640_0098436 3300046533 Bacteria 1922
284 Ga0495587_0198017 3300046536 Bacteria 1136
285 Ga0495667_0040394 3300046559 Bacteria 3098
286 Ga0495634_0172212 3300046642 Bacteria 1360
287 Ga0495634_0644834 3300046642 Bacteria 612
288 Ga0495646_0191821 3300046680 Bacteria 1117
289 Ga0495646_0383579 3300046680 Bacteria 732
290 Ga0495600_0242842 3300046809 Bacteria 1147
291 Ga0495604_0186841 3300047317 Bacteria 1446
292 Ga0495674_0034133 3300047319 Bacteria 4603
293 Ga0495674_0147833 3300047319 Bacteria 1972
294 Ga0495674_0416953 3300047319 Bacteria 1082
295 Ga0495676_0291386 3300047321 Bacteria 1103
296 Ga0495680_0008027 3300047322 Bacteria 9627
297 Ga0495675_0083183 3300047444 Bacteria 2015
298 Ga0496101_0356482 3300048904 Bacteria 1150
299 Ga0496102_0440369 3300048905 Bacteria 1223
300 Ga0496104_0159134 3300048907 Bacteria 2167
301 Ga0496106_0068657 3300048909 Bacteria 2704
302 Ga0496109_1004327 3300048912 Unclassified 772
303 Ga0496109_1173550 3300048912 Bacteria 705
304 Ga0496112_0311775 3300048915 Bacteria 1518
305 Ga0496114_0581819 3300048917 Bacteria 988
306 Ga0496115_0180915 3300048918 Bacteria 1743
307 Ga0496126_0517254 3300048929 Bacteria 952
308 Ga0501033_0029617 3300049570 Bacteria 4114
309 Ga0501036_0786574 3300049572 Bacteria 784
310 Ga0501037_0091329 3300049573 Unclassified 2202
311 Ga0501043_0301543 3300049579 Bacteria 1224
312 Ga0501047_0041107 3300049581 Bacteria 4468
313 Ga0501070_0091869 3300049586 Unclassified 2512
314 Ga0501035_0017858 3300049822 Bacteria 6544
315 Ga0501044_0002665 3300049823 Bacteria 20304
316 Ga0501044_0160877 3300049823 Bacteria 2222
317 Ga0501044_0363839 3300049823 Bacteria 1364
318 nmdc:mga05p37_23091_c1 3300050507 Bacteria 7547
319 nmdc:mga05p37_335233_c1 3300050507 Bacteria 1785
320 nmdc:mga05p37_76790_c1 3300050507 Bacteria 4112
321 nmdc:mga09592_430403_c1 3300050508 Bacteria 1139
322 nmdc:mga0qj67_3926_c1 3300050509 Bacteria 10754
323 nmdc:mga06r32_26869_c1 3300050510 Bacteria 5371
324 nmdc:mga06r32_7380_c1 3300050510 Bacteria 9893
325 nmdc:mga06r32_963871_c1 3300050510 Unclassified 807
326 nmdc:mga08y16_695276_c1 3300050511 Bacteria 1017
327 nmdc:mga0n895_100149_c1 3300050512 Bacteria 2907
328 nmdc:mga0n895_145580_c1 3300050512 Bacteria 2399
329 nmdc:mga0n895_147346_c1 3300050512 Bacteria 2384
330 nmdc:mga0n895_419468_c1 3300050512 Bacteria 1353
331 nmdc:mga0n895_6081_c1 3300050512 Bacteria 10186
332 nmdc:mga0rr50_14240_c1 3300050513 Bacteria 5210
333 nmdc:mga0rr50_1532_c1 3300050513 Bacteria 12754
334 nmdc:mga08x19_365212_c1 3300050514 Unclassified 1009
335 nmdc:mga08x19_6042_c1 3300050514 Bacteria 7157
336 nmdc:mga08x19_624037_c1 3300050514 Bacteria 764
337 nmdc:mga0a205_15498_c1 3300050515 Bacteria 7123
338 nmdc:mga0a205_35051_c1 3300050515 Bacteria 4818
339 nmdc:mga0a205_37119_c1 3300050515 Bacteria 4685
340 Ga0495601_0219469 3300053077 Bacteria 1242
341 Ga0500610_0000391 3300053079 Bacteria 13329
342 Ga0500651_0000924 3300053093 Bacteria 14398
343 Ga0500555_013361 3300053103 Bacteria 2368
344 Ga0500588_0022829 3300053146 Bacteria 1708
345 Ga0587111_0006492 3300060346 Bacteria 1857
346 Ga0436364_0203550
347 Ga0065704_10088299
348 Ga0065712_10108968
349 Ga0065712_10163259
350 Ga0065712_10226252
351 Ga0065715_10104036
352 Ga0065715_10130304
353 Ga0070676_10193296
354 Ga0070683_100992612
355 Ga0070690_100077940
356 Ga0070670_100553060
357 Ga0068869_100052324
358 Ga0070666_10022629
359 Ga0070666_10252134
360 Ga0070666_10857856
361 Ga0068868_100132364
362 Ga0070689_100106931
363 Ga0070691_10116147
364 Ga0070691_10623611
365 Ga0070661_100216673
366 Ga0070669_100007282
367 Ga0070669_100139340
368 Ga0070669_100476842
369 Ga0070675_100586044
370 Ga0070671_100580595
371 Ga0070674_100271627
372 Ga0070674_100309788
373 Ga0070673_100116715
374 Ga0070673_100596131
375 Ga0070688_100060933
376 Ga0070667_100034125
377 Ga0070705_100147912
378 Ga0070700_100090520
379 Ga0070700_100408206
380 Ga0070700_100710175
381 Ga0070694_100003149
382 Ga0070694_100069985
383 Ga0070708_100425300
384 Ga0070663_100062491
385 Ga0070678_100057230
386 Ga0070678_100067462
387 Ga0068867_100050472
388 Ga0070685_10005388
389 Ga0070706_100704261
390 Ga0070707_100003051
391 Ga0070707_100088288
392 Ga0070698_100919920
393 Ga0070699_100574857
394 Ga0070697_100207384
395 Ga0070697_100767109
396 Ga0070672_100135977
397 Ga0070686_100060935
398 Ga0070686_100483675
399 Ga0070695_100007204
400 Ga0070695_100732450
401 Ga0070696_100066056
402 Ga0070665_100087967
403 Ga0070665_100617780
404 Ga0070704_100033306
405 Ga0070664_100000914
406 Ga0070664_100255125
407 Ga0068854_101057884
408 Ga0070702_100952998
409 Ga0068852_100671122
410 Ga0068859_100045181
411 Ga0068864_100058781
412 Ga0068864_100068111
413 Ga0068866_10063372
414 Ga0068866_10138810
415 Ga0068866_10291787
416 Ga0068861_100729049
417 Ga0068851_10062405
418 Ga0068851_10393519
419 Ga0068870_10002586
420 Ga0068870_10454156
421 Ga0068863_100035499
422 Ga0068858_100017565
423 Ga0068858_100083555
424 Ga0068858_100099469
425 Ga0068858_100231489
426 Ga0068858_100363715
427 Ga0068858_100404963
428 Ga0068860_100036113
429 Ga0068860_100449232
430 Ga0068862_100317449
431 Ga0068862_100898178
432 Ga0081540_1017587
433 Ga0070712_100679010
434 Ga0075367_10071713
435 Ga0097621_100064178
436 Ga0097621_100353936
437 Ga0097621_100665916
438 Ga0068871_100091205
439 Ga0068871_100289165
440 Ga0068871_100596100
441 Ga0068871_100819349
442 Ga0075428_100011520
443 Ga0075428_100283074
444 Ga0075430_100009319
445 Ga0075430_100180138
446 Ga0075431_100003661
447 Ga0075431_100698816
448 Ga0075433_10027041
449 Ga0075433_10046628
450 Ga0075433_10113597
451 Ga0075434_100008260
452 Ga0075434_100016177
453 Ga0075434_100017172
454 Ga0075434_100041664
455 Ga0075434_100150257
456 Ga0075434_100201697
457 Ga0075436_100013956
458 Ga0075436_100701059
459 Ga0097620_100045183
460 Ga0075435_100001867
461 Ga0105240_10368915
462 Ga0111539_10189576
463 Ga0111539_11058767
464 Ga0105245_10382962
465 Ga0105245_10538618
466 Ga0105247_10379580
467 Ga0114129_10010795
468 Ga0114129_10080881
469 Ga0105243_10110598
470 Ga0105241_11060557
471 Ga0105242_10099173
472 Ga0105242_10219759
473 Ga0105242_11123106
474 Ga0105248_10007193
475 Ga0105248_10021148
476 Ga0105248_10030021
477 Ga0105248_10037435
478 Ga0105248_10077546
479 Ga0105237_10498814
480 Ga0105238_10106242
481 Ga0105238_10157432
482 Ga0105249_10002976
483 Ga0105249_10003029
484 Ga0105249_10055331
485 Ga0105249_10154423
486 Ga0105249_10246960
487 Ga0105249_11159542
488 Ga0105239_10766088
489 Ga0105239_10845059
490 Ga0105239_11666325
491 Ga0105239_12360428
492 Ga0105246_10043598
493 Ga0105246_10089632
494 Ga0105246_11095665
495 Ga0157370_10737752
496 Ga0157374_10596584
497 Ga0157378_10045029
498 Ga0157378_11229779
499 Ga0163162_10019656
500 Ga0163162_10053797
501 Ga0163162_10622888
502 Ga0163162_10671078
503 Ga0157372_10078950
504 Ga0157375_10005456
505 Ga0157375_10270185
506 Ga0157375_10385776
507 Ga0157375_10728409
508 Ga0157375_11354999
509 Ga0163163_10284388
510 Ga0163163_11247535
511 Ga0157380_10009619
512 Ga0157380_10210030
513 Ga0157380_10641467
514 Ga0157377_10118927
515 Ga0157377_10294293
516 Ga0157379_10022094
517 Ga0157379_10271430
518 Ga0157379_10388908
519 Ga0157376_10067903
520 Ga0163161_10420798
521 Ga0163161_10736161
522 Ga0163161_10749966
523 Ga0213876_10116744
524 Ga0207697_10001608
525 Ga0207682_10010095
526 Ga0207642_10032945
527 Ga0207642_10528828
528 Ga0207688_10004636
529 Ga0207680_10275390
530 Ga0207643_10000692
531 Ga0207662_10143965
532 Ga0207646_10015125
533 Ga0207681_10064500
534 Ga0207681_10109855
535 Ga0207681_10276169
536 Ga0207694_10043847
537 Ga0207659_10172196
538 Ga0207659_10201655
539 Ga0207687_10002081
540 Ga0207644_10425603
541 Ga0207690_10223017
542 Ga0207706_10004290
543 Ga0207686_10121851
544 Ga0207709_10418163
545 Ga0207670_10019616
546 Ga0207670_10085983
547 Ga0207669_11037128
548 Ga0207691_10003296
549 Ga0207711_10000564
550 Ga0207711_10032236
551 Ga0207711_10065843
552 Ga0207711_10270013
553 Ga0207689_10070594
554 Ga0207689_10365962
555 Ga0207679_10046368
556 Ga0207651_10039295
557 Ga0207712_10002221
558 Ga0207712_10185658
559 Ga0207640_10061932
560 Ga0207640_10680530
561 Ga0207658_10069131
562 Ga0207677_10325250
563 Ga0207703_10038565
564 Ga0207703_10083728
565 Ga0207703_10113809
566 Ga0207703_10647203
567 Ga0207708_10018001
568 Ga0207708_10175972
569 Ga0207708_10363218
570 Ga0207708_10522942
571 Ga0207641_10097545
572 Ga0207641_10484380
573 Ga0207648_10029621
574 Ga0207648_10056648
575 Ga0207648_10546255
576 Ga0207648_10598477
577 Ga0207676_10026154
578 Ga0207676_10196378
579 Ga0207676_10248009
580 Ga0207675_100012355
581 Ga0207675_100282592
582 Ga0207683_10119069
583 Ga0207428_10111972
584 Ga0268266_10244851
585 Ga0268266_11053005
586 Ga0268265_10289323
587 Ga0268265_10886188
588 Ga0268265_11039344
589 Ga0268264_10053457
590 Ga0268264_10257695
591 Ga0265320_10022925
592 Ga0265329_10025042
593 Ga0265331_10052765
594 Ga0307509_10014396
595 Ga0265342_10114315
596 Ga0307416_100236830
597 Ga0307414_10959124
598 Ga0373940_0031844
599 Ga0373952_0090768
600 Ga0373953_0042528
601 Ga0373960_0094573
602 Ga0373943_0007859
603 Ga0373946_0004006
604 Ga0373946_0366757
605 Ga0373955_0088860
606 Ga0373955_0328210
607 Ga0373927_0080296
608 Ga0373927_0399777
609 Ga0373937_0010435
610 Ga0373937_0558422
611 Ga0373925_0042779
612 Ga0373925_0552732
613 Ga0436364_1409439
614 Ga0436365_0746072
615 Ga0436365_1680196
616 Ga0436363_1115802
617 Ga0451853_3139451
618 Ga0439460_0184024
619 Ga0439440_0062531
620 Ga0453684_0231736
621 Ga0451576_1027379
622 Ga0495641_0210021
623 Ga0495651_0117326
624 Ga0495664_0413622
625 Ga0495628_0166740
626 Ga0495637_0201216
627 Ga0495652_0007163
628 Ga0495640_0098436
629 Ga0495587_0198017
630 Ga0495667_0040394
631 Ga0495634_0172212
632 Ga0495634_0644834
633 Ga0495646_0191821
634 Ga0495646_0383579
635 Ga0495600_0242842
636 Ga0495604_0186841
637 Ga0495674_0034133
638 Ga0495674_0147833
639 Ga0495674_0416953
640 Ga0495676_0291386
641 Ga0495680_0008027
642 Ga0495675_0083183
643 Ga0496101_0356482
644 Ga0496102_0440369
645 Ga0496104_0159134
646 Ga0496106_0068657
647 Ga0496109_1004327
648 Ga0496109_1173550
649 Ga0496112_0311775
650 Ga0496114_0581819
651 Ga0496115_0180915
652 Ga0496126_0517254
653 Ga0501033_0029617
654 Ga0501036_0786574
655 Ga0501037_0091329
656 Ga0501043_0301543
657 Ga0501047_0041107
658 Ga0501070_0091869
659 Ga0501035_0017858
660 Ga0501044_0002665
661 Ga0501044_0160877
662 Ga0501044_0363839
663 nmdc:mga05p37_23091_c1
664 nmdc:mga05p37_335233_c1
665 nmdc:mga05p37_76790_c1
666 nmdc:mga09592_430403_c1
667 nmdc:mga0qj67_3926_c1
668 nmdc:mga06r32_26869_c1
669 nmdc:mga06r32_7380_c1
670 nmdc:mga06r32_963871_c1
671 nmdc:mga08y16_695276_c1
672 nmdc:mga0n895_100149_c1
673 nmdc:mga0n895_145580_c1
674 nmdc:mga0n895_147346_c1
675 nmdc:mga0n895_419468_c1
676 nmdc:mga0n895_6081_c1
677 nmdc:mga0rr50_14240_c1
678 nmdc:mga0rr50_1532_c1
679 nmdc:mga08x19_365212_c1
680 nmdc:mga08x19_6042_c1
681 nmdc:mga08x19_624037_c1
682 nmdc:mga0a205_15498_c1
683 nmdc:mga0a205_35051_c1
684 nmdc:mga0a205_37119_c1
685 Ga0495601_0219469
686 Ga0500610_0000391
687 Ga0500651_0000924
688 Ga0500555_013361
689 Ga0500588_0022829
690 Ga0587111_0006492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16694

Cytochrome_P460

Cytochrome P460

72

210

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.8423 44 184
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.8201 44 183
8brk-assembly1.cif.gz_A room temperature crystal structure of cytochrome c' from thermus thermophilus 0.7867 44 183
6hiu-assembly1.cif.gz_A cytochrome p460 from methylococcus capsulatus (bath) 0.7725 44 184
7zps-assembly1.cif.gz_B cytochrome c prime beta from methylococcus capsulatus (bath): no complex 0.7694 44 183
ID Description Score Start End Superfamily
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.6706 40 65 3.10.180.10
af_A4I1M6_70_270_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.658 131 148 3.30.470.20
af_K7LWA0_1_126_3.60.10.10 Alpha Beta;4-Layer Sandwich;Deoxyribonuclease I; Chain A;Endonuclease/exonuclease/phosphatase 0.624 47 65 3.60.10.10
2je3A00 Alpha Beta;3-Layer(bba) Sandwich;Chalcone isomerase;Cytochrome P460 0.6095 44 179 3.50.70.20
af_A2CGB3_201_312_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.5987 50 97 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.9494 28 184
AF-A0A2V2R107-F1-model_v4 deleted 0.945 20 184
AF-A0A2V7MFV7-F1-model_v4 Cytochrome P460 0.9436 28 184
AF-A0A6B9YVF0-F1-model_v4 C-type cytochrome 0.9379 23 184 GO:0009055
GO:0020037
GO:0046872
AF-A0A2U0XWL8-F1-model_v4 deleted 0.9344 94 141

Map