F416426

General Info

Members Datasets Scaffolds Average Seq Length
345 194 690 152

Family's Representative Sequence

Representative Sequence 3300031247|Ga0265340_10051129|Ga0265340_100511294
Length 143
Sequence MSMDDRAVVERQLGRRPRAFRSVAVRCPFGRPAVTEQTPFDEDGRPFPTQFYVTCPFLVAQLSRLEAAGGVEAWSRAADDDPELRASLERAQPGGIGGSTRSGSLKCLHAHAAFALARPGYTLGERILQEIPGLWPESACCSA

Samples

Sample ID Description Type Environment
1 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
134 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
139 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
140 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.17
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 15.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265340_10051129 3300031247 Unclassified 2002
2 Ga0070658_10199590 3300005327 Bacteria 1687
3 Ga0070658_10211343 3300005327 Bacteria 1639
4 Ga0070658_11029874 3300005327 Unclassified 716
5 Ga0070683_100012421 3300005329 Bacteria 7401
6 Ga0070683_100301331 3300005329 Bacteria 1525
7 Ga0070680_100118144 3300005336 Bacteria 2211
8 Ga0070660_100000651 3300005339 Bacteria 23008
9 Ga0070660_100018604 3300005339 Bacteria 5079
10 Ga0070660_100101932 3300005339 Unclassified 2275
11 Ga0070660_100500442 3300005339 Bacteria 1011
12 Ga0070691_10110934 3300005341 Unclassified 1372
13 Ga0070691_10235501 3300005341 Bacteria 976
14 Ga0070661_100153454 3300005344 Bacteria 1742
15 Ga0070692_10589751 3300005345 Unclassified 734
16 Ga0070668_100217067 3300005347 Bacteria 1576
17 Ga0070673_101435381 3300005364 Bacteria 650
18 Ga0070659_100056786 3300005366 Bacteria 3087
19 Ga0070659_100121070 3300005366 Bacteria 2119
20 Ga0070659_100482764 3300005366 Bacteria 1055
21 Ga0070667_100106739 3300005367 Bacteria 2424
22 Ga0070709_10431244 3300005434 Bacteria 990
23 Ga0070714_100269347 3300005435 Bacteria 1579
24 Ga0070710_10058377 3300005437 Bacteria 2189
25 Ga0070701_10548839 3300005438 Unclassified 758
26 Ga0070711_100829452 3300005439 Bacteria 786
27 Ga0070705_100160649 3300005440 Bacteria 1502
28 Ga0070694_100632484 3300005444 Bacteria 865
29 Ga0070708_100287458 3300005445 Bacteria 1548
30 Ga0070708_100430366 3300005445 Bacteria 1244
31 Ga0070708_101096556 3300005445 Bacteria 746
32 Ga0070663_100485341 3300005455 Unclassified 1024
33 Ga0070681_10000870 3300005458 Bacteria 25432
34 Ga0070681_10088530 3300005458 Bacteria 3047
35 Ga0070681_10207185 3300005458 Bacteria 1877
36 Ga0070681_10240848 3300005458 Unclassified 1722
37 Ga0070706_100073512 3300005467 Bacteria 3164
38 Ga0070706_100302654 3300005467 Bacteria 1492
39 Ga0070706_100496322 3300005467 Unclassified 1136
40 Ga0070706_100937656 3300005467 Bacteria 799
41 Ga0070707_100004398 3300005468 Bacteria 13203
42 Ga0070707_100111566 3300005468 Bacteria 2652
43 Ga0070707_100293165 3300005468 Bacteria 1581
44 Ga0070707_102155587 3300005468 Unclassified 525
45 Ga0070698_100138730 3300005471 Unclassified 2384
46 Ga0070699_100443299 3300005518 Bacteria 1177
47 Ga0070699_100471864 3300005518 Bacteria 1138
48 Ga0070684_100148921 3300005535 Bacteria 2119
49 Ga0070684_100196695 3300005535 Bacteria 1836
50 Ga0070684_100270017 3300005535 Unclassified 1557
51 Ga0068853_100763239 3300005539 Unclassified 925
52 Ga0070695_100080987 3300005545 Bacteria 2147
53 Ga0070696_100103707 3300005546 Bacteria 2041
54 Ga0070665_100016488 3300005548 Bacteria 7407
55 Ga0070704_100089886 3300005549 Bacteria 2285
56 Ga0070704_100261242 3300005549 Bacteria 1426
57 Ga0068855_100029966 3300005563 Bacteria 6507
58 Ga0068855_100062300 3300005563 Bacteria 4354
59 Ga0068855_100105167 3300005563 Bacteria 3246
60 Ga0068857_100055640 3300005577 Bacteria 3510
61 Ga0068854_100305210 3300005578 Bacteria 1289
62 Ga0068854_100912419 3300005578 Bacteria 773
63 Ga0068856_100028073 3300005614 Bacteria 5492
64 Ga0068856_100070008 3300005614 Bacteria 3470
65 Ga0068856_100165548 3300005614 Bacteria 2222
66 Ga0068852_100374508 3300005616 Bacteria 1395
67 Ga0068866_10523976 3300005718 Unclassified 788
68 Ga0068861_100044556 3300005719 Bacteria 3336
69 Ga0070717_10225935 3300006028 Unclassified 1647
70 Ga0075432_10008639 3300006058 Bacteria 3477
71 Ga0070716_100013362 3300006173 Bacteria 4182
72 Ga0070712_100204215 3300006175 Bacteria 1554
73 Ga0070712_100329485 3300006175 Bacteria 1244
74 Ga0070712_101251776 3300006175 Bacteria 646
75 Ga0097621_100148039 3300006237 Bacteria 2012
76 Ga0068871_100160124 3300006358 Bacteria 1925
77 Ga0068871_100895087 3300006358 Unclassified 822
78 Ga0075428_100157653 3300006844 Bacteria 2465
79 Ga0075431_100002483 3300006847 Bacteria 17781
80 Ga0075433_10009470 3300006852 Bacteria 7785
81 Ga0075434_100235853 3300006871 Bacteria 1849
82 Ga0075434_100420101 3300006871 Bacteria 1358
83 Ga0075429_100395444 3300006880 Bacteria 1210
84 Ga0075436_100001284 3300006914 Bacteria 17052
85 Ga0075435_100199664 3300007076 Bacteria 1694
86 Ga0075435_100372381 3300007076 Bacteria 1226
87 Ga0105240_10033573 3300009093 Bacteria 6626
88 Ga0111539_10007774 3300009094 Bacteria 13687
89 Ga0111539_10010442 3300009094 Bacteria 11688
90 Ga0105245_10073994 3300009098 Bacteria 3099
91 Ga0114129_10083969 3300009147 Bacteria 4422
92 Ga0114129_10184781 3300009147 Bacteria 2834
93 Ga0105243_11568058 3300009148 Unclassified 684
94 Ga0105241_10232785 3300009174 Bacteria 1554
95 Ga0105242_10808872 3300009176 Bacteria 928
96 Ga0105248_11017373 3300009177 Bacteria 936
97 Ga0105237_10248818 3300009545 Bacteria 1779
98 Ga0105237_11303600 3300009545 Unclassified 733
99 Ga0105238_10364570 3300009551 Bacteria 1435
100 Ga0105239_10135637 3300010375 Bacteria 2740
101 Ga0105239_10405130 3300010375 Bacteria 1544
102 Ga0157370_10166281 3300013104 Bacteria 2051
103 Ga0157370_10291102 3300013104 Bacteria 1508
104 Ga0157370_11073656 3300013104 Bacteria 728
105 Ga0157369_10002883 3300013105 Bacteria 20540
106 Ga0157369_10016657 3300013105 Bacteria 8264
107 Ga0157369_10032625 3300013105 Bacteria 5726
108 Ga0157369_10042487 3300013105 Bacteria 4958
109 Ga0157369_10168631 3300013105 Bacteria 2308
110 Ga0157369_10618613 3300013105 Bacteria 1117
111 Ga0157374_10590137 3300013296 Bacteria 1120
112 Ga0157374_10594232 3300013296 Bacteria 1116
113 Ga0157378_10157323 3300013297 Bacteria 2122
114 Ga0157372_10025951 3300013307 Bacteria 6374
115 Ga0157372_10037070 3300013307 Bacteria 5375
116 Ga0157372_12274501 3300013307 Bacteria 623
117 Ga0157375_10058838 3300013308 Bacteria 3804
118 Ga0182008_10327383 3300014497 Bacteria 808
119 Ga0157379_10908576 3300014968 Bacteria 835
120 Ga0157376_10698509 3300014969 Unclassified 1019
121 Ga0157376_10936307 3300014969 Unclassified 886
122 Ga0206353_10109286 3300020082 Bacteria 2054
123 Ga0206353_10211348 3300020082 Bacteria 6099
124 Ga0213871_10005074 3300021441 Bacteria 2690
125 Ga0207647_10220371 3300025904 Bacteria 1093
126 Ga0207699_10056186 3300025906 Bacteria 2345
127 Ga0207684_10115424 3300025910 Bacteria 2300
128 Ga0207684_10125291 3300025910 Bacteria 2204
129 Ga0207684_10792246 3300025910 Bacteria 801
130 Ga0207707_10003569 3300025912 Bacteria 13791
131 Ga0207707_10362349 3300025912 Bacteria 1248
132 Ga0207695_10082888 3300025913 Bacteria 3241
133 Ga0207695_10532127 3300025913 Unclassified 1057
134 Ga0207693_10009227 3300025915 Bacteria 8053
135 Ga0207693_10968689 3300025915 Bacteria 651
136 Ga0207663_10215681 3300025916 Bacteria 1394
137 Ga0207663_10474765 3300025916 Bacteria 968
138 Ga0207663_10850292 3300025916 Bacteria 728
139 Ga0207660_10028521 3300025917 Bacteria 3819
140 Ga0207657_10001863 3300025919 Bacteria 22803
141 Ga0207657_10002974 3300025919 Bacteria 18179
142 Ga0207657_10094573 3300025919 Bacteria 2488
143 Ga0207657_10368514 3300025919 Bacteria 1132
144 Ga0207657_10482178 3300025919 Unclassified 972
145 Ga0207649_10410605 3300025920 Bacteria 1015
146 Ga0207652_10326878 3300025921 Bacteria 1384
147 Ga0207652_10433776 3300025921 Unclassified 1185
148 Ga0207652_11131591 3300025921 Bacteria 684
149 Ga0207646_10002184 3300025922 Bacteria 23337
150 Ga0207646_10151362 3300025922 Bacteria 2092
151 Ga0207646_10645975 3300025922 Bacteria 948
152 Ga0207664_10281718 3300025929 Bacteria 1459
153 Ga0207690_10040417 3300025932 Bacteria 3049
154 Ga0207690_10284656 3300025932 Unclassified 1288
155 Ga0207686_10344835 3300025934 Unclassified 1120
156 Ga0207686_10572290 3300025934 Unclassified 886
157 Ga0207709_10585548 3300025935 Bacteria 882
158 Ga0207665_10014135 3300025939 Bacteria 5251
159 Ga0207665_10135284 3300025939 Bacteria 1753
160 Ga0207661_10331314 3300025944 Bacteria 1370
161 Ga0207679_10242281 3300025945 Unclassified 1528
162 Ga0207667_10036089 3300025949 Bacteria 5301
163 Ga0207667_10149756 3300025949 Bacteria 2402
164 Ga0207667_10382505 3300025949 Unclassified 1434
165 Ga0207651_10331846 3300025960 Bacteria 1275
166 Ga0207651_10981818 3300025960 Unclassified 754
167 Ga0207640_10702264 3300025981 Bacteria 867
168 Ga0207639_11536952 3300026041 Bacteria 624
169 Ga0207678_10287813 3300026067 Unclassified 1411
170 Ga0207702_10098034 3300026078 Bacteria 2581
171 Ga0207702_10312911 3300026078 Bacteria 1493
172 Ga0207702_10433725 3300026078 Unclassified 1272
173 Ga0207702_10494384 3300026078 Unclassified 1192
174 Ga0207648_11138123 3300026089 Bacteria 732
175 Ga0207674_10024779 3300026116 Bacteria 6404
176 Ga0207674_11213208 3300026116 Bacteria 724
177 Ga0207675_100019432 3300026118 Bacteria 6338
178 Ga0207698_10008245 3300026142 Bacteria 6576
179 Ga0207428_10005373 3300027907 Bacteria 11954
180 Ga0207428_10442074 3300027907 Unclassified 949
181 Ga0265323_10046624 3300028653 Unclassified 1553
182 Ga0265338_10010822 3300028800 Bacteria 10628
183 Ga0265338_10256439 3300028800 Unclassified 1288
184 Ga0265332_10097553 3300031238 Unclassified 1241
185 Ga0265325_10040367 3300031241 Unclassified 2451
186 Ga0265340_10139641 3300031247 Unclassified 1108
187 Ga0265339_10186351 3300031249 Bacteria 1031
188 Ga0265331_10193467 3300031250 Unclassified 917
189 Ga0265331_10336358 3300031250 Unclassified 676
190 Ga0265316_10022315 3300031344 Bacteria 5339
191 Ga0265316_10151963 3300031344 Bacteria 1734
192 Ga0265313_10023593 3300031595 Bacteria 3311
193 Ga0265314_10024769 3300031711 Bacteria 4541
194 Ga0265342_10108308 3300031712 Unclassified 1575
195 Ga0373939_0289512 3300035114 Bacteria 650
196 Ga0373941_0404265 3300035115 Unclassified 565
197 Ga0373925_0544929 3300037068 Bacteria 954
198 Ga0395899_0039939 3300037312 Bacteria 3510
199 Ga0395899_0055509 3300037312 Bacteria 2930
200 Ga0395899_0057126 3300037312 Bacteria 2882
201 Ga0395899_0097487 3300037312 Bacteria 2125
202 Ga0395899_0221891 3300037312 Bacteria 1309
203 Ga0395900_0007041 3300037418 Bacteria 11646
204 Ga0395900_0018092 3300037418 Bacteria 7191
205 Ga0395900_0023265 3300037418 Bacteria 6342
206 Ga0395900_0091134 3300037418 Bacteria 3133
207 Ga0395898_0006567 3300037466 Bacteria 12408
208 Ga0395898_0012356 3300037466 Bacteria 8832
209 Ga0395898_0145173 3300037466 Bacteria 2271
210 Ga0395898_0283949 3300037466 Bacteria 1579
211 Ga0395898_0694013 3300037466 Bacteria 960
212 Ga0395898_0864250 3300037466 Bacteria 843
213 Ga0395905_0023700 3300037471 Bacteria 5795
214 Ga0395905_0058464 3300037471 Bacteria 3605
215 Ga0395905_0257647 3300037471 Bacteria 1629
216 Ga0395905_0533590 3300037471 Bacteria 1074
217 Ga0395905_0681208 3300037471 Bacteria 930
218 Ga0395905_1592476 3300037471 Bacteria 558
219 Ga0436364_1268184 3300037853 Bacteria 1482
220 Ga0395901_0012938 3300038443 Bacteria 8466
221 Ga0395901_0021782 3300038443 Bacteria 6568
222 Ga0395901_0027190 3300038443 Bacteria 5877
223 Ga0395901_0105959 3300038443 Bacteria 2951
224 Ga0395901_0291495 3300038443 Bacteria 1693
225 Ga0395901_0816002 3300038443 Bacteria 921
226 Ga0436365_0125786 3300039437 Bacteria 1772
227 Ga0436360_0549902 3300039438 Bacteria 4841
228 Ga0436360_0848359 3300039438 Unclassified 1021
229 Ga0451793_1332436 3300041452 Bacteria 2129
230 Ga0451851_0142510 3300041507 Unclassified 1729
231 Ga0451853_0163298 3300041512 Bacteria 1355
232 Ga0450920_114557 3300042122 Bacteria 564
233 Ga0466965_0435407 3300044683 Bacteria 728
234 Ga0466961_0023024 3300044693 Bacteria 4007
235 Ga0466961_0078887 3300044693 Bacteria 2085
236 Ga0466961_0177731 3300044693 Bacteria 1322
237 Ga0466963_0005340 3300044694 Bacteria 7514
238 Ga0466963_0020429 3300044694 Bacteria 4164
239 Ga0466963_0089248 3300044694 Unclassified 2097
240 Ga0466963_0123405 3300044694 Bacteria 1784
241 Ga0466963_0141776 3300044694 Bacteria 1665
242 Ga0466964_0057896 3300044706 Bacteria 1605
243 Ga0466971_0000481 3300044719 Bacteria 15690
244 Ga0466968_0323482 3300044735 Bacteria 745
245 Ga0466970_0215017 3300044765 Bacteria 1072
246 Ga0466957_0004494 3300044842 Bacteria 7780
247 Ga0466957_0334153 3300044842 Bacteria 1025
248 Ga0466960_0002491 3300044901 Bacteria 6931
249 Ga0466959_0005782 3300045049 Bacteria 8518
250 Ga0466959_0030826 3300045049 Bacteria 3971
251 Ga0466958_0010286 3300045836 Bacteria 5237
252 Ga0466958_0025656 3300045836 Bacteria 3476
253 Ga0466967_0022591 3300045976 Bacteria 5136
254 Ga0466967_0037037 3300045976 Bacteria 4170
255 Ga0466967_0040338 3300045976 Bacteria 4018
256 Ga0466967_0051535 3300045976 Bacteria 3608
257 Ga0466967_0132762 3300045976 Bacteria 2313
258 Ga0466967_0212783 3300045976 Bacteria 1834
259 Ga0466967_0529579 3300045976 Bacteria 1158
260 Ga0495603_0106410 3300046455 Bacteria 1637
261 Ga0495629_0322177 3300046459 Bacteria 1056
262 Ga0495605_0088441 3300046474 Bacteria 1439
263 Ga0495666_0349943 3300046526 Unclassified 666
264 Ga0495652_0823520 3300046529 Bacteria 617
265 Ga0495665_0456826 3300046531 Bacteria 645
266 Ga0495657_0531823 3300046675 Bacteria 684
267 Ga0495647_0118637 3300046681 Unclassified 1111
268 Ga0495604_0487111 3300047317 Archaea 801
269 Ga0496100_0003965 3300048903 Bacteria 7780
270 Ga0496100_0028494 3300048903 Bacteria 3445
271 Ga0496100_0047427 3300048903 Bacteria 2768
272 Ga0496101_0006368 3300048904 Bacteria 7598
273 Ga0496101_0009340 3300048904 Bacteria 6444
274 Ga0496101_0039665 3300048904 Bacteria 3351
275 Ga0496101_0875348 3300048904 Unclassified 707
276 Ga0496102_0247858 3300048905 Unclassified 1679
277 Ga0496102_0250926 3300048905 Bacteria 1668
278 Ga0496103_0015122 3300048906 Bacteria 4588
279 Ga0496103_0532778 3300048906 Bacteria 750
280 Ga0496104_0234563 3300048907 Bacteria 1747
281 Ga0496104_0856070 3300048907 Bacteria 814
282 Ga0496104_1200619 3300048907 Unclassified 662
283 Ga0496104_1498709 3300048907 Bacteria 577
284 Ga0496105_0008236 3300048908 Bacteria 8105
285 Ga0496105_0011786 3300048908 Bacteria 6921
286 Ga0496105_0419271 3300048908 Bacteria 1060
287 Ga0496106_0012373 3300048909 Bacteria 6299
288 Ga0496107_0029154 3300048910 Bacteria 3925
289 Ga0496107_0030365 3300048910 Bacteria 3851
290 Ga0496108_0057723 3300048911 Bacteria 3261
291 Ga0496108_0144239 3300048911 Unclassified 2052
292 Ga0496109_0116146 3300048912 Bacteria 2490
293 Ga0496109_0362020 3300048912 Unclassified 1370
294 Ga0496110_0002690 3300048913 Bacteria 13429
295 Ga0496110_0029862 3300048913 Bacteria 4697
296 Ga0496110_0345792 3300048913 Bacteria 1355
297 Ga0496111_0030940 3300048914 Bacteria 3809
298 Ga0496111_0066949 3300048914 Bacteria 2609
299 Ga0496111_0115810 3300048914 Bacteria 1976
300 Ga0496112_0306861 3300048915 Bacteria 1532
301 Ga0496113_0048875 3300048916 Bacteria 3148
302 Ga0496113_0147593 3300048916 Bacteria 1854
303 Ga0496114_0002086 3300048917 Bacteria 15206
304 Ga0496114_0040275 3300048917 Bacteria 3867
305 Ga0496114_0060948 3300048917 Bacteria 3154
306 Ga0496114_0123573 3300048917 Bacteria 2228
307 Ga0496115_0001353 3300048918 Bacteria 17501
308 Ga0496115_0004453 3300048918 Bacteria 10154
309 Ga0496115_0792052 3300048918 Bacteria 738
310 Ga0501033_0408921 3300049570 Bacteria 946
311 Ga0501036_0762555 3300049572 Bacteria 798
312 Ga0501038_0636119 3300049574 Bacteria 804
313 Ga0501040_0363339 3300049576 Bacteria 1037
314 Ga0501041_0194052 3300049577 Bacteria 1272
315 Ga0501047_0170102 3300049581 Bacteria 2048
316 Ga0501047_1192312 3300049581 Bacteria 575
317 Ga0501069_0296089 3300049585 Bacteria 948
318 Ga0501070_0004310 3300049586 Bacteria 12226
319 Ga0501070_0212937 3300049586 Bacteria 1586
320 Ga0501075_0192074 3300049591 Bacteria 1557
321 Ga0501077_0029831 3300049593 Bacteria 3468
322 Ga0501079_0198442 3300049741 Bacteria 1567
323 Ga0501080_0073314 3300049742 Bacteria 3185
324 Ga0501080_0469222 3300049742 Bacteria 1127
325 Ga0501080_0910053 3300049742 Bacteria 766
326 Ga0501081_0179675 3300049743 Bacteria 1530
327 Ga0501083_0306820 3300049744 Bacteria 1032
328 Ga0501044_0237404 3300049823 Bacteria 1768
329 nmdc:mga05p37_13674_c1 3300050507 Bacteria 9726
330 nmdc:mga06r32_5579_c1 3300050510 Bacteria 11326
331 nmdc:mga08y16_24877_c1 3300050511 Bacteria 6316
332 nmdc:mga08y16_46532_c1 3300050511 Bacteria 4542
333 nmdc:mga0n895_561212_c1 3300050512 Bacteria 1147
334 nmdc:mga0n895_6963_c1 3300050512 Bacteria 9652
335 nmdc:mga0rr50_1112_c1 3300050513 Bacteria 14601
336 nmdc:mga08x19_72835_c1 3300050514 Bacteria 2242
337 nmdc:mga0a205_6910_c1 3300050515 Bacteria 10260
338 Ga0495601_0064659 3300053077 Bacteria 2327
339 Ga0495655_0088433 3300053083 Bacteria 898
340 Ga0501084_0854987 3300054114 Bacteria 766
341 Ga0501082_0157920 3300060353 Bacteria 1970
342 Ga0466962_0004258 3300061719 Bacteria 6854
343 Ga0466962_0229819 3300061719 Archaea 909
344 Ga0466962_0460570 3300061719 Unclassified 641
345 Ga0530510_0807964 3300061734 Unclassified 716
346 Ga0265340_10051129
347 Ga0070658_10199590
348 Ga0070658_10211343
349 Ga0070658_11029874
350 Ga0070683_100012421
351 Ga0070683_100301331
352 Ga0070680_100118144
353 Ga0070660_100000651
354 Ga0070660_100018604
355 Ga0070660_100101932
356 Ga0070660_100500442
357 Ga0070691_10110934
358 Ga0070691_10235501
359 Ga0070661_100153454
360 Ga0070692_10589751
361 Ga0070668_100217067
362 Ga0070673_101435381
363 Ga0070659_100056786
364 Ga0070659_100121070
365 Ga0070659_100482764
366 Ga0070667_100106739
367 Ga0070709_10431244
368 Ga0070714_100269347
369 Ga0070710_10058377
370 Ga0070701_10548839
371 Ga0070711_100829452
372 Ga0070705_100160649
373 Ga0070694_100632484
374 Ga0070708_100287458
375 Ga0070708_100430366
376 Ga0070708_101096556
377 Ga0070663_100485341
378 Ga0070681_10000870
379 Ga0070681_10088530
380 Ga0070681_10207185
381 Ga0070681_10240848
382 Ga0070706_100073512
383 Ga0070706_100302654
384 Ga0070706_100496322
385 Ga0070706_100937656
386 Ga0070707_100004398
387 Ga0070707_100111566
388 Ga0070707_100293165
389 Ga0070707_102155587
390 Ga0070698_100138730
391 Ga0070699_100443299
392 Ga0070699_100471864
393 Ga0070684_100148921
394 Ga0070684_100196695
395 Ga0070684_100270017
396 Ga0068853_100763239
397 Ga0070695_100080987
398 Ga0070696_100103707
399 Ga0070665_100016488
400 Ga0070704_100089886
401 Ga0070704_100261242
402 Ga0068855_100029966
403 Ga0068855_100062300
404 Ga0068855_100105167
405 Ga0068857_100055640
406 Ga0068854_100305210
407 Ga0068854_100912419
408 Ga0068856_100028073
409 Ga0068856_100070008
410 Ga0068856_100165548
411 Ga0068852_100374508
412 Ga0068866_10523976
413 Ga0068861_100044556
414 Ga0070717_10225935
415 Ga0075432_10008639
416 Ga0070716_100013362
417 Ga0070712_100204215
418 Ga0070712_100329485
419 Ga0070712_101251776
420 Ga0097621_100148039
421 Ga0068871_100160124
422 Ga0068871_100895087
423 Ga0075428_100157653
424 Ga0075431_100002483
425 Ga0075433_10009470
426 Ga0075434_100235853
427 Ga0075434_100420101
428 Ga0075429_100395444
429 Ga0075436_100001284
430 Ga0075435_100199664
431 Ga0075435_100372381
432 Ga0105240_10033573
433 Ga0111539_10007774
434 Ga0111539_10010442
435 Ga0105245_10073994
436 Ga0114129_10083969
437 Ga0114129_10184781
438 Ga0105243_11568058
439 Ga0105241_10232785
440 Ga0105242_10808872
441 Ga0105248_11017373
442 Ga0105237_10248818
443 Ga0105237_11303600
444 Ga0105238_10364570
445 Ga0105239_10135637
446 Ga0105239_10405130
447 Ga0157370_10166281
448 Ga0157370_10291102
449 Ga0157370_11073656
450 Ga0157369_10002883
451 Ga0157369_10016657
452 Ga0157369_10032625
453 Ga0157369_10042487
454 Ga0157369_10168631
455 Ga0157369_10618613
456 Ga0157374_10590137
457 Ga0157374_10594232
458 Ga0157378_10157323
459 Ga0157372_10025951
460 Ga0157372_10037070
461 Ga0157372_12274501
462 Ga0157375_10058838
463 Ga0182008_10327383
464 Ga0157379_10908576
465 Ga0157376_10698509
466 Ga0157376_10936307
467 Ga0206353_10109286
468 Ga0206353_10211348
469 Ga0213871_10005074
470 Ga0207647_10220371
471 Ga0207699_10056186
472 Ga0207684_10115424
473 Ga0207684_10125291
474 Ga0207684_10792246
475 Ga0207707_10003569
476 Ga0207707_10362349
477 Ga0207695_10082888
478 Ga0207695_10532127
479 Ga0207693_10009227
480 Ga0207693_10968689
481 Ga0207663_10215681
482 Ga0207663_10474765
483 Ga0207663_10850292
484 Ga0207660_10028521
485 Ga0207657_10001863
486 Ga0207657_10002974
487 Ga0207657_10094573
488 Ga0207657_10368514
489 Ga0207657_10482178
490 Ga0207649_10410605
491 Ga0207652_10326878
492 Ga0207652_10433776
493 Ga0207652_11131591
494 Ga0207646_10002184
495 Ga0207646_10151362
496 Ga0207646_10645975
497 Ga0207664_10281718
498 Ga0207690_10040417
499 Ga0207690_10284656
500 Ga0207686_10344835
501 Ga0207686_10572290
502 Ga0207709_10585548
503 Ga0207665_10014135
504 Ga0207665_10135284
505 Ga0207661_10331314
506 Ga0207679_10242281
507 Ga0207667_10036089
508 Ga0207667_10149756
509 Ga0207667_10382505
510 Ga0207651_10331846
511 Ga0207651_10981818
512 Ga0207640_10702264
513 Ga0207639_11536952
514 Ga0207678_10287813
515 Ga0207702_10098034
516 Ga0207702_10312911
517 Ga0207702_10433725
518 Ga0207702_10494384
519 Ga0207648_11138123
520 Ga0207674_10024779
521 Ga0207674_11213208
522 Ga0207675_100019432
523 Ga0207698_10008245
524 Ga0207428_10005373
525 Ga0207428_10442074
526 Ga0265323_10046624
527 Ga0265338_10010822
528 Ga0265338_10256439
529 Ga0265332_10097553
530 Ga0265325_10040367
531 Ga0265340_10139641
532 Ga0265339_10186351
533 Ga0265331_10193467
534 Ga0265331_10336358
535 Ga0265316_10022315
536 Ga0265316_10151963
537 Ga0265313_10023593
538 Ga0265314_10024769
539 Ga0265342_10108308
540 Ga0373939_0289512
541 Ga0373941_0404265
542 Ga0373925_0544929
543 Ga0395899_0039939
544 Ga0395899_0055509
545 Ga0395899_0057126
546 Ga0395899_0097487
547 Ga0395899_0221891
548 Ga0395900_0007041
549 Ga0395900_0018092
550 Ga0395900_0023265
551 Ga0395900_0091134
552 Ga0395898_0006567
553 Ga0395898_0012356
554 Ga0395898_0145173
555 Ga0395898_0283949
556 Ga0395898_0694013
557 Ga0395898_0864250
558 Ga0395905_0023700
559 Ga0395905_0058464
560 Ga0395905_0257647
561 Ga0395905_0533590
562 Ga0395905_0681208
563 Ga0395905_1592476
564 Ga0436364_1268184
565 Ga0395901_0012938
566 Ga0395901_0021782
567 Ga0395901_0027190
568 Ga0395901_0105959
569 Ga0395901_0291495
570 Ga0395901_0816002
571 Ga0436365_0125786
572 Ga0436360_0549902
573 Ga0436360_0848359
574 Ga0451793_1332436
575 Ga0451851_0142510
576 Ga0451853_0163298
577 Ga0450920_114557
578 Ga0466965_0435407
579 Ga0466961_0023024
580 Ga0466961_0078887
581 Ga0466961_0177731
582 Ga0466963_0005340
583 Ga0466963_0020429
584 Ga0466963_0089248
585 Ga0466963_0123405
586 Ga0466963_0141776
587 Ga0466964_0057896
588 Ga0466971_0000481
589 Ga0466968_0323482
590 Ga0466970_0215017
591 Ga0466957_0004494
592 Ga0466957_0334153
593 Ga0466960_0002491
594 Ga0466959_0005782
595 Ga0466959_0030826
596 Ga0466958_0010286
597 Ga0466958_0025656
598 Ga0466967_0022591
599 Ga0466967_0037037
600 Ga0466967_0040338
601 Ga0466967_0051535
602 Ga0466967_0132762
603 Ga0466967_0212783
604 Ga0466967_0529579
605 Ga0495603_0106410
606 Ga0495629_0322177
607 Ga0495605_0088441
608 Ga0495666_0349943
609 Ga0495652_0823520
610 Ga0495665_0456826
611 Ga0495657_0531823
612 Ga0495647_0118637
613 Ga0495604_0487111
614 Ga0496100_0003965
615 Ga0496100_0028494
616 Ga0496100_0047427
617 Ga0496101_0006368
618 Ga0496101_0009340
619 Ga0496101_0039665
620 Ga0496101_0875348
621 Ga0496102_0247858
622 Ga0496102_0250926
623 Ga0496103_0015122
624 Ga0496103_0532778
625 Ga0496104_0234563
626 Ga0496104_0856070
627 Ga0496104_1200619
628 Ga0496104_1498709
629 Ga0496105_0008236
630 Ga0496105_0011786
631 Ga0496105_0419271
632 Ga0496106_0012373
633 Ga0496107_0029154
634 Ga0496107_0030365
635 Ga0496108_0057723
636 Ga0496108_0144239
637 Ga0496109_0116146
638 Ga0496109_0362020
639 Ga0496110_0002690
640 Ga0496110_0029862
641 Ga0496110_0345792
642 Ga0496111_0030940
643 Ga0496111_0066949
644 Ga0496111_0115810
645 Ga0496112_0306861
646 Ga0496113_0048875
647 Ga0496113_0147593
648 Ga0496114_0002086
649 Ga0496114_0040275
650 Ga0496114_0060948
651 Ga0496114_0123573
652 Ga0496115_0001353
653 Ga0496115_0004453
654 Ga0496115_0792052
655 Ga0501033_0408921
656 Ga0501036_0762555
657 Ga0501038_0636119
658 Ga0501040_0363339
659 Ga0501041_0194052
660 Ga0501047_0170102
661 Ga0501047_1192312
662 Ga0501069_0296089
663 Ga0501070_0004310
664 Ga0501070_0212937
665 Ga0501075_0192074
666 Ga0501077_0029831
667 Ga0501079_0198442
668 Ga0501080_0073314
669 Ga0501080_0469222
670 Ga0501080_0910053
671 Ga0501081_0179675
672 Ga0501083_0306820
673 Ga0501044_0237404
674 nmdc:mga05p37_13674_c1
675 nmdc:mga06r32_5579_c1
676 nmdc:mga08y16_24877_c1
677 nmdc:mga08y16_46532_c1
678 nmdc:mga0n895_561212_c1
679 nmdc:mga0n895_6963_c1
680 nmdc:mga0rr50_1112_c1
681 nmdc:mga08x19_72835_c1
682 nmdc:mga0a205_6910_c1
683 Ga0495601_0064659
684 Ga0495655_0088433
685 Ga0501084_0854987
686 Ga0501082_0157920
687 Ga0466962_0004258
688 Ga0466962_0229819
689 Ga0466962_0460570
690 Ga0530510_0807964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04417

DUF501

Protein of unknown function (DUF501)

23

94

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v0i-assembly3.cif.gz_C crystal structure of a celr catalytic domain active site mutant with bound cellohexaose substrate 0.4039 116 147
1x6o-assembly1.cif.gz_A structural analysis of leishmania braziliensis eukaryotic initiation factor 5a 0.3781 16 67
5c4i-assembly1.cif.gz_E structure of an oxalate oxidoreductase 0.3247 102 146
3syj-assembly1.cif.gz_A-2 crystal structure of the haemophilus influenzae hap adhesin 0.3002 4 47
5wrw-assembly2.cif.gz_D structure of human apo-srp72 0.2991 51 137
ID Description Score Start End Superfamily
af_Q9FL33_267_656_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.4256 79 137 3.40.50.300
1nd4B02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.4193 116 145 3.90.1200.10
af_Q4E329_479_605_1.20.1060.10 Mainly Alpha;Up-down Bundle;Taq DNA Polymerase; Chain T, domain 4;Taq DNA Polymerase; Chain T, domain 4 0.3328 55 137 1.20.1060.10
af_Q9V3X5_873_937_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3243 69 143 1.25.40.10
af_Q7X766_40_175_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.3188 52 137 1.10.520.10
ID Description Score Start End GO Terms
AF-A0A538DC47-F1-model_v4 DUF501 domain-containing protein 0.985 3 150
AF-A0A538CLI1-F1-model_v4 DUF501 domain-containing protein 0.9846 1 150
AF-A0A538DRS2-F1-model_v4 DUF501 domain-containing protein 0.9846 26 150
AF-A0A537ZTE1-F1-model_v4 DUF501 domain-containing protein 0.9795 1 150
AF-A0A538G6S4-F1-model_v4 DUF501 domain-containing protein 0.979 1 127

Map