F416391

General Info

Members Datasets Scaffolds Average Seq Length
345 224 690 323

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10128726|Ga0157379_101287262
Length 347
Sequence MAATAARRTRLRCAERREESDVQYVNLGDTGLRVSRVCLGMMSFGAHESRRWSLAEEEAAPIIRRAVEGGITFFDTADVYNGGESEVVTGNVLPKLLTREEMVVATKVCMRTMPGENGRGLSRKHVMASIDGSLRRLGMDYVDLYQIHRWDPLTPVAETMEALHDVVKAGKARYIGASSMFAWQFGKAQAAAEHRGGTRFVSMQNHYNLVYREEEREMIPQCVDGGVAVLPWSPLARGLLAGNRTREGERRTTRAESDPFGDALYVPEIDFDVIDRVVEVASERGVPSARVALAWLLGRPGVTAPIVGATKPEHVDDAVAAVEVALTADEIVRLEEPYVPHAVSGHE

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
78 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
122 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
146 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
159 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
224 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.87
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 9.28
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10128726 3300014968 Bacteria 2278
2 CNXas_1000156 3300000545 Bacteria 11591
3 JGI25406J46586_10021441 3300003203 Bacteria 2593
4 Ga0070658_10006884 3300005327 Bacteria 9187
5 Ga0070683_100001297 3300005329 Bacteria 19040
6 Ga0070683_100005978 3300005329 Bacteria 10189
7 Ga0070680_100014599 3300005336 Bacteria 6143
8 Ga0068868_100186528 3300005338 Bacteria 1723
9 Ga0070660_100036330 3300005339 Bacteria 3731
10 Ga0070660_100136742 3300005339 Bacteria 1963
11 Ga0070689_100161025 3300005340 Bacteria 1814
12 Ga0070689_100259580 3300005340 Bacteria 1436
13 Ga0070669_100286707 3300005353 Bacteria 1321
14 Ga0070671_100292772 3300005355 Bacteria 1386
15 Ga0070674_100019480 3300005356 Bacteria 4310
16 Ga0070688_100169423 3300005365 Bacteria 1506
17 Ga0070667_100080869 3300005367 Bacteria 2780
18 Ga0070714_100022650 3300005435 Bacteria 5151
19 Ga0070714_100169371 3300005435 Bacteria 1981
20 Ga0070714_100279137 3300005435 Bacteria 1551
21 Ga0070713_100091491 3300005436 Bacteria 2617
22 Ga0070710_10130303 3300005437 Bacteria 1533
23 Ga0070705_100168844 3300005440 Bacteria 1470
24 Ga0070700_100064339 3300005441 Bacteria 2323
25 Ga0070700_100124540 3300005441 Bacteria 1731
26 Ga0070708_100309210 3300005445 Bacteria 1488
27 Ga0070678_100005555 3300005456 Bacteria 7311
28 Ga0070678_100249361 3300005456 Bacteria 1488
29 Ga0070706_100048809 3300005467 Bacteria 3906
30 Ga0070706_100098103 3300005467 Bacteria 2722
31 Ga0070706_100100965 3300005467 Bacteria 2681
32 Ga0070707_100067123 3300005468 Bacteria 3449
33 Ga0070707_100075829 3300005468 Bacteria 3244
34 Ga0070707_100087114 3300005468 Bacteria 3020
35 Ga0070698_100023657 3300005471 Bacteria 6418
36 Ga0070699_100107659 3300005518 Bacteria 2446
37 Ga0070679_100481344 3300005530 Bacteria 1185
38 Ga0070684_100014440 3300005535 Bacteria 6399
39 Ga0070684_100075500 3300005535 Bacteria 2973
40 Ga0070697_100015455 3300005536 Bacteria 5992
41 Ga0068853_100032285 3300005539 Bacteria 4434
42 Ga0070672_100157052 3300005543 Bacteria 1884
43 Ga0070693_100129837 3300005547 Bacteria 1574
44 Ga0070704_100048605 3300005549 Bacteria 2970
45 Ga0068855_100068592 3300005563 Bacteria 4128
46 Ga0068854_100013443 3300005578 Bacteria 5374
47 Ga0068854_100023538 3300005578 Bacteria 4209
48 Ga0068856_100107866 3300005614 Bacteria 2781
49 Ga0070702_100158703 3300005615 Bacteria 1460
50 Ga0068870_10026244 3300005840 Bacteria 2903
51 Ga0068863_100161360 3300005841 Bacteria 2148
52 Ga0068858_100193744 3300005842 Bacteria 1920
53 Ga0068860_100080762 3300005843 Bacteria 3092
54 Ga0081455_10023274 3300005937 Bacteria 5768
55 Ga0081455_10025358 3300005937 Bacteria 5474
56 Ga0081538_10000255 3300005981 Bacteria 60411
57 Ga0081538_10002389 3300005981 Bacteria 18436
58 Ga0081538_10036251 3300005981 Bacteria 3222
59 Ga0081540_1038661 3300005983 Bacteria 2513
60 Ga0081539_10000957 3300005985 Bacteria 54155
61 Ga0081539_10006225 3300005985 Bacteria 11569
62 Ga0070717_10017766 3300006028 Bacteria 5540
63 Ga0070717_10074546 3300006028 Bacteria 2837
64 Ga0075365_10185273 3300006038 Bacteria 1456
65 Ga0070716_100238545 3300006173 Bacteria 1232
66 Ga0070712_100011707 3300006175 Bacteria 5573
67 Ga0070712_100023663 3300006175 Bacteria 4061
68 Ga0068871_100127076 3300006358 Bacteria 2159
69 Ga0075433_10105374 3300006852 Bacteria 2498
70 Ga0075433_10125022 3300006852 Bacteria 2284
71 Ga0075433_10308205 3300006852 Bacteria 1401
72 Ga0075434_100105454 3300006871 Bacteria 2829
73 Ga0075434_100384944 3300006871 Bacteria 1423
74 Ga0068865_100020231 3300006881 Bacteria 4316
75 Ga0075436_100042185 3300006914 Bacteria 3146
76 Ga0105251_10000655 3300009011 Bacteria 31924
77 Ga0105244_10001531 3300009036 Bacteria 18448
78 Ga0105250_10000025 3300009092 Bacteria 215424
79 Ga0111539_10061584 3300009094 Bacteria 4445
80 Ga0111539_10155589 3300009094 Bacteria 2675
81 Ga0105245_10188380 3300009098 Bacteria 1975
82 Ga0105247_10072079 3300009101 Bacteria 2162
83 Ga0114129_10154591 3300009147 Bacteria 3138
84 Ga0114129_10221335 3300009147 Bacteria 2553
85 Ga0114129_10591625 3300009147 Bacteria 1438
86 Ga0114129_10673177 3300009147 Bacteria 1333
87 Ga0105243_10018164 3300009148 Bacteria 5323
88 Ga0105243_10021531 3300009148 Bacteria 4895
89 Ga0105243_10079643 3300009148 Bacteria 2670
90 Ga0105241_10416257 3300009174 Bacteria 1182
91 Ga0105242_10035922 3300009176 Bacteria 3973
92 Ga0105242_10189677 3300009176 Bacteria 1819
93 Ga0105249_10646588 3300009553 Bacteria 1115
94 Ga0105239_10081651 3300010375 Bacteria 3558
95 Ga0105246_10108559 3300011119 Bacteria 2034
96 Ga0157370_10459286 3300013104 Bacteria 1171
97 Ga0157369_10096216 3300013105 Bacteria 3159
98 Ga0157378_10307515 3300013297 Bacteria 1536
99 Ga0157375_10042467 3300013308 Bacteria 4401
100 Ga0157375_10305015 3300013308 Bacteria 1756
101 Ga0157375_10428408 3300013308 Bacteria 1489
102 Ga0163163_10197049 3300014325 Bacteria 2062
103 Ga0163163_10301294 3300014325 Bacteria 1655
104 Ga0157380_10006585 3300014326 Bacteria 8194
105 Ga0157377_10008914 3300014745 Bacteria 4908
106 Ga0157376_10310770 3300014969 Bacteria 1495
107 Ga0206356_10079064 3300020070 Bacteria 7536
108 Ga0206354_11532482 3300020081 Bacteria 1750
109 Ga0213875_10030488 3300021388 Bacteria 2552
110 Ga0224712_10015006 3300022467 Bacteria 2512
111 Ga0207696_1000007 3300025711 Bacteria 578417
112 Ga0207655_1006115 3300025728 Bacteria 8034
113 Ga0207713_1000005 3300025735 Bacteria 649958
114 Ga0207692_10091420 3300025898 Bacteria 1651
115 Ga0207710_10029556 3300025900 Bacteria 2386
116 Ga0207688_10090005 3300025901 Bacteria 1761
117 Ga0207699_10104024 3300025906 Bacteria 1807
118 Ga0207705_10183065 3300025909 Bacteria 1582
119 Ga0207684_10008011 3300025910 Bacteria 9437
120 Ga0207684_10013755 3300025910 Bacteria 6990
121 Ga0207684_10040044 3300025910 Bacteria 3972
122 Ga0207707_10097890 3300025912 Bacteria 2564
123 Ga0207707_10130896 3300025912 Bacteria 2194
124 Ga0207693_10000696 3300025915 Bacteria 30225
125 Ga0207693_10008148 3300025915 Bacteria 8587
126 Ga0207663_10002309 3300025916 Bacteria 9138
127 Ga0207662_10017213 3300025918 Bacteria 4087
128 Ga0207662_10141758 3300025918 Bacteria 1523
129 Ga0207657_10004284 3300025919 Bacteria 15117
130 Ga0207657_10118252 3300025919 Bacteria 2182
131 Ga0207646_10056349 3300025922 Bacteria 3513
132 Ga0207646_10056834 3300025922 Bacteria 3497
133 Ga0207646_10176057 3300025922 Bacteria 1932
134 Ga0207650_10111810 3300025925 Bacteria 2115
135 Ga0207659_10013778 3300025926 Bacteria 5194
136 Ga0207659_10097995 3300025926 Bacteria 2204
137 Ga0207700_10013371 3300025928 Bacteria 5337
138 Ga0207700_10297535 3300025928 Bacteria 1392
139 Ga0207664_10037031 3300025929 Bacteria 3773
140 Ga0207664_10052648 3300025929 Bacteria 3220
141 Ga0207664_10221426 3300025929 Bacteria 1641
142 Ga0207664_10422412 3300025929 Bacteria 1188
143 Ga0207709_10005857 3300025935 Bacteria 6947
144 Ga0207670_10152503 3300025936 Bacteria 1716
145 Ga0207669_10228040 3300025937 Bacteria 1372
146 Ga0207669_10342908 3300025937 Bacteria 1151
147 Ga0207665_10019867 3300025939 Bacteria 4414
148 Ga0207665_10076093 3300025939 Bacteria 2301
149 Ga0207691_10073830 3300025940 Bacteria 3076
150 Ga0207661_10105141 3300025944 Bacteria 2378
151 Ga0207661_10235716 3300025944 Bacteria 1622
152 Ga0207658_10060757 3300025986 Bacteria 2821
153 Ga0207708_10002190 3300026075 Bacteria 14428
154 Ga0207708_10024995 3300026075 Bacteria 4518
155 Ga0207648_10190607 3300026089 Bacteria 1817
156 Ga0207676_10461546 3300026095 Bacteria 1199
157 Ga0207675_100091673 3300026118 Bacteria 2857
158 Ga0207675_100203771 3300026118 Bacteria 1900
159 Ga0207683_10139587 3300026121 Bacteria 2183
160 Ga0207428_10054931 3300027907 Bacteria 3169
161 Ga0265323_10040103 3300028653 Bacteria 1705
162 Ga0265332_10032045 3300031238 Bacteria 2292
163 Ga0307513_10284463 3300031456 Bacteria 1429
164 Ga0307405_10013397 3300031731 Bacteria 4372
165 Ga0307409_100014312 3300031995 Bacteria 5153
166 Ga0307409_100088621 3300031995 Bacteria 2527
167 Ga0307409_100337022 3300031995 Bacteria 1417
168 Ga0307416_100015161 3300032002 Bacteria 5311
169 Ga0307415_100001156 3300032126 Bacteria 12352
170 Ga0373934_0015357 3300035086 Bacteria 2904
171 Ga0373940_0007427 3300035088 Bacteria 2474
172 Ga0373951_0008890 3300035091 Bacteria 2265
173 Ga0373952_0016641 3300035092 Bacteria 1498
174 Ga0373932_0005852 3300035112 Bacteria 2896
175 Ga0373953_0026684 3300035117 Bacteria 2214
176 Ga0373953_0064349 3300035117 Bacteria 1504
177 Ga0373954_0004276 3300035118 Bacteria 6136
178 Ga0373956_0005324 3300035119 Bacteria 5151
179 Ga0373956_0069978 3300035119 Bacteria 1600
180 Ga0373955_0024857 3300035172 Bacteria 3068
181 Ga0373962_0031748 3300035242 Bacteria 1450
182 Ga0373924_0018663 3300035410 Bacteria 2676
183 Ga0373931_0151948 3300035691 Bacteria 1350
184 Ga0373927_0188503 3300035695 Bacteria 1353
185 Ga0373927_0241351 3300035695 Bacteria 1187
186 Ga0373933_0004282 3300035724 Bacteria 7842
187 Ga0373933_0006687 3300035724 Bacteria 6285
188 Ga0373933_0025851 3300035724 Bacteria 3368
189 Ga0373933_0082017 3300035724 Bacteria 1979
190 Ga0373937_0022628 3300036401 Bacteria 5652
191 Ga0373937_0070700 3300036401 Bacteria 3219
192 Ga0373937_0076485 3300036401 Bacteria 3091
193 Ga0373937_0103072 3300036401 Bacteria 2650
194 Ga0373925_0008213 3300037068 Bacteria 7600
195 Ga0395899_0077926 3300037312 Bacteria 2416
196 Ga0395899_0198260 3300037312 Bacteria 1401
197 Ga0395900_0044060 3300037418 Bacteria 4599
198 Ga0395900_0079714 3300037418 Bacteria 3365
199 Ga0395900_0348204 3300037418 Bacteria 1455
200 Ga0395898_0054320 3300037466 Bacteria 3909
201 Ga0395898_0060420 3300037466 Bacteria 3683
202 Ga0395898_0106029 3300037466 Bacteria 2695
203 Ga0395905_0116129 3300037471 Bacteria 2515
204 Ga0436364_0051728 3300037853 Bacteria 6071
205 Ga0436364_0307915 3300037853 Bacteria 12103
206 Ga0395901_0214056 3300038443 Bacteria 2015
207 Ga0436365_0048599 3300039437 Bacteria 3531
208 Ga0436365_1693132 3300039437 Bacteria 3690
209 Ga0436363_0559095 3300039450 Bacteria 1256
210 Ga0451807_1947199 3300041486 Bacteria 1165
211 Ga0439451_021505 3300042009 Bacteria 1301
212 Ga0466963_0021160 3300044694 Bacteria 4099
213 Ga0466963_0081701 3300044694 Bacteria 2189
214 Ga0466964_0023501 3300044706 Bacteria 2396
215 Ga0466968_0114430 3300044735 Bacteria 1216
216 Ga0466957_0283860 3300044842 Bacteria 1109
217 Ga0466958_0013995 3300045836 Bacteria 4575
218 Ga0466958_0232323 3300045836 Bacteria 1178
219 Ga0466967_0066804 3300045976 Bacteria 3205
220 Ga0466967_0077268 3300045976 Bacteria 2997
221 Ga0466967_0289571 3300045976 Bacteria 1573
222 Ga0495592_0143214 3300046454 Bacteria 1660
223 Ga0495592_0256154 3300046454 Bacteria 1154
224 Ga0495629_0124522 3300046459 Bacteria 1796
225 Ga0495629_0183086 3300046459 Bacteria 1451
226 Ga0495641_0050943 3300046461 Bacteria 1892
227 Ga0495651_0150303 3300046462 Bacteria 1679
228 Ga0495653_0053476 3300046463 Bacteria 3089
229 Ga0495650_0047952 3300046471 Bacteria 1783
230 Ga0495664_0257643 3300046477 Bacteria 1055
231 Ga0495596_0064093 3300046500 Bacteria 1430
232 Ga0495608_0014795 3300046511 Bacteria 5412
233 Ga0495608_0016366 3300046511 Bacteria 5131
234 Ga0495618_0022063 3300046514 Bacteria 3929
235 Ga0495618_0035642 3300046514 Bacteria 3123
236 Ga0495628_0060693 3300046516 Bacteria 2966
237 Ga0495628_0113721 3300046516 Bacteria 2080
238 Ga0495628_0117019 3300046516 Bacteria 2047
239 Ga0495628_0173418 3300046516 Bacteria 1634
240 Ga0495644_0032669 3300046523 Bacteria 1967
241 Ga0495663_0033680 3300046525 Bacteria 1531
242 Ga0495652_0071473 3300046529 Bacteria 2896
243 Ga0495652_0126317 3300046529 Bacteria 2031
244 Ga0495640_0068429 3300046533 Bacteria 2389
245 Ga0495587_0009480 3300046536 Bacteria 6238
246 Ga0495667_0010180 3300046559 Bacteria 6365
247 Ga0495667_0024372 3300046559 Bacteria 4074
248 Ga0495667_0044363 3300046559 Bacteria 2945
249 Ga0495667_0063434 3300046559 Bacteria 2418
250 Ga0495656_0130413 3300046615 Bacteria 1196
251 Ga0495634_0226868 3300046642 Bacteria 1151
252 Ga0495635_0057973 3300046663 Bacteria 2664
253 Ga0495635_0166316 3300046663 Bacteria 1501
254 Ga0495657_0016797 3300046675 Bacteria 5322
255 Ga0495657_0022268 3300046675 Bacteria 4542
256 Ga0495657_0056335 3300046675 Bacteria 2618
257 Ga0495599_0005242 3300046678 Bacteria 7733
258 Ga0495599_0046217 3300046678 Bacteria 2730
259 Ga0495623_0036362 3300046679 Bacteria 3155
260 Ga0495646_0038360 3300046680 Bacteria 2958
261 Ga0495658_0017958 3300046683 Bacteria 3668
262 Ga0495613_0228597 3300046689 Bacteria 1304
263 Ga0495600_0062079 3300046809 Bacteria 2441
264 Ga0495600_0150463 3300046809 Bacteria 1507
265 Ga0495581_0063748 3300047315 Bacteria 2129
266 Ga0495674_0024548 3300047319 Bacteria 5537
267 Ga0495674_0086653 3300047319 Bacteria 2681
268 Ga0495680_0013034 3300047322 Bacteria 7272
269 Ga0495680_0019716 3300047322 Bacteria 5689
270 Ga0495680_0036807 3300047322 Bacteria 3925
271 Ga0495680_0046730 3300047322 Bacteria 3411
272 Ga0495675_0069276 3300047444 Bacteria 2228
273 Ga0495679_030505 3300047446 Bacteria 1749
274 Ga0495684_0145512 3300047471 Bacteria 1775
275 Ga0495602_0010841 3300048088 Bacteria 9446
276 Ga0495602_0078119 3300048088 Bacteria 2797
277 Ga0496102_0030601 3300048905 Bacteria 4818
278 Ga0496103_0196758 3300048906 Bacteria 1296
279 Ga0496104_0067489 3300048907 Bacteria 3397
280 Ga0496105_0063493 3300048908 Bacteria 3046
281 Ga0496105_0113949 3300048908 Bacteria 2230
282 Ga0496105_0187943 3300048908 Bacteria 1690
283 Ga0496105_0226658 3300048908 Bacteria 1520
284 Ga0496106_0044116 3300048909 Bacteria 3346
285 Ga0496107_0063763 3300048910 Bacteria 2670
286 Ga0496107_0093825 3300048910 Bacteria 2195
287 Ga0496108_0050457 3300048911 Bacteria 3483
288 Ga0496108_0105673 3300048911 Bacteria 2404
289 Ga0496109_0031706 3300048912 Bacteria 4746
290 Ga0496109_0035103 3300048912 Bacteria 4521
291 Ga0496109_0098524 3300048912 Bacteria 2710
292 Ga0496109_0327652 3300048912 Bacteria 1446
293 Ga0496110_0080752 3300048913 Bacteria 2898
294 Ga0496110_0298373 3300048913 Bacteria 1468
295 Ga0496111_0093598 3300048914 Bacteria 2203
296 Ga0496111_0117155 3300048914 Bacteria 1965
297 Ga0496112_0000593 3300048915 Bacteria 24887
298 Ga0496112_0028822 3300048915 Bacteria 5363
299 Ga0496112_0364137 3300048915 Bacteria 1388
300 Ga0496113_0081452 3300048916 Bacteria 2481
301 Ga0496114_0031115 3300048917 Bacteria 4390
302 Ga0496114_0094422 3300048917 Bacteria 2544
303 Ga0496114_0153294 3300048917 Bacteria 1999
304 Ga0496114_0163361 3300048917 Bacteria 1938
305 Ga0496114_0188384 3300048917 Bacteria 1804
306 Ga0496115_0038675 3300048918 Bacteria 3786
307 Ga0496115_0055318 3300048918 Bacteria 3187
308 Ga0496117_0063396 3300048920 Bacteria 2527
309 Ga0496117_0077516 3300048920 Bacteria 2199
310 Ga0496119_0011927 3300048922 Bacteria 7128
311 Ga0496120_0008603 3300048923 Bacteria 7375
312 Ga0496122_0109995 3300048925 Bacteria 1812
313 Ga0496124_0254760 3300048927 Bacteria 1295
314 Ga0496126_0014176 3300048929 Bacteria 8068
315 Ga0496126_0017503 3300048929 Bacteria 7138
316 Ga0496126_0307306 3300048929 Bacteria 1306
317 Ga0501040_0193394 3300049576 Bacteria 1444
318 Ga0501042_0070840 3300049578 Bacteria 2494
319 Ga0501042_0270182 3300049578 Bacteria 1228
320 Ga0501047_0027160 3300049581 Bacteria 5514
321 Ga0501048_0353362 3300049582 Bacteria 1048
322 Ga0501075_0142004 3300049591 Bacteria 1830
323 Ga0501080_0249182 3300049742 Bacteria 1620
324 Ga0501081_0257511 3300049743 Bacteria 1275
325 Ga0501044_0306771 3300049823 Bacteria 1515
326 Ga0501045_0109236 3300049824 Bacteria 2050
327 nmdc:mga05p37_189457_c1 3300050507 Bacteria 2498
328 nmdc:mga05p37_23665_c1 3300050507 Bacteria 7456
329 nmdc:mga08y16_101607_c1 3300050511 Bacteria 2994
330 nmdc:mga0n895_33139_c1 3300050512 Bacteria 4963
331 nmdc:mga0n895_66530_c1 3300050512 Bacteria 3569
332 nmdc:mga0rr50_167396_c1 3300050513 Bacteria 1788
333 nmdc:mga0rr50_32522_c1 3300050513 Bacteria 3718
334 nmdc:mga08x19_34719_c1 3300050514 Bacteria 3189
335 nmdc:mga0a205_17052_c1 3300050515 Bacteria 6799
336 nmdc:mga0a205_22977_c1 3300050515 Bacteria 5913
337 Ga0495601_0065363 3300053077 Bacteria 2315
338 Ga0495601_0083118 3300053077 Bacteria 2056
339 Ga0495612_0055191 3300053078 Bacteria 1637
340 Ga0495595_0004057 3300053084 Bacteria 5863
341 Ga0495595_0068898 3300053084 Bacteria 1669
342 Ga0495619_0062653 3300053085 Bacteria 2476
343 Ga0495619_0177810 3300053085 Bacteria 1472
344 3003001688 3002998708 Bacteria 11715108
345 8053948639 8053945823 Bacteria 8962862
346 Ga0157379_10128726
347 CNXas_1000156
348 JGI25406J46586_10021441
349 Ga0070658_10006884
350 Ga0070683_100001297
351 Ga0070683_100005978
352 Ga0070680_100014599
353 Ga0068868_100186528
354 Ga0070660_100036330
355 Ga0070660_100136742
356 Ga0070689_100161025
357 Ga0070689_100259580
358 Ga0070669_100286707
359 Ga0070671_100292772
360 Ga0070674_100019480
361 Ga0070688_100169423
362 Ga0070667_100080869
363 Ga0070714_100022650
364 Ga0070714_100169371
365 Ga0070714_100279137
366 Ga0070713_100091491
367 Ga0070710_10130303
368 Ga0070705_100168844
369 Ga0070700_100064339
370 Ga0070700_100124540
371 Ga0070708_100309210
372 Ga0070678_100005555
373 Ga0070678_100249361
374 Ga0070706_100048809
375 Ga0070706_100098103
376 Ga0070706_100100965
377 Ga0070707_100067123
378 Ga0070707_100075829
379 Ga0070707_100087114
380 Ga0070698_100023657
381 Ga0070699_100107659
382 Ga0070679_100481344
383 Ga0070684_100014440
384 Ga0070684_100075500
385 Ga0070697_100015455
386 Ga0068853_100032285
387 Ga0070672_100157052
388 Ga0070693_100129837
389 Ga0070704_100048605
390 Ga0068855_100068592
391 Ga0068854_100013443
392 Ga0068854_100023538
393 Ga0068856_100107866
394 Ga0070702_100158703
395 Ga0068870_10026244
396 Ga0068863_100161360
397 Ga0068858_100193744
398 Ga0068860_100080762
399 Ga0081455_10023274
400 Ga0081455_10025358
401 Ga0081538_10000255
402 Ga0081538_10002389
403 Ga0081538_10036251
404 Ga0081540_1038661
405 Ga0081539_10000957
406 Ga0081539_10006225
407 Ga0070717_10017766
408 Ga0070717_10074546
409 Ga0075365_10185273
410 Ga0070716_100238545
411 Ga0070712_100011707
412 Ga0070712_100023663
413 Ga0068871_100127076
414 Ga0075433_10105374
415 Ga0075433_10125022
416 Ga0075433_10308205
417 Ga0075434_100105454
418 Ga0075434_100384944
419 Ga0068865_100020231
420 Ga0075436_100042185
421 Ga0105251_10000655
422 Ga0105244_10001531
423 Ga0105250_10000025
424 Ga0111539_10061584
425 Ga0111539_10155589
426 Ga0105245_10188380
427 Ga0105247_10072079
428 Ga0114129_10154591
429 Ga0114129_10221335
430 Ga0114129_10591625
431 Ga0114129_10673177
432 Ga0105243_10018164
433 Ga0105243_10021531
434 Ga0105243_10079643
435 Ga0105241_10416257
436 Ga0105242_10035922
437 Ga0105242_10189677
438 Ga0105249_10646588
439 Ga0105239_10081651
440 Ga0105246_10108559
441 Ga0157370_10459286
442 Ga0157369_10096216
443 Ga0157378_10307515
444 Ga0157375_10042467
445 Ga0157375_10305015
446 Ga0157375_10428408
447 Ga0163163_10197049
448 Ga0163163_10301294
449 Ga0157380_10006585
450 Ga0157377_10008914
451 Ga0157376_10310770
452 Ga0206356_10079064
453 Ga0206354_11532482
454 Ga0213875_10030488
455 Ga0224712_10015006
456 Ga0207696_1000007
457 Ga0207655_1006115
458 Ga0207713_1000005
459 Ga0207692_10091420
460 Ga0207710_10029556
461 Ga0207688_10090005
462 Ga0207699_10104024
463 Ga0207705_10183065
464 Ga0207684_10008011
465 Ga0207684_10013755
466 Ga0207684_10040044
467 Ga0207707_10097890
468 Ga0207707_10130896
469 Ga0207693_10000696
470 Ga0207693_10008148
471 Ga0207663_10002309
472 Ga0207662_10017213
473 Ga0207662_10141758
474 Ga0207657_10004284
475 Ga0207657_10118252
476 Ga0207646_10056349
477 Ga0207646_10056834
478 Ga0207646_10176057
479 Ga0207650_10111810
480 Ga0207659_10013778
481 Ga0207659_10097995
482 Ga0207700_10013371
483 Ga0207700_10297535
484 Ga0207664_10037031
485 Ga0207664_10052648
486 Ga0207664_10221426
487 Ga0207664_10422412
488 Ga0207709_10005857
489 Ga0207670_10152503
490 Ga0207669_10228040
491 Ga0207669_10342908
492 Ga0207665_10019867
493 Ga0207665_10076093
494 Ga0207691_10073830
495 Ga0207661_10105141
496 Ga0207661_10235716
497 Ga0207658_10060757
498 Ga0207708_10002190
499 Ga0207708_10024995
500 Ga0207648_10190607
501 Ga0207676_10461546
502 Ga0207675_100091673
503 Ga0207675_100203771
504 Ga0207683_10139587
505 Ga0207428_10054931
506 Ga0265323_10040103
507 Ga0265332_10032045
508 Ga0307513_10284463
509 Ga0307405_10013397
510 Ga0307409_100014312
511 Ga0307409_100088621
512 Ga0307409_100337022
513 Ga0307416_100015161
514 Ga0307415_100001156
515 Ga0373934_0015357
516 Ga0373940_0007427
517 Ga0373951_0008890
518 Ga0373952_0016641
519 Ga0373932_0005852
520 Ga0373953_0026684
521 Ga0373953_0064349
522 Ga0373954_0004276
523 Ga0373956_0005324
524 Ga0373956_0069978
525 Ga0373955_0024857
526 Ga0373962_0031748
527 Ga0373924_0018663
528 Ga0373931_0151948
529 Ga0373927_0188503
530 Ga0373927_0241351
531 Ga0373933_0004282
532 Ga0373933_0006687
533 Ga0373933_0025851
534 Ga0373933_0082017
535 Ga0373937_0022628
536 Ga0373937_0070700
537 Ga0373937_0076485
538 Ga0373937_0103072
539 Ga0373925_0008213
540 Ga0395899_0077926
541 Ga0395899_0198260
542 Ga0395900_0044060
543 Ga0395900_0079714
544 Ga0395900_0348204
545 Ga0395898_0054320
546 Ga0395898_0060420
547 Ga0395898_0106029
548 Ga0395905_0116129
549 Ga0436364_0051728
550 Ga0436364_0307915
551 Ga0395901_0214056
552 Ga0436365_0048599
553 Ga0436365_1693132
554 Ga0436363_0559095
555 Ga0451807_1947199
556 Ga0439451_021505
557 Ga0466963_0021160
558 Ga0466963_0081701
559 Ga0466964_0023501
560 Ga0466968_0114430
561 Ga0466957_0283860
562 Ga0466958_0013995
563 Ga0466958_0232323
564 Ga0466967_0066804
565 Ga0466967_0077268
566 Ga0466967_0289571
567 Ga0495592_0143214
568 Ga0495592_0256154
569 Ga0495629_0124522
570 Ga0495629_0183086
571 Ga0495641_0050943
572 Ga0495651_0150303
573 Ga0495653_0053476
574 Ga0495650_0047952
575 Ga0495664_0257643
576 Ga0495596_0064093
577 Ga0495608_0014795
578 Ga0495608_0016366
579 Ga0495618_0022063
580 Ga0495618_0035642
581 Ga0495628_0060693
582 Ga0495628_0113721
583 Ga0495628_0117019
584 Ga0495628_0173418
585 Ga0495644_0032669
586 Ga0495663_0033680
587 Ga0495652_0071473
588 Ga0495652_0126317
589 Ga0495640_0068429
590 Ga0495587_0009480
591 Ga0495667_0010180
592 Ga0495667_0024372
593 Ga0495667_0044363
594 Ga0495667_0063434
595 Ga0495656_0130413
596 Ga0495634_0226868
597 Ga0495635_0057973
598 Ga0495635_0166316
599 Ga0495657_0016797
600 Ga0495657_0022268
601 Ga0495657_0056335
602 Ga0495599_0005242
603 Ga0495599_0046217
604 Ga0495623_0036362
605 Ga0495646_0038360
606 Ga0495658_0017958
607 Ga0495613_0228597
608 Ga0495600_0062079
609 Ga0495600_0150463
610 Ga0495581_0063748
611 Ga0495674_0024548
612 Ga0495674_0086653
613 Ga0495680_0013034
614 Ga0495680_0019716
615 Ga0495680_0036807
616 Ga0495680_0046730
617 Ga0495675_0069276
618 Ga0495679_030505
619 Ga0495684_0145512
620 Ga0495602_0010841
621 Ga0495602_0078119
622 Ga0496102_0030601
623 Ga0496103_0196758
624 Ga0496104_0067489
625 Ga0496105_0063493
626 Ga0496105_0113949
627 Ga0496105_0187943
628 Ga0496105_0226658
629 Ga0496106_0044116
630 Ga0496107_0063763
631 Ga0496107_0093825
632 Ga0496108_0050457
633 Ga0496108_0105673
634 Ga0496109_0031706
635 Ga0496109_0035103
636 Ga0496109_0098524
637 Ga0496109_0327652
638 Ga0496110_0080752
639 Ga0496110_0298373
640 Ga0496111_0093598
641 Ga0496111_0117155
642 Ga0496112_0000593
643 Ga0496112_0028822
644 Ga0496112_0364137
645 Ga0496113_0081452
646 Ga0496114_0031115
647 Ga0496114_0094422
648 Ga0496114_0153294
649 Ga0496114_0163361
650 Ga0496114_0188384
651 Ga0496115_0038675
652 Ga0496115_0055318
653 Ga0496117_0063396
654 Ga0496117_0077516
655 Ga0496119_0011927
656 Ga0496120_0008603
657 Ga0496122_0109995
658 Ga0496124_0254760
659 Ga0496126_0014176
660 Ga0496126_0017503
661 Ga0496126_0307306
662 Ga0501040_0193394
663 Ga0501042_0070840
664 Ga0501042_0270182
665 Ga0501047_0027160
666 Ga0501048_0353362
667 Ga0501075_0142004
668 Ga0501080_0249182
669 Ga0501081_0257511
670 Ga0501044_0306771
671 Ga0501045_0109236
672 nmdc:mga05p37_189457_c1
673 nmdc:mga05p37_23665_c1
674 nmdc:mga08y16_101607_c1
675 nmdc:mga0n895_33139_c1
676 nmdc:mga0n895_66530_c1
677 nmdc:mga0rr50_167396_c1
678 nmdc:mga0rr50_32522_c1
679 nmdc:mga08x19_34719_c1
680 nmdc:mga0a205_17052_c1
681 nmdc:mga0a205_22977_c1
682 Ga0495601_0065363
683 Ga0495601_0083118
684 Ga0495612_0055191
685 Ga0495595_0004057
686 Ga0495595_0068898
687 Ga0495619_0062653
688 Ga0495619_0177810
689 3003001688
690 8053948639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

36

338

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9651 1 319
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9635 1 319
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9587 1 319
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9494 1 319
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.9343 1 316
ID Description Score Start End Superfamily
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9582 1 319 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9577 1 324 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9548 1 324 3.20.20.100
af_Q02895_4_341_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9324 1 319 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.93 1 316 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.989 112 212 GO:0005829
GO:0016491
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9883 1 211 GO:0005829
GO:0016491
AF-A0A3M1Z231-F1-model_v4 Aldo/keto reductase 0.9837 1 211 GO:0005829
GO:0016491
AF-A0A531LSG7-F1-model_v4 Aldo/keto reductase 0.9824 108 223 GO:0005829
GO:0016491
AF-A0A817MNW5-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9811 1 155 GO:0005829

Map