F416419

General Info

Members Datasets Scaffolds Average Seq Length
345 212 690 267

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10010360|Ga0207683_100103605
Length 267
Sequence VTSEQPEKLRLGGMALRNGLLIHGPTHWAAAVRDGDGKIEVASERKPELAPGLVAKLPGLRGPIKLAEAIAVLPLVRRRMRSARLPFEDTRVIAAAALTIGATSLLRRRGRASATREGLLQAIGALPALVALSDRDLAAYHGAEHKTIAAYERGVVEDVAGVPKEHDRCGSNLVVPMMLLSAGGTVLLERLVAKPSPAVRAGVGLGGASLAVEMFAWSDRHHGDPLAEAFHTPGREIQRHWATKEPTPDQLDVAVAALEEILRAEAA

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
98 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
115 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
146 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
147 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
210 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.87
Nodule 0
Rhizoplane 10.14
Rhizosphere 83.48
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10010360 3300026121 Bacteria 7953
2 JGI25406J46586_10035171 3300003203 Bacteria 1830
3 Ga0070683_100004842 3300005329 Bacteria 11145
4 Ga0070683_100015414 3300005329 Bacteria 6713
5 Ga0070683_100159534 3300005329 Bacteria 2139
6 Ga0070677_10000006 3300005333 Bacteria 75244
7 Ga0070666_10010127 3300005335 Bacteria 5888
8 Ga0070666_10123568 3300005335 Bacteria 1796
9 Ga0070680_100011336 3300005336 Bacteria 6894
10 Ga0070680_100562557 3300005336 Bacteria 978
11 Ga0070682_100000029 3300005337 Bacteria 183516
12 Ga0070682_100000815 3300005337 Bacteria 18228
13 Ga0068868_100001567 3300005338 Bacteria 15608
14 Ga0070691_10000069 3300005341 Bacteria 28638
15 Ga0070668_100040135 3300005347 Bacteria 3581
16 Ga0070674_100000014 3300005356 Bacteria 100122
17 Ga0070673_100019029 3300005364 Bacteria 4925
18 Ga0070659_100009701 3300005366 Bacteria 7074
19 Ga0070667_100001368 3300005367 Bacteria 21878
20 Ga0070667_100102281 3300005367 Bacteria 2476
21 Ga0070709_10389604 3300005434 Bacteria 1038
22 Ga0070714_100119772 3300005435 Bacteria 2340
23 Ga0070713_100000076 3300005436 Bacteria 61668
24 Ga0070701_10058478 3300005438 Bacteria 2024
25 Ga0070678_100009910 3300005456 Bacteria 5791
26 Ga0070662_100000008 3300005457 Bacteria 168754
27 Ga0068867_100000247 3300005459 Bacteria 35692
28 Ga0070679_100000651 3300005530 Bacteria 29562
29 Ga0070679_100114971 3300005530 Bacteria 2676
30 Ga0070684_100022755 3300005535 Bacteria 5232
31 Ga0070693_100000398 3300005547 Bacteria 19763
32 Ga0070665_100022800 3300005548 Bacteria 6303
33 Ga0070665_100160727 3300005548 Bacteria 2248
34 Ga0070665_100765133 3300005548 Bacteria 979
35 Ga0070664_100108418 3300005564 Bacteria 2422
36 Ga0068854_100000115 3300005578 Bacteria 55089
37 Ga0068854_100001265 3300005578 Bacteria 15181
38 Ga0068856_100010700 3300005614 Bacteria 8912
39 Ga0068852_100320928 3300005616 Bacteria 1504
40 Ga0068859_100834598 3300005617 Bacteria 1008
41 Ga0068864_100000044 3300005618 Bacteria 157919
42 Ga0068866_10000002 3300005718 Bacteria 394090
43 Ga0068866_10000219 3300005718 Bacteria 27162
44 Ga0068861_100387707 3300005719 Unclassified 1236
45 Ga0068851_10001867 3300005834 Bacteria 9251
46 Ga0068851_10022934 3300005834 Bacteria 3047
47 Ga0068863_100000042 3300005841 Bacteria 154459
48 Ga0068863_100003904 3300005841 Bacteria 14726
49 Ga0068858_100000155 3300005842 Bacteria 72794
50 Ga0068858_100064971 3300005842 Bacteria 3377
51 Ga0068862_100010337 3300005844 Bacteria 7701
52 Ga0081455_10100357 3300005937 Bacteria 2326
53 Ga0081540_1021526 3300005983 Bacteria 3834
54 Ga0081539_10001100 3300005985 Bacteria 49090
55 Ga0070715_10000015 3300006163 Bacteria 152816
56 Ga0097621_100124280 3300006237 Bacteria 2191
57 Ga0097620_100834655 3300006931 Bacteria 1008
58 Ga0105240_10196241 3300009093 Bacteria 2370
59 Ga0105245_10000053 3300009098 Bacteria 125678
60 Ga0105245_10001015 3300009098 Bacteria 25483
61 Ga0105245_10002749 3300009098 Bacteria 15821
62 Ga0105247_10148608 3300009101 Bacteria 1542
63 Ga0105242_10008605 3300009176 Bacteria 7837
64 Ga0105238_10000299 3300009551 Bacteria 54293
65 Ga0105249_10000085 3300009553 Bacteria 133497
66 Ga0105249_10280463 3300009553 Bacteria 1664
67 Ga0105239_10059429 3300010375 Bacteria 4196
68 Ga0157374_10002177 3300013296 Bacteria 16513
69 Ga0157372_10000616 3300013307 Bacteria 38850
70 Ga0157375_10008882 3300013308 Bacteria 8794
71 Ga0163163_10164392 3300014325 Bacteria 2265
72 Ga0157380_10000080 3300014326 Bacteria 53731
73 Ga0157379_10055979 3300014968 Bacteria 3525
74 Ga0157379_10121840 3300014968 Bacteria 2346
75 Ga0163161_10009328 3300017792 Bacteria 6790
76 Ga0207656_10000354 3300025321 Bacteria 15472
77 Ga0207656_10004306 3300025321 Bacteria 4960
78 Ga0207682_10000228 3300025893 Bacteria 25297
79 Ga0207642_10000001 3300025899 Bacteria 714030
80 Ga0207642_10000003 3300025899 Bacteria 650651
81 Ga0207642_10000094 3300025899 Bacteria 23395
82 Ga0207710_10060648 3300025900 Bacteria 1715
83 Ga0207685_10000001 3300025905 Bacteria 604473
84 Ga0207705_10168384 3300025909 Bacteria 1649
85 Ga0207707_10065523 3300025912 Bacteria 3164
86 Ga0207660_10083546 3300025917 Bacteria 2352
87 Ga0207660_10339435 3300025917 Bacteria 1202
88 Ga0207657_10243254 3300025919 Bacteria 1436
89 Ga0207652_10000150 3300025921 Bacteria 75189
90 Ga0207652_10015731 3300025921 Bacteria 6162
91 Ga0207694_10000035 3300025924 Bacteria 195870
92 Ga0207694_10327799 3300025924 Bacteria 1264
93 Ga0207687_10000021 3300025927 Bacteria 226396
94 Ga0207687_10000350 3300025927 Bacteria 30682
95 Ga0207687_10000716 3300025927 Bacteria 22524
96 Ga0207700_10000009 3300025928 Bacteria 314953
97 Ga0207664_10056834 3300025929 Bacteria 3109
98 Ga0207664_10081702 3300025929 Bacteria 2631
99 Ga0207690_10006983 3300025932 Bacteria 6695
100 Ga0207706_10000016 3300025933 Bacteria 170697
101 Ga0207686_10000029 3300025934 Bacteria 160239
102 Ga0207670_10088283 3300025936 Bacteria 2186
103 Ga0207670_10131550 3300025936 Bacteria 1834
104 Ga0207669_10000007 3300025937 Bacteria 169904
105 Ga0207669_10000027 3300025937 Bacteria 91216
106 Ga0207704_10049105 3300025938 Bacteria 2536
107 Ga0207661_10003394 3300025944 Bacteria 11055
108 Ga0207661_10007802 3300025944 Bacteria 7623
109 Ga0207661_10142891 3300025944 Bacteria 2061
110 Ga0207679_10101689 3300025945 Bacteria 2249
111 Ga0207651_10029595 3300025960 Bacteria 3472
112 Ga0207712_10000033 3300025961 Bacteria 209336
113 Ga0207712_10009331 3300025961 Bacteria 6208
114 Ga0207712_10240643 3300025961 Bacteria 1457
115 Ga0207640_10000059 3300025981 Bacteria 90901
116 Ga0207640_10001105 3300025981 Bacteria 14885
117 Ga0207658_10001768 3300025986 Bacteria 16221
118 Ga0207677_10002226 3300026023 Bacteria 10184
119 Ga0207703_10000266 3300026035 Bacteria 58337
120 Ga0207639_10003854 3300026041 Bacteria 10101
121 Ga0207678_10074841 3300026067 Bacteria 2901
122 Ga0207702_10007605 3300026078 Bacteria 9224
123 Ga0207641_10000231 3300026088 Bacteria 72245
124 Ga0207641_10002660 3300026088 Bacteria 16331
125 Ga0207641_10097205 3300026088 Bacteria 2588
126 Ga0207641_10537953 3300026088 Bacteria 1138
127 Ga0207648_10000230 3300026089 Bacteria 59713
128 Ga0207676_10000043 3300026095 Bacteria 161948
129 Ga0207675_100133541 3300026118 Bacteria 2354
130 Ga0207675_100345374 3300026118 Unclassified 1457
131 Ga0207683_10121638 3300026121 Bacteria 2344
132 Ga0207698_10271061 3300026142 Bacteria 1565
133 Ga0268266_10000076 3300028379 Bacteria 217644
134 Ga0268266_10000664 3300028379 Bacteria 46506
135 Ga0268266_10110420 3300028379 Bacteria 2436
136 Ga0268266_10288710 3300028379 Bacteria 1527
137 Ga0268265_10054427 3300028380 Bacteria 3036
138 Ga0268264_10056131 3300028381 Bacteria 3291
139 Ga0268264_10070092 3300028381 Bacteria 2967
140 Ga0265319_1000029 3300028563 Bacteria 131291
141 Ga0265338_10000179 3300028800 Bacteria 117995
142 Ga0265332_10128048 3300031238 Unclassified 1065
143 Ga0265325_10011215 3300031241 Bacteria 5154
144 Ga0265316_10205207 3300031344 Bacteria 1460
145 Ga0307513_10210041 3300031456 Bacteria 1779
146 Ga0373957_0166282 3300035120 Bacteria 910
147 Ga0373933_0065959 3300035724 Bacteria 2193
148 Ga0373937_0041924 3300036401 Bacteria 4177
149 Ga0373937_0067722 3300036401 Bacteria 3290
150 Ga0451853_0674116 3300041512 Bacteria 5453
151 Ga0466967_0038536 3300045976 Bacteria 4100
152 Ga0495592_0000521 3300046454 Bacteria 27805
153 Ga0495603_0000045 3300046455 Bacteria 53543
154 Ga0495629_0001361 3300046459 Bacteria 19270
155 Ga0495629_0001391 3300046459 Bacteria 19098
156 Ga0495629_0011806 3300046459 Bacteria 6337
157 Ga0495638_0005536 3300046460 Bacteria 9366
158 Ga0495641_0000001 3300046461 Bacteria 485224
159 Ga0495641_0104917 3300046461 Bacteria 1261
160 Ga0495651_0369782 3300046462 Bacteria 943
161 Ga0495639_0030389 3300046475 Bacteria 2401
162 Ga0495662_0000137 3300046476 Bacteria 28083
163 Ga0495594_0000276 3300046499 Bacteria 25314
164 Ga0495606_0000045 3300046507 Bacteria 212105
165 Ga0495608_0000001 3300046511 Bacteria 411278
166 Ga0495608_0000163 3300046511 Bacteria 47170
167 Ga0495618_0001468 3300046514 Bacteria 15801
168 Ga0495620_0001840 3300046515 Bacteria 12507
169 Ga0495628_0000858 3300046516 Bacteria 28086
170 Ga0495628_0026019 3300046516 Bacteria 4777
171 Ga0495628_0271155 3300046516 Bacteria 1262
172 Ga0495628_0285255 3300046516 Bacteria 1225
173 Ga0495630_0000037 3300046517 Bacteria 114404
174 Ga0495630_0533473 3300046517 Bacteria 900
175 Ga0495652_0000086 3300046529 Bacteria 99373
176 Ga0495652_0055999 3300046529 Bacteria 3351
177 Ga0495586_0007201 3300046535 Bacteria 5933
178 Ga0495587_0001022 3300046536 Bacteria 18410
179 Ga0495587_0029073 3300046536 Bacteria 3357
180 Ga0495587_0270744 3300046536 Bacteria 953
181 Ga0495598_0003687 3300046537 Bacteria 3273
182 Ga0495645_0092735 3300046543 Bacteria 2156
183 Ga0495645_0203994 3300046543 Bacteria 1339
184 Ga0495622_0000690 3300046557 Bacteria 19165
185 Ga0495633_0006532 3300046558 Bacteria 6890
186 Ga0495634_0004564 3300046642 Bacteria 10814
187 Ga0495634_0068337 3300046642 Bacteria 2348
188 Ga0495634_0242840 3300046642 Bacteria 1104
189 Ga0495635_0000063 3300046663 Bacteria 65304
190 Ga0495635_0042554 3300046663 Bacteria 3136
191 Ga0495588_0000179 3300046674 Bacteria 77030
192 Ga0495588_0163497 3300046674 Bacteria 1177
193 Ga0495657_0000002 3300046675 Bacteria 411958
194 Ga0495657_0014113 3300046675 Bacteria 5871
195 Ga0495657_0058936 3300046675 Bacteria 2548
196 Ga0495647_0000003 3300046681 Bacteria 145235
197 Ga0495647_0003248 3300046681 Bacteria 5203
198 Ga0495647_0008323 3300046681 Bacteria 3485
199 Ga0495658_0000008 3300046683 Bacteria 115426
200 Ga0495669_0000651 3300046684 Bacteria 15129
201 Ga0495613_0000298 3300046689 Bacteria 44864
202 Ga0495613_0000369 3300046689 Bacteria 39198
203 Ga0495624_0000164 3300046690 Bacteria 48886
204 Ga0495624_0002296 3300046690 Bacteria 14562
205 Ga0495624_0003753 3300046690 Bacteria 11225
206 Ga0495670_0007059 3300046691 Bacteria 5530
207 Ga0495600_0035731 3300046809 Bacteria 3229
208 Ga0495600_0119424 3300046809 Bacteria 1715
209 Ga0495604_0000033 3300047317 Bacteria 134810
210 Ga0495604_0000850 3300047317 Bacteria 25489
211 Ga0495604_0050587 3300047317 Bacteria 3226
212 Ga0495672_0211039 3300047320 Bacteria 964
213 Ga0495676_0000652 3300047321 Bacteria 28858
214 Ga0495676_0001759 3300047321 Bacteria 18921
215 Ga0495676_0007512 3300047321 Bacteria 9996
216 Ga0495676_0095698 3300047321 Bacteria 2209
217 Ga0495676_0131933 3300047321 Bacteria 1802
218 Ga0495680_0000215 3300047322 Bacteria 63049
219 Ga0495680_0036038 3300047322 Bacteria 3977
220 Ga0495680_0059144 3300047322 Bacteria 2960
221 Ga0495680_0066993 3300047322 Bacteria 2746
222 Ga0495680_0264749 3300047322 Bacteria 1215
223 Ga0495675_0000046 3300047444 Bacteria 82596
224 Ga0495679_009212 3300047446 Bacteria 3966
225 Ga0495685_033392 3300047447 Bacteria 1767
226 Ga0495684_0279981 3300047471 Unclassified 1204
227 Ga0495686_0084474 3300047472 Bacteria 1935
228 Ga0495593_0010922 3300047673 Bacteria 5230
229 Ga0495602_0000010 3300048088 Bacteria 212121
230 Ga0495602_0000188 3300048088 Bacteria 58305
231 Ga0496100_0000003 3300048903 Bacteria 360802
232 Ga0496101_0000003 3300048904 Bacteria 406565
233 Ga0496102_0000965 3300048905 Bacteria 27059
234 Ga0496102_0041849 3300048905 Bacteria 4150
235 Ga0496102_0449642 3300048905 Bacteria 1209
236 Ga0496103_0000627 3300048906 Bacteria 27075
237 Ga0496103_0012939 3300048906 Bacteria 4950
238 Ga0496103_0042724 3300048906 Bacteria 2790
239 Ga0496104_0000066 3300048907 Bacteria 108721
240 Ga0496104_0061354 3300048907 Bacteria 3565
241 Ga0496105_0000020 3300048908 Bacteria 181484
242 Ga0496105_0004549 3300048908 Bacteria 10446
243 Ga0496105_0011713 3300048908 Bacteria 6939
244 Ga0496106_0000015 3300048909 Bacteria 187570
245 Ga0496106_0000160 3300048909 Bacteria 48936
246 Ga0496107_0000008 3300048910 Bacteria 251874
247 Ga0496107_0052097 3300048910 Bacteria 2952
248 Ga0496108_0000002 3300048911 Bacteria 700890
249 Ga0496109_0000001 3300048912 Bacteria 700852
250 Ga0496109_0042252 3300048912 Bacteria 4129
251 Ga0496109_0441052 3300048912 Bacteria 1230
252 Ga0496110_0002971 3300048913 Bacteria 12859
253 Ga0496111_0000022 3300048914 Bacteria 66777
254 Ga0496111_0169367 3300048914 Bacteria 1623
255 Ga0496112_0000003 3300048915 Bacteria 660147
256 Ga0496112_0006530 3300048915 Bacteria 10256
257 Ga0496112_0858374 3300048915 Bacteria 831
258 Ga0496113_0000093 3300048916 Bacteria 38914
259 Ga0496113_0017949 3300048916 Bacteria 4920
260 Ga0496113_0058250 3300048916 Bacteria 2906
261 Ga0496113_0199065 3300048916 Bacteria 1592
262 Ga0496114_0000010 3300048917 Bacteria 363396
263 Ga0496114_0030582 3300048917 Bacteria 4431
264 Ga0496115_0000004 3300048918 Bacteria 319734
265 Ga0496115_0019408 3300048918 Bacteria 5230
266 Ga0496116_0000014 3300048919 Bacteria 569049
267 Ga0496117_0001652 3300048920 Bacteria 31325
268 Ga0496117_0274128 3300048920 Bacteria 907
269 Ga0496118_0002996 3300048921 Bacteria 21807
270 Ga0496118_0099062 3300048921 Bacteria 1977
271 Ga0496119_0000862 3300048922 Bacteria 40026
272 Ga0496119_0012555 3300048922 Bacteria 6866
273 Ga0496119_0083811 3300048922 Bacteria 1829
274 Ga0496119_0109236 3300048922 Bacteria 1538
275 Ga0496120_0009355 3300048923 Bacteria 6964
276 Ga0496121_0020660 3300048924 Bacteria 6500
277 Ga0496125_0039010 3300048928 Bacteria 4099
278 Ga0496125_0047605 3300048928 Bacteria 3583
279 Ga0496125_0113850 3300048928 Bacteria 1950
280 Ga0496126_0018873 3300048929 Bacteria 6814
281 Ga0496126_0118335 3300048929 Bacteria 2300
282 Ga0496126_0167541 3300048929 Bacteria 1874
283 Ga0501031_0000585 3300049568 Bacteria 21428
284 Ga0501032_0001884 3300049569 Bacteria 16573
285 Ga0501032_0245831 3300049569 Bacteria 1162
286 Ga0501033_0002159 3300049570 Bacteria 17021
287 Ga0501034_0005810 3300049571 Bacteria 13419
288 Ga0501034_0290684 3300049571 Bacteria 1572
289 Ga0501036_0000287 3300049572 Bacteria 34898
290 Ga0501037_0014546 3300049573 Bacteria 5789
291 Ga0501038_0001843 3300049574 Bacteria 19593
292 Ga0501039_0178285 3300049575 Bacteria 1671
293 Ga0501040_0034880 3300049576 Bacteria 3409
294 Ga0501042_0069151 3300049578 Bacteria 2525
295 Ga0501043_0001114 3300049579 Bacteria 23603
296 Ga0501046_0000622 3300049580 Bacteria 34857
297 Ga0501046_0257161 3300049580 Bacteria 1284
298 Ga0501047_0002607 3300049581 Bacteria 17167
299 Ga0501047_0028421 3300049581 Bacteria 5391
300 Ga0501047_0155697 3300049581 Bacteria 2159
301 Ga0501048_0000278 3300049582 Bacteria 34571
302 Ga0501048_0324792 3300049582 Bacteria 1096
303 Ga0501069_0003049 3300049585 Bacteria 8601
304 Ga0501069_0200737 3300049585 Bacteria 1155
305 Ga0501070_0011408 3300049586 Bacteria 7509
306 Ga0501070_0082163 3300049586 Bacteria 2666
307 Ga0501070_0454593 3300049586 Bacteria 1032
308 Ga0501071_0030888 3300049587 Bacteria 3792
309 Ga0501071_0088414 3300049587 Bacteria 2273
310 Ga0501072_0202272 3300049588 Bacteria 1584
311 Ga0501073_0001738 3300049589 Bacteria 16189
312 Ga0501074_0010504 3300049590 Bacteria 6720
313 Ga0501074_0183934 3300049590 Bacteria 1490
314 Ga0501075_0007890 3300049591 Bacteria 7391
315 Ga0501079_0001101 3300049741 Bacteria 18769
316 Ga0501080_0003621 3300049742 Bacteria 13614
317 Ga0501083_0005448 3300049744 Bacteria 9013
318 Ga0501083_0017005 3300049744 Bacteria 5078
319 Ga0501083_0031277 3300049744 Bacteria 3653
320 Ga0501083_0067130 3300049744 Bacteria 2388
321 Ga0501035_0002753 3300049822 Bacteria 17037
322 Ga0501044_0003708 3300049823 Bacteria 17167
323 Ga0501044_0164207 3300049823 Bacteria 2195
324 Ga0501044_0303383 3300049823 Bacteria 1525
325 Ga0501045_0278390 3300049824 Bacteria 1245
326 nmdc:mga0rr50_107514_c1 3300050513 Bacteria 2202
327 Ga0495601_0000012 3300053077 Bacteria 227853
328 Ga0495601_0000169 3300053077 Bacteria 35095
329 Ga0495601_0012989 3300053077 Bacteria 5002
330 Ga0495601_0062830 3300053077 Bacteria 2359
331 Ga0495612_0001003 3300053078 Bacteria 11610
332 Ga0495612_0039082 3300053078 Bacteria 1929
333 Ga0495655_0000003 3300053083 Bacteria 303053
334 Ga0495655_0000471 3300053083 Bacteria 6767
335 Ga0495595_0000001 3300053084 Bacteria 495226
336 Ga0495595_0000372 3300053084 Bacteria 17048
337 Ga0495595_0001241 3300053084 Bacteria 9932
338 Ga0495619_0000018 3300053085 Bacteria 209943
339 Ga0495619_0000120 3300053085 Bacteria 58265
340 Ga0495619_0000408 3300053085 Bacteria 29246
341 Ga0495619_0011996 3300053085 Bacteria 5459
342 Ga0500614_000374 3300053123 Bacteria 11670
343 Ga0500628_000002 3300053129 Bacteria 357687
344 Ga0500658_0077813 3300053134 Bacteria 1413
345 Ga0501084_0046307 3300054114 Bacteria 3643
346 Ga0207683_10010360
347 JGI25406J46586_10035171
348 Ga0070683_100004842
349 Ga0070683_100015414
350 Ga0070683_100159534
351 Ga0070677_10000006
352 Ga0070666_10010127
353 Ga0070666_10123568
354 Ga0070680_100011336
355 Ga0070680_100562557
356 Ga0070682_100000029
357 Ga0070682_100000815
358 Ga0068868_100001567
359 Ga0070691_10000069
360 Ga0070668_100040135
361 Ga0070674_100000014
362 Ga0070673_100019029
363 Ga0070659_100009701
364 Ga0070667_100001368
365 Ga0070667_100102281
366 Ga0070709_10389604
367 Ga0070714_100119772
368 Ga0070713_100000076
369 Ga0070701_10058478
370 Ga0070678_100009910
371 Ga0070662_100000008
372 Ga0068867_100000247
373 Ga0070679_100000651
374 Ga0070679_100114971
375 Ga0070684_100022755
376 Ga0070693_100000398
377 Ga0070665_100022800
378 Ga0070665_100160727
379 Ga0070665_100765133
380 Ga0070664_100108418
381 Ga0068854_100000115
382 Ga0068854_100001265
383 Ga0068856_100010700
384 Ga0068852_100320928
385 Ga0068859_100834598
386 Ga0068864_100000044
387 Ga0068866_10000002
388 Ga0068866_10000219
389 Ga0068861_100387707
390 Ga0068851_10001867
391 Ga0068851_10022934
392 Ga0068863_100000042
393 Ga0068863_100003904
394 Ga0068858_100000155
395 Ga0068858_100064971
396 Ga0068862_100010337
397 Ga0081455_10100357
398 Ga0081540_1021526
399 Ga0081539_10001100
400 Ga0070715_10000015
401 Ga0097621_100124280
402 Ga0097620_100834655
403 Ga0105240_10196241
404 Ga0105245_10000053
405 Ga0105245_10001015
406 Ga0105245_10002749
407 Ga0105247_10148608
408 Ga0105242_10008605
409 Ga0105238_10000299
410 Ga0105249_10000085
411 Ga0105249_10280463
412 Ga0105239_10059429
413 Ga0157374_10002177
414 Ga0157372_10000616
415 Ga0157375_10008882
416 Ga0163163_10164392
417 Ga0157380_10000080
418 Ga0157379_10055979
419 Ga0157379_10121840
420 Ga0163161_10009328
421 Ga0207656_10000354
422 Ga0207656_10004306
423 Ga0207682_10000228
424 Ga0207642_10000001
425 Ga0207642_10000003
426 Ga0207642_10000094
427 Ga0207710_10060648
428 Ga0207685_10000001
429 Ga0207705_10168384
430 Ga0207707_10065523
431 Ga0207660_10083546
432 Ga0207660_10339435
433 Ga0207657_10243254
434 Ga0207652_10000150
435 Ga0207652_10015731
436 Ga0207694_10000035
437 Ga0207694_10327799
438 Ga0207687_10000021
439 Ga0207687_10000350
440 Ga0207687_10000716
441 Ga0207700_10000009
442 Ga0207664_10056834
443 Ga0207664_10081702
444 Ga0207690_10006983
445 Ga0207706_10000016
446 Ga0207686_10000029
447 Ga0207670_10088283
448 Ga0207670_10131550
449 Ga0207669_10000007
450 Ga0207669_10000027
451 Ga0207704_10049105
452 Ga0207661_10003394
453 Ga0207661_10007802
454 Ga0207661_10142891
455 Ga0207679_10101689
456 Ga0207651_10029595
457 Ga0207712_10000033
458 Ga0207712_10009331
459 Ga0207712_10240643
460 Ga0207640_10000059
461 Ga0207640_10001105
462 Ga0207658_10001768
463 Ga0207677_10002226
464 Ga0207703_10000266
465 Ga0207639_10003854
466 Ga0207678_10074841
467 Ga0207702_10007605
468 Ga0207641_10000231
469 Ga0207641_10002660
470 Ga0207641_10097205
471 Ga0207641_10537953
472 Ga0207648_10000230
473 Ga0207676_10000043
474 Ga0207675_100133541
475 Ga0207675_100345374
476 Ga0207683_10121638
477 Ga0207698_10271061
478 Ga0268266_10000076
479 Ga0268266_10000664
480 Ga0268266_10110420
481 Ga0268266_10288710
482 Ga0268265_10054427
483 Ga0268264_10056131
484 Ga0268264_10070092
485 Ga0265319_1000029
486 Ga0265338_10000179
487 Ga0265332_10128048
488 Ga0265325_10011215
489 Ga0265316_10205207
490 Ga0307513_10210041
491 Ga0373957_0166282
492 Ga0373933_0065959
493 Ga0373937_0041924
494 Ga0373937_0067722
495 Ga0451853_0674116
496 Ga0466967_0038536
497 Ga0495592_0000521
498 Ga0495603_0000045
499 Ga0495629_0001361
500 Ga0495629_0001391
501 Ga0495629_0011806
502 Ga0495638_0005536
503 Ga0495641_0000001
504 Ga0495641_0104917
505 Ga0495651_0369782
506 Ga0495639_0030389
507 Ga0495662_0000137
508 Ga0495594_0000276
509 Ga0495606_0000045
510 Ga0495608_0000001
511 Ga0495608_0000163
512 Ga0495618_0001468
513 Ga0495620_0001840
514 Ga0495628_0000858
515 Ga0495628_0026019
516 Ga0495628_0271155
517 Ga0495628_0285255
518 Ga0495630_0000037
519 Ga0495630_0533473
520 Ga0495652_0000086
521 Ga0495652_0055999
522 Ga0495586_0007201
523 Ga0495587_0001022
524 Ga0495587_0029073
525 Ga0495587_0270744
526 Ga0495598_0003687
527 Ga0495645_0092735
528 Ga0495645_0203994
529 Ga0495622_0000690
530 Ga0495633_0006532
531 Ga0495634_0004564
532 Ga0495634_0068337
533 Ga0495634_0242840
534 Ga0495635_0000063
535 Ga0495635_0042554
536 Ga0495588_0000179
537 Ga0495588_0163497
538 Ga0495657_0000002
539 Ga0495657_0014113
540 Ga0495657_0058936
541 Ga0495647_0000003
542 Ga0495647_0003248
543 Ga0495647_0008323
544 Ga0495658_0000008
545 Ga0495669_0000651
546 Ga0495613_0000298
547 Ga0495613_0000369
548 Ga0495624_0000164
549 Ga0495624_0002296
550 Ga0495624_0003753
551 Ga0495670_0007059
552 Ga0495600_0035731
553 Ga0495600_0119424
554 Ga0495604_0000033
555 Ga0495604_0000850
556 Ga0495604_0050587
557 Ga0495672_0211039
558 Ga0495676_0000652
559 Ga0495676_0001759
560 Ga0495676_0007512
561 Ga0495676_0095698
562 Ga0495676_0131933
563 Ga0495680_0000215
564 Ga0495680_0036038
565 Ga0495680_0059144
566 Ga0495680_0066993
567 Ga0495680_0264749
568 Ga0495675_0000046
569 Ga0495679_009212
570 Ga0495685_033392
571 Ga0495684_0279981
572 Ga0495686_0084474
573 Ga0495593_0010922
574 Ga0495602_0000010
575 Ga0495602_0000188
576 Ga0496100_0000003
577 Ga0496101_0000003
578 Ga0496102_0000965
579 Ga0496102_0041849
580 Ga0496102_0449642
581 Ga0496103_0000627
582 Ga0496103_0012939
583 Ga0496103_0042724
584 Ga0496104_0000066
585 Ga0496104_0061354
586 Ga0496105_0000020
587 Ga0496105_0004549
588 Ga0496105_0011713
589 Ga0496106_0000015
590 Ga0496106_0000160
591 Ga0496107_0000008
592 Ga0496107_0052097
593 Ga0496108_0000002
594 Ga0496109_0000001
595 Ga0496109_0042252
596 Ga0496109_0441052
597 Ga0496110_0002971
598 Ga0496111_0000022
599 Ga0496111_0169367
600 Ga0496112_0000003
601 Ga0496112_0006530
602 Ga0496112_0858374
603 Ga0496113_0000093
604 Ga0496113_0017949
605 Ga0496113_0058250
606 Ga0496113_0199065
607 Ga0496114_0000010
608 Ga0496114_0030582
609 Ga0496115_0000004
610 Ga0496115_0019408
611 Ga0496116_0000014
612 Ga0496117_0001652
613 Ga0496117_0274128
614 Ga0496118_0002996
615 Ga0496118_0099062
616 Ga0496119_0000862
617 Ga0496119_0012555
618 Ga0496119_0083811
619 Ga0496119_0109236
620 Ga0496120_0009355
621 Ga0496121_0020660
622 Ga0496125_0039010
623 Ga0496125_0047605
624 Ga0496125_0113850
625 Ga0496126_0018873
626 Ga0496126_0118335
627 Ga0496126_0167541
628 Ga0501031_0000585
629 Ga0501032_0001884
630 Ga0501032_0245831
631 Ga0501033_0002159
632 Ga0501034_0005810
633 Ga0501034_0290684
634 Ga0501036_0000287
635 Ga0501037_0014546
636 Ga0501038_0001843
637 Ga0501039_0178285
638 Ga0501040_0034880
639 Ga0501042_0069151
640 Ga0501043_0001114
641 Ga0501046_0000622
642 Ga0501046_0257161
643 Ga0501047_0002607
644 Ga0501047_0028421
645 Ga0501047_0155697
646 Ga0501048_0000278
647 Ga0501048_0324792
648 Ga0501069_0003049
649 Ga0501069_0200737
650 Ga0501070_0011408
651 Ga0501070_0082163
652 Ga0501070_0454593
653 Ga0501071_0030888
654 Ga0501071_0088414
655 Ga0501072_0202272
656 Ga0501073_0001738
657 Ga0501074_0010504
658 Ga0501074_0183934
659 Ga0501075_0007890
660 Ga0501079_0001101
661 Ga0501080_0003621
662 Ga0501083_0005448
663 Ga0501083_0017005
664 Ga0501083_0031277
665 Ga0501083_0067130
666 Ga0501035_0002753
667 Ga0501044_0003708
668 Ga0501044_0164207
669 Ga0501044_0303383
670 Ga0501045_0278390
671 nmdc:mga0rr50_107514_c1
672 Ga0495601_0000012
673 Ga0495601_0000169
674 Ga0495601_0012989
675 Ga0495601_0062830
676 Ga0495612_0001003
677 Ga0495612_0039082
678 Ga0495655_0000003
679 Ga0495655_0000471
680 Ga0495595_0000001
681 Ga0495595_0000372
682 Ga0495595_0001241
683 Ga0495619_0000018
684 Ga0495619_0000120
685 Ga0495619_0000408
686 Ga0495619_0011996
687 Ga0500614_000374
688 Ga0500628_000002
689 Ga0500658_0077813
690 Ga0501084_0046307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07136

DUF1385

Protein of unknown function (DUF1385)

127

264

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iys-assembly1.cif.gz_O-2 loop deletion and proline insertion mutant (deleting six residues and inserted three proline residues) 0.773 19 47
3na5-assembly1.cif.gz_B crystal structure of a bacterial phosphoglucomutase, an enzyme important in the virulence of several human pathogens. 0.7699 20 45
8h0n-assembly1.cif.gz_A crystal structure of the human mettl1-wdr4 complex 0.7657 11 45
7u20-assembly1.cif.gz_B crystal structure of human mettl1 and wdr4 complex 0.7653 11 45
5cyb-assembly1.cif.gz_A-2 structure of a lipocalin lipoprotein affecting virulence in streptococcus pneumoniae 0.75 12 45
ID Description Score Start End Superfamily
af_Q20977_456_539_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.7364 25 45 3.30.505.10
af_Q86MP3_34_328_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7347 12 46 2.130.10.10
af_E7F602_65_468_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7175 19 49 2.130.10.10
af_Q24050_1_182_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7167 25 50 3.40.50.300
af_A0A2R8QDB2_1_107_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.7129 10 46 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A537XEI0-F1-model_v4 DUF1385 domain-containing protein 0.935 1 265
AF-A0A7V8ZD49-F1-model_v4 DUF1385 domain-containing protein 0.9298 3 265
AF-A0A838V573-F1-model_v4 DUF1385 domain-containing protein 0.9291 102 265
AF-A0A1M3BJT9-F1-model_v4 DUF1385 domain-containing protein 0.929 1 266
AF-A0A1M3BJT9-F1-model_v4 DUF1385 domain-containing protein 0.9257 1 266

Map